SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120042.Seq
         (745 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ549085-1|CAD70159.1|  529|Anopheles gambiae thioredoxin-disulf...    28   0.35 
AJ549084-1|CAD70158.1|  505|Anopheles gambiae thioredoxin-disulf...    28   0.35 
AJ459821-1|CAD30858.1|  502|Anopheles gambiae thioredoxin reduct...    28   0.35 
DQ342048-1|ABC69940.1|  847|Anopheles gambiae STIP protein.            25   2.5  
AB097127-1|BAC82595.1| 1209|Anopheles gambiae reverse transcript...    25   3.3  
DQ004399-1|AAY21238.1|  847|Anopheles gambiae lysozyme c-6 protein.    23   10.0 

>AJ549085-1|CAD70159.1|  529|Anopheles gambiae thioredoxin-disulfide
           reductase protein.
          Length = 529

 Score = 27.9 bits (59), Expect = 0.35
 Identities = 15/34 (44%), Positives = 21/34 (61%)
 Frame = +3

Query: 417 FRSVDEAGEHNMGVLKIIIDTVIKYIGKLAETST 518
           + +VDEAG    G  + + DTV+  IG+ AET T
Sbjct: 295 YETVDEAGTATNG--EDVFDTVLFAIGRQAETGT 326


>AJ549084-1|CAD70158.1|  505|Anopheles gambiae thioredoxin-disulfide
           reductase protein.
          Length = 505

 Score = 27.9 bits (59), Expect = 0.35
 Identities = 15/34 (44%), Positives = 21/34 (61%)
 Frame = +3

Query: 417 FRSVDEAGEHNMGVLKIIIDTVIKYIGKLAETST 518
           + +VDEAG    G  + + DTV+  IG+ AET T
Sbjct: 271 YETVDEAGTATNG--EDVFDTVLFAIGRQAETGT 302


>AJ459821-1|CAD30858.1|  502|Anopheles gambiae thioredoxin reductase
           protein.
          Length = 502

 Score = 27.9 bits (59), Expect = 0.35
 Identities = 15/34 (44%), Positives = 21/34 (61%)
 Frame = +3

Query: 417 FRSVDEAGEHNMGVLKIIIDTVIKYIGKLAETST 518
           + +VDEAG    G  + + DTV+  IG+ AET T
Sbjct: 268 YETVDEAGTATNG--EDVFDTVLFAIGRQAETGT 299


>DQ342048-1|ABC69940.1|  847|Anopheles gambiae STIP protein.
          Length = 847

 Score = 25.0 bits (52), Expect = 2.5
 Identities = 12/31 (38%), Positives = 16/31 (51%), Gaps = 4/31 (12%)
 Frame = +1

Query: 109 LDLCASVKLTP----FKPMRPPKPMQCWIHP 189
           L+    VKLT     + P+    P+ CWIHP
Sbjct: 542 LEQIVLVKLTAAVIEWDPLTDTVPIHCWIHP 572


>AB097127-1|BAC82595.1| 1209|Anopheles gambiae reverse transcriptase
           protein.
          Length = 1209

 Score = 24.6 bits (51), Expect = 3.3
 Identities = 17/69 (24%), Positives = 27/69 (39%)
 Frame = +2

Query: 509 DEYILIADRMYVDLIYSEFRAIILPQSAYIIKGDYAESDSESGQSVDVCNELQYPWNLIT 688
           D +   A ++ +  +Y   RAIILP+    IK +      E        + +    N I 
Sbjct: 129 DRFPRFAHQLDLSKLYIRQRAIILPEELEFIKLEVRREFGEEEAGWRESSRISARLNTID 188

Query: 689 ANSFNVSTD 715
            N+   S D
Sbjct: 189 QNTSRASED 197


>DQ004399-1|AAY21238.1|  847|Anopheles gambiae lysozyme c-6 protein.
          Length = 847

 Score = 23.0 bits (47), Expect = 10.0
 Identities = 9/30 (30%), Positives = 15/30 (50%)
 Frame = -3

Query: 551 LNRHTCGPLSKCTRLGQFANVLDDRIDDDL 462
           ++R+ C        L     +LDD +DDD+
Sbjct: 79  IDRYACARYGSICGLATCNLLLDDELDDDI 108


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 703,513
Number of Sequences: 2352
Number of extensions: 14949
Number of successful extensions: 74
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 73
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 74
length of database: 563,979
effective HSP length: 63
effective length of database: 415,803
effective search space used: 76507752
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -