SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120043.Seq
         (810 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CR954256-9|CAJ14150.1|  872|Anopheles gambiae putative calcium/c...    30   0.073
AY146729-1|AAO12089.1|  156|Anopheles gambiae odorant-binding pr...    24   6.4  
CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel...    23   8.4  

>CR954256-9|CAJ14150.1|  872|Anopheles gambiae putative
           calcium/calmodulin-dependentprotein kinase, CAKI
           protein.
          Length = 872

 Score = 30.3 bits (65), Expect = 0.073
 Identities = 18/75 (24%), Positives = 38/75 (50%), Gaps = 3/75 (4%)
 Frame = -3

Query: 217 MNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQ--IKGELSHQLVS-NIIRQLCEA 47
           M  HP+ +++   +       +V D       FE ++  + G +  + V+ + +RQ+ EA
Sbjct: 48  MLKHPHIVELLETYSSEGMLYMVFDMEGSDICFEVVRRAVAGFVYSEAVACHYLRQILEA 107

Query: 46  LNDLHKHNFIHNDIK 2
           L   H+++ IH D++
Sbjct: 108 LRYCHENDIIHRDVR 122


>AY146729-1|AAO12089.1|  156|Anopheles gambiae odorant-binding
           protein AgamOBP5 protein.
          Length = 156

 Score = 23.8 bits (49), Expect = 6.4
 Identities = 5/5 (100%), Positives = 5/5 (100%)
 Frame = +2

Query: 407 WRWWW 421
           WRWWW
Sbjct: 10  WRWWW 14


>CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal
            structural protein protein.
          Length = 1645

 Score = 23.4 bits (48), Expect = 8.4
 Identities = 6/9 (66%), Positives = 7/9 (77%)
 Frame = -1

Query: 432  IRHGHHHRH 406
            + HGHHH H
Sbjct: 1318 LHHGHHHHH 1326


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 776,638
Number of Sequences: 2352
Number of extensions: 15407
Number of successful extensions: 37
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 37
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 37
length of database: 563,979
effective HSP length: 63
effective length of database: 415,803
effective search space used: 85655418
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -