SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120040.Seq
         (757 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY578810-1|AAT07315.1|  897|Anopheles gambiae smurf protein.           24   4.4  
AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein.            24   5.8  
AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein.            24   5.8  

>AY578810-1|AAT07315.1|  897|Anopheles gambiae smurf protein.
          Length = 897

 Score = 24.2 bits (50), Expect = 4.4
 Identities = 9/21 (42%), Positives = 13/21 (61%)
 Frame = +2

Query: 350 QYFKDEHYSVSCQNGSVLKSK 412
           QY +D+HYS+     S LK +
Sbjct: 556 QYSRDDHYSLQINPDSYLKQR 576


>AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein.
          Length = 3320

 Score = 23.8 bits (49), Expect = 5.8
 Identities = 13/45 (28%), Positives = 19/45 (42%)
 Frame = +2

Query: 224  SYTKRYAQEQHLRDRIKSKVDEQFDQLEREYSDKIDGFHDNIQYF 358
            SY K +  + HL   +    D    QL   Y ++ D F   I +F
Sbjct: 1819 SYVKTHHGDHHLTTYMYDTNDRLVLQLPPAYHEQADTFSRTIPFF 1863


>AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein.
          Length = 3318

 Score = 23.8 bits (49), Expect = 5.8
 Identities = 13/45 (28%), Positives = 19/45 (42%)
 Frame = +2

Query: 224  SYTKRYAQEQHLRDRIKSKVDEQFDQLEREYSDKIDGFHDNIQYF 358
            SY K +  + HL   +    D    QL   Y ++ D F   I +F
Sbjct: 1820 SYVKTHHGDHHLTTYMYDTNDRLVLQLPPAYHEQADTFSRTIPFF 1864


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 783,941
Number of Sequences: 2352
Number of extensions: 16689
Number of successful extensions: 21
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 19
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 21
length of database: 563,979
effective HSP length: 63
effective length of database: 415,803
effective search space used: 78170964
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -