SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120034X.Seq
         (582 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein.            26   0.77 
AY028785-1|AAK32959.1|  509|Anopheles gambiae cytochrome P450 pr...    24   3.1  
AF487534-1|AAL93295.1|  509|Anopheles gambiae cytochrome P450 CY...    24   4.1  
AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodi...    23   7.2  
EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calc...    23   9.5  
AY903307-1|AAX48939.1|  283|Anopheles gambiae male-specific doub...    23   9.5  
AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein.            23   9.5  
AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein.            23   9.5  
AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcript...    23   9.5  

>AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein.
          Length = 3361

 Score = 26.2 bits (55), Expect = 0.77
 Identities = 12/26 (46%), Positives = 16/26 (61%)
 Frame = -2

Query: 284  RPALPRYLEHVLDLVGMLKRRFVLAV 207
            R AL  Y  HV D+VG+L   F+ A+
Sbjct: 2425 RKALQIYNSHVPDIVGVLNNHFMTAL 2450


>AY028785-1|AAK32959.1|  509|Anopheles gambiae cytochrome P450
           protein.
          Length = 509

 Score = 24.2 bits (50), Expect = 3.1
 Identities = 12/27 (44%), Positives = 15/27 (55%)
 Frame = +2

Query: 185 TGNTCPRRRQVQIDV*ACRPNPAHAPD 265
           T +  PR   VQI V A   +PAH P+
Sbjct: 396 TRHVIPRHVGVQIPVYAIHHDPAHYPE 422


>AF487534-1|AAL93295.1|  509|Anopheles gambiae cytochrome P450
           CYP6P3 protein.
          Length = 509

 Score = 23.8 bits (49), Expect = 4.1
 Identities = 11/27 (40%), Positives = 15/27 (55%)
 Frame = +2

Query: 185 TGNTCPRRRQVQIDV*ACRPNPAHAPD 265
           T +  P+R  VQI   A + +P H PD
Sbjct: 396 TKHVIPKRTLVQIPAYAIQRDPDHYPD 422


>AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodium
           channel alpha subunitprotein.
          Length = 2139

 Score = 23.0 bits (47), Expect = 7.2
 Identities = 4/8 (50%), Positives = 6/8 (75%)
 Frame = -3

Query: 265 IWSMCWIW 242
           +W  CW+W
Sbjct: 787 VWDCCWVW 794


>EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calcium
           channel alpha1 subunit protein.
          Length = 1893

 Score = 22.6 bits (46), Expect = 9.5
 Identities = 9/33 (27%), Positives = 16/33 (48%)
 Frame = -1

Query: 522 RKICVATVNFCVRSSILAITSFVSISTAGAYLP 424
           RK+C+A V +     ++ +T F +      Y P
Sbjct: 103 RKLCIAIVEWKPFEYLILLTIFANCVALAVYTP 135


>AY903307-1|AAX48939.1|  283|Anopheles gambiae male-specific
           doublesex protein protein.
          Length = 283

 Score = 22.6 bits (46), Expect = 9.5
 Identities = 8/23 (34%), Positives = 17/23 (73%)
 Frame = -2

Query: 395 PKAILVILCRKAIWTSLSVESRQ 327
           P+ +L+ LC+++ + SLS+  R+
Sbjct: 231 PQLLLLELCKRSSFRSLSMHKRR 253


>AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein.
          Length = 3320

 Score = 22.6 bits (46), Expect = 9.5
 Identities = 9/15 (60%), Positives = 10/15 (66%)
 Frame = -1

Query: 198 HVLPVHNLHILNCWR 154
           HVL V N   LNC+R
Sbjct: 33  HVLLVRNQRALNCYR 47


>AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein.
          Length = 3318

 Score = 22.6 bits (46), Expect = 9.5
 Identities = 9/15 (60%), Positives = 10/15 (66%)
 Frame = -1

Query: 198 HVLPVHNLHILNCWR 154
           HVL V N   LNC+R
Sbjct: 33  HVLLVRNQRALNCYR 47


>AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcriptase
           protein.
          Length = 1248

 Score = 22.6 bits (46), Expect = 9.5
 Identities = 11/21 (52%), Positives = 14/21 (66%)
 Frame = +1

Query: 484 SDAKIDGGHADFAEATDRSFC 546
           S+A I  G   +AEATDR +C
Sbjct: 787 SEAIIRYGAPIWAEATDRQWC 807


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 658,749
Number of Sequences: 2352
Number of extensions: 14446
Number of successful extensions: 22
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 21
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 22
length of database: 563,979
effective HSP length: 61
effective length of database: 420,507
effective search space used: 55506924
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -