SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120035.Seq
         (749 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ439060-11|CAD27762.1| 1881|Anopheles gambiae putative cell-adh...    27   0.82 
AY183375-1|AAO24765.1|  679|Anopheles gambiae NADPH cytochrome P...    25   3.3  
AF364130-1|AAL35506.1|  417|Anopheles gambiae putative odorant r...    24   4.4  

>AJ439060-11|CAD27762.1| 1881|Anopheles gambiae putative cell-adhesion
            protein protein.
          Length = 1881

 Score = 26.6 bits (56), Expect = 0.82
 Identities = 15/53 (28%), Positives = 24/53 (45%), Gaps = 3/53 (5%)
 Frame = +3

Query: 3    DIGGDTIVNNQTTMTQ---INFNASYTSAPTPSRASFDNGYSEFCDKQQPNDY 152
            D  G+ +V N+    +   +NF+       TP RASF   + +  D+   N Y
Sbjct: 1007 DETGEIVVRNRIDHEEYSWLNFSVRAADTGTPPRASFVEVFVQVLDENDNNPY 1059


>AY183375-1|AAO24765.1|  679|Anopheles gambiae NADPH cytochrome P450
           reductase protein.
          Length = 679

 Score = 24.6 bits (51), Expect = 3.3
 Identities = 6/23 (26%), Positives = 16/23 (69%)
 Frame = +3

Query: 117 SEFCDKQQPNDYLNYYNNPTPDG 185
           +E+C +++  ++L + ++  PDG
Sbjct: 393 AEYCGEEKDKEFLRFISSTAPDG 415


>AF364130-1|AAL35506.1|  417|Anopheles gambiae putative odorant
           receptor Or1 protein.
          Length = 417

 Score = 24.2 bits (50), Expect = 4.4
 Identities = 7/16 (43%), Positives = 11/16 (68%)
 Frame = -3

Query: 189 RLHPAWDCYNNSNSRW 142
           +L+P WD Y+  +S W
Sbjct: 5   KLNPRWDAYDRRDSFW 20


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 756,423
Number of Sequences: 2352
Number of extensions: 16726
Number of successful extensions: 27
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 26
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 27
length of database: 563,979
effective HSP length: 63
effective length of database: 415,803
effective search space used: 77339358
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -