SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120039.Seq
         (672 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ439353-11|CAD27933.1|  615|Anopheles gambiae 30E5.11 protein.        27   0.41 
AY341195-1|AAR13759.1|  294|Anopheles gambiae laminin protein.         23   8.8  
AY341194-1|AAR13758.1|  294|Anopheles gambiae laminin protein.         23   8.8  
AY341193-1|AAR13757.1|  294|Anopheles gambiae laminin protein.         23   8.8  
AY341192-1|AAR13756.1|  294|Anopheles gambiae laminin protein.         23   8.8  
AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 pr...    23   8.8  

>AJ439353-11|CAD27933.1|  615|Anopheles gambiae 30E5.11 protein.
          Length = 615

 Score = 27.5 bits (58), Expect = 0.41
 Identities = 20/105 (19%), Positives = 57/105 (54%), Gaps = 3/105 (2%)
 Frame = +3

Query: 153 QTFMKKTKAKPRAKNQQTLLDIIAKFNQGNKAKAKVPVTRAKKMPLRNQ-QFKQMGKFQQ 329
           Q   ++ K +  A+ QQ+L ++I    +  + + +  +  +K+M  +N  +  +M + ++
Sbjct: 260 QQLQRQRKQELIAEEQQSL-EVIEGEMRRQQEQDRAALEASKEMRRKNALEAIRMAEDRR 318

Query: 330 --LRKKLKVQILVAPMMSHQNRHLSPTKQLKNLTLHQLRNKNHQM 458
             LR++ +++  +  +     ++++  KQ  ++  H+LR+ +HQ+
Sbjct: 319 TRLRRESEIEDALLQIYCEGQQNIASFKQAIHVNKHRLRDNSHQL 363


>AY341195-1|AAR13759.1|  294|Anopheles gambiae laminin protein.
          Length = 294

 Score = 23.0 bits (47), Expect = 8.8
 Identities = 19/73 (26%), Positives = 34/73 (46%)
 Frame = +3

Query: 63  NFKMNLTTEIQADVNSLVHQYLEKIDKSLAQTFMKKTKAKPRAKNQQTLLDIIAKFNQGN 242
           N + N+T E+   ++S + Q  EK++     T    T+A  R  N +  L + A  N+  
Sbjct: 92  NQQANITKELDTSISSEIAQAREKLNTVSKLTEQALTRA--REVNDEA-LTLFAAVNR-- 146

Query: 243 KAKAKVPVTRAKK 281
            A   + + + KK
Sbjct: 147 TAPPNIDIDKIKK 159


>AY341194-1|AAR13758.1|  294|Anopheles gambiae laminin protein.
          Length = 294

 Score = 23.0 bits (47), Expect = 8.8
 Identities = 19/73 (26%), Positives = 34/73 (46%)
 Frame = +3

Query: 63  NFKMNLTTEIQADVNSLVHQYLEKIDKSLAQTFMKKTKAKPRAKNQQTLLDIIAKFNQGN 242
           N + N+T E+   ++S + Q  EK++     T    T+A  R  N +  L + A  N+  
Sbjct: 92  NQQANITKELDTSISSEIAQAREKLNTVSKLTEQALTRA--REVNDEA-LTLFAAVNR-- 146

Query: 243 KAKAKVPVTRAKK 281
            A   + + + KK
Sbjct: 147 TAPPNIDIDKIKK 159


>AY341193-1|AAR13757.1|  294|Anopheles gambiae laminin protein.
          Length = 294

 Score = 23.0 bits (47), Expect = 8.8
 Identities = 19/73 (26%), Positives = 34/73 (46%)
 Frame = +3

Query: 63  NFKMNLTTEIQADVNSLVHQYLEKIDKSLAQTFMKKTKAKPRAKNQQTLLDIIAKFNQGN 242
           N + N+T E+   ++S + Q  EK++     T    T+A  R  N +  L + A  N+  
Sbjct: 92  NQQANITKELDTSISSEIAQAREKLNTVSKLTEQALTRA--REVNDEA-LTLFAAVNR-- 146

Query: 243 KAKAKVPVTRAKK 281
            A   + + + KK
Sbjct: 147 TAPPNIDIDKIKK 159


>AY341192-1|AAR13756.1|  294|Anopheles gambiae laminin protein.
          Length = 294

 Score = 23.0 bits (47), Expect = 8.8
 Identities = 19/73 (26%), Positives = 34/73 (46%)
 Frame = +3

Query: 63  NFKMNLTTEIQADVNSLVHQYLEKIDKSLAQTFMKKTKAKPRAKNQQTLLDIIAKFNQGN 242
           N + N+T E+   ++S + Q  EK++     T    T+A  R  N +  L + A  N+  
Sbjct: 92  NQQANITKELDTSISSEIAQAREKLNTVSKLTEQALTRA--REVNDEA-LTLFAAVNR-- 146

Query: 243 KAKAKVPVTRAKK 281
            A   + + + KK
Sbjct: 147 TAPPNIDIDKIKK 159


>AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1
            precursor protein.
          Length = 1623

 Score = 23.0 bits (47), Expect = 8.8
 Identities = 19/73 (26%), Positives = 34/73 (46%)
 Frame = +3

Query: 63   NFKMNLTTEIQADVNSLVHQYLEKIDKSLAQTFMKKTKAKPRAKNQQTLLDIIAKFNQGN 242
            N + N+T E+   ++S + Q  EK++     T    T+A  R  N +  L + A  N+  
Sbjct: 1231 NQQANITKELDTSISSEIAQAREKLNTVSKLTEQALTRA--REVNDEA-LTLFAAVNR-- 1285

Query: 243  KAKAKVPVTRAKK 281
             A   + + + KK
Sbjct: 1286 TAPPNIDIDKIKK 1298


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 530,583
Number of Sequences: 2352
Number of extensions: 8651
Number of successful extensions: 19
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 19
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 19
length of database: 563,979
effective HSP length: 62
effective length of database: 418,155
effective search space used: 67322955
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -