Bombyx BLAST Result against mosquito

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= bmnc10c21
         (303 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY705394-1|AAU12503.1|  557|Anopheles gambiae nicotinic acetylch...    25   0.63 
AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/T...    24   1.1  
AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/T...    24   1.1  
CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transpos...    21   7.8  
AY745221-1|AAU93488.1|   95|Anopheles gambiae cytochrome P450 pr...    21   7.8  

>AY705394-1|AAU12503.1|  557|Anopheles gambiae nicotinic
           acetylcholine receptor subunitalpha 1 protein.
          Length = 557

 Score = 25.0 bits (52), Expect = 0.63
 Identities = 14/48 (29%), Positives = 27/48 (56%), Gaps = 3/48 (6%)
 Frame = -3

Query: 145 EKHTLCRGIV---TIYFIAIITMFLCLSSTVPKTRRIRMLAMVVLTLT 11
           EK +LC  I+   T++F+ +  +    S TVP   +  +  M+++TL+
Sbjct: 269 EKISLCISILLSLTVFFLLLAEIIPPTSLTVPLLGKYLLFTMMLVTLS 316


>AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/Thr
            phosphatase protein.
          Length = 1977

 Score = 24.2 bits (50), Expect = 1.1
 Identities = 6/12 (50%), Positives = 9/12 (75%)
 Frame = +2

Query: 80   KEHCNNCNEIYC 115
            K HC +C +I+C
Sbjct: 1824 KHHCRSCGQIFC 1835


>AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/Thr
            phosphatase protein.
          Length = 1978

 Score = 24.2 bits (50), Expect = 1.1
 Identities = 6/12 (50%), Positives = 9/12 (75%)
 Frame = +2

Query: 80   KEHCNNCNEIYC 115
            K HC +C +I+C
Sbjct: 1825 KHHCRSCGQIFC 1836


>CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transposon
           polyprotein protein.
          Length = 1726

 Score = 21.4 bits (43), Expect = 7.8
 Identities = 7/16 (43%), Positives = 11/16 (68%)
 Frame = -1

Query: 84  SFVCRQLSRKHGVFVC 37
           ++VC+Q  RKH   +C
Sbjct: 393 TYVCQQCKRKHHSKLC 408


>AY745221-1|AAU93488.1|   95|Anopheles gambiae cytochrome P450
           protein.
          Length = 95

 Score = 21.4 bits (43), Expect = 7.8
 Identities = 6/9 (66%), Positives = 7/9 (77%)
 Frame = +3

Query: 174 KKICQCFVC 200
           K +CQCF C
Sbjct: 17  KLLCQCFTC 25


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 271,490
Number of Sequences: 2352
Number of extensions: 5881
Number of successful extensions: 11
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 10
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 11
length of database: 563,979
effective HSP length: 55
effective length of database: 434,619
effective search space used: 19557855
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)