SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120036.Seq
         (735 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein.            25   3.2  
EF588645-1|ABQ96833.1|  161|Anopheles gambiae transposase protein.     24   5.6  
EF588613-1|ABQ96804.1|  161|Anopheles gambiae transposase protein.     24   5.6  
AJ821850-1|CAH25390.1|  426|Anopheles gambiae alpha-2,6-sialyltr...    23   9.8  

>AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein.
          Length = 3361

 Score = 24.6 bits (51), Expect = 3.2
 Identities = 13/56 (23%), Positives = 29/56 (51%)
 Frame = +1

Query: 190  KLDHTVINVYILYLCHVIYRMCRSIPESEDKIGDKLDLKKSTKTVPKVFYTARNVI 357
            +L H +++ Y+     +I  M R+IP +   +G K++         +VF+ A+ ++
Sbjct: 2905 RLYHGILDAYVTASFTMI--MVRNIPNTIKSLGRKIETGLDRLAETEVFFRAKQLM 2958


>EF588645-1|ABQ96833.1|  161|Anopheles gambiae transposase protein.
          Length = 161

 Score = 23.8 bits (49), Expect = 5.6
 Identities = 12/29 (41%), Positives = 14/29 (48%)
 Frame = -1

Query: 123 NYKTFFELFHKNVCFRKKNTPFTITIQGD 37
           N K    L HK V + K+N P   TI  D
Sbjct: 41  NLKRDLNLVHKTVPYLKQNQPIPQTINID 69


>EF588613-1|ABQ96804.1|  161|Anopheles gambiae transposase protein.
          Length = 161

 Score = 23.8 bits (49), Expect = 5.6
 Identities = 12/29 (41%), Positives = 14/29 (48%)
 Frame = -1

Query: 123 NYKTFFELFHKNVCFRKKNTPFTITIQGD 37
           N K    L HK V + K+N P   TI  D
Sbjct: 41  NLKRDLNLVHKTVPYLKQNQPIPQTINID 69


>AJ821850-1|CAH25390.1|  426|Anopheles gambiae
           alpha-2,6-sialyltransferase protein.
          Length = 426

 Score = 23.0 bits (47), Expect = 9.8
 Identities = 10/23 (43%), Positives = 15/23 (65%)
 Frame = +1

Query: 19  IKILSFITLYSNCKRSIFFTKTN 87
           I ILSF  + +  +RS+F+ K N
Sbjct: 39  IAILSFNVVQARERRSVFYVKHN 61


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 730,387
Number of Sequences: 2352
Number of extensions: 14138
Number of successful extensions: 46
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 46
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 46
length of database: 563,979
effective HSP length: 63
effective length of database: 415,803
effective search space used: 75260343
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -