SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120033.Seq
         (717 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY280613-1|AAQ21366.1|  257|Anopheles gambiae carbonic anhydrase...    25   1.8  
DQ342048-1|ABC69940.1|  847|Anopheles gambiae STIP protein.            25   2.3  
AB097127-1|BAC82595.1| 1209|Anopheles gambiae reverse transcript...    25   3.1  
AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein.            24   4.1  
AY324315-1|AAQ89700.1|  153|Anopheles gambiae insulin-like pepti...    24   4.1  
AY324314-1|AAQ89699.1|  153|Anopheles gambiae insulin-like pepti...    24   4.1  
EF588664-1|ABQ96850.1|  177|Anopheles gambiae transposase protein.     24   5.4  
EF588655-1|ABQ96841.1|  177|Anopheles gambiae transposase protein.     24   5.4  
EF588642-1|ABQ96832.1|  177|Anopheles gambiae transposase protein.     24   5.4  
EF588641-1|ABQ96831.1|  177|Anopheles gambiae transposase protein.     24   5.4  
EF588640-1|ABQ96830.1|  177|Anopheles gambiae transposase protein.     24   5.4  
EF588638-1|ABQ96828.1|  177|Anopheles gambiae transposase protein.     24   5.4  
EF588633-1|ABQ96823.1|  177|Anopheles gambiae transposase protein.     24   5.4  
EF588631-1|ABQ96821.1|  177|Anopheles gambiae transposase protein.     24   5.4  
EF588627-1|ABQ96817.1|  177|Anopheles gambiae transposase protein.     24   5.4  
EF588620-1|ABQ96810.1|  177|Anopheles gambiae transposase protein.     24   5.4  
EF588609-1|ABQ96800.1|  177|Anopheles gambiae transposase protein.     24   5.4  
EF588600-1|ABQ96791.1|  177|Anopheles gambiae transposase protein.     24   5.4  
EF588599-1|ABQ96790.1|  177|Anopheles gambiae transposase protein.     24   5.4  
EF588598-1|ABQ96789.1|  177|Anopheles gambiae transposase protein.     24   5.4  
EF588597-1|ABQ96788.1|  177|Anopheles gambiae transposase protein.     24   5.4  
EF588596-1|ABQ96787.1|  177|Anopheles gambiae transposase protein.     24   5.4  
EF588591-1|ABQ96785.1|  177|Anopheles gambiae transposase protein.     24   5.4  
EF588574-1|ABQ96770.1|  177|Anopheles gambiae transposase protein.     24   5.4  
EF588569-1|ABQ96767.1|  177|Anopheles gambiae transposase protein.     24   5.4  
EF588563-1|ABQ96761.1|  177|Anopheles gambiae transposase protein.     24   5.4  
EF588561-1|ABQ96759.1|  177|Anopheles gambiae transposase protein.     24   5.4  
EF588560-1|ABQ96758.1|  177|Anopheles gambiae transposase protein.     24   5.4  
EF588555-1|ABQ96753.1|  177|Anopheles gambiae transposase protein.     24   5.4  
EF588553-1|ABQ96751.1|  177|Anopheles gambiae transposase protein.     24   5.4  
EF588527-1|ABQ63483.1|  177|Anopheles gambiae transposase protein.     24   5.4  
EF588526-1|ABQ63482.1|  177|Anopheles gambiae transposase protein.     24   5.4  
EF588524-1|ABQ63480.1|  177|Anopheles gambiae transposase protein.     24   5.4  
EF588523-1|ABQ63479.1|  177|Anopheles gambiae transposase protein.     24   5.4  
EF588494-1|ABQ96730.1|  177|Anopheles gambiae transposase protein.     24   5.4  
EF588492-1|ABQ96728.1|  177|Anopheles gambiae transposase protein.     24   5.4  
EF588457-1|ABQ96693.1|  177|Anopheles gambiae transposase protein.     24   5.4  
EF588456-1|ABQ96692.1|  177|Anopheles gambiae transposase protein.     24   5.4  
EF588455-1|ABQ96691.1|  177|Anopheles gambiae transposase protein.     24   5.4  
EF588436-1|ABQ96672.1|  177|Anopheles gambiae transposase protein.     24   5.4  
EF588435-1|ABQ96671.1|  177|Anopheles gambiae transposase protein.     24   5.4  
EF588434-1|ABQ96670.1|  177|Anopheles gambiae transposase protein.     24   5.4  
EF588433-1|ABQ96669.1|  177|Anopheles gambiae transposase protein.     24   5.4  
EF588432-1|ABQ96668.1|  177|Anopheles gambiae transposase protein.     24   5.4  
EF588431-1|ABQ96667.1|  177|Anopheles gambiae transposase protein.     24   5.4  
EF588430-1|ABQ96666.1|  177|Anopheles gambiae transposase protein.     24   5.4  
EF588429-1|ABQ96665.1|  177|Anopheles gambiae transposase protein.     24   5.4  
EF588428-1|ABQ96664.1|  177|Anopheles gambiae transposase protein.     24   5.4  
AY785361-1|AAV52865.1|  960|Anopheles gambiae male-specific tran...    24   5.4  
AY785360-1|AAV52864.1|  759|Anopheles gambiae male-specific tran...    24   5.4  
AY725820-1|AAU50568.1|  593|Anopheles gambiae fruitless female-s...    24   5.4  
AY725819-1|AAU50567.1|  569|Anopheles gambiae fruitless male-spe...    23   7.2  

>AY280613-1|AAQ21366.1|  257|Anopheles gambiae carbonic anhydrase
           alternate isoform protein.
          Length = 257

 Score = 25.4 bits (53), Expect = 1.8
 Identities = 9/26 (34%), Positives = 16/26 (61%)
 Frame = -3

Query: 424 YSSSASLPMYLMTVSMMIFKTPMLCS 347
           Y  S + P Y  +V+ +++KTP+  S
Sbjct: 181 YKGSLTTPPYFESVTWLVYKTPIYVS 206


>DQ342048-1|ABC69940.1|  847|Anopheles gambiae STIP protein.
          Length = 847

 Score = 25.0 bits (52), Expect = 2.3
 Identities = 12/31 (38%), Positives = 16/31 (51%), Gaps = 4/31 (12%)
 Frame = +1

Query: 16  LDLCASVKLTP----FKPMRPPKPMQCWIHP 96
           L+    VKLT     + P+    P+ CWIHP
Sbjct: 542 LEQIVLVKLTAAVIEWDPLTDTVPIHCWIHP 572


>AB097127-1|BAC82595.1| 1209|Anopheles gambiae reverse transcriptase
           protein.
          Length = 1209

 Score = 24.6 bits (51), Expect = 3.1
 Identities = 13/41 (31%), Positives = 23/41 (56%)
 Frame = +3

Query: 390 IKYIGKLADDEYILIADRMYVDLIYSEFRAIILPQSAYIIK 512
           +K +G + +D +   A ++ +  +Y   RAIILP+    IK
Sbjct: 121 VKMLG-MFNDRFPRFAHQLDLSKLYIRQRAIILPEELEFIK 160


>AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein.
          Length = 3398

 Score = 24.2 bits (50), Expect = 4.1
 Identities = 13/46 (28%), Positives = 23/46 (50%), Gaps = 1/46 (2%)
 Frame = -3

Query: 385  VSMMIFKTP-MLCSPASSTLLKCSVRIGLINTHSYTSSALRIVFLP 251
            +SM  F T   +  PA+ T+++ S  I L+       ++  +VF P
Sbjct: 1149 LSMFFFHTKETIQQPANVTMVRASNTISLVTVRHVNETSKFVVFRP 1194


>AY324315-1|AAQ89700.1|  153|Anopheles gambiae insulin-like peptide
           7 precursor protein.
          Length = 153

 Score = 24.2 bits (50), Expect = 4.1
 Identities = 14/50 (28%), Positives = 21/50 (42%)
 Frame = +1

Query: 148 DNENDMLHMTVLNSVFLNEHAKLYYRHLLRNDQAEAEKQFSTPTTCTSAC 297
           D   DM++  ++    LN H +  +  + R   AE   Q  T  T  S C
Sbjct: 102 DRSADMIYQALVTLQHLNTHEEHNFHRVRRQVVAECCYQSCTLDTLKSYC 151


>AY324314-1|AAQ89699.1|  153|Anopheles gambiae insulin-like peptide
           7 precursor protein.
          Length = 153

 Score = 24.2 bits (50), Expect = 4.1
 Identities = 14/50 (28%), Positives = 21/50 (42%)
 Frame = +1

Query: 148 DNENDMLHMTVLNSVFLNEHAKLYYRHLLRNDQAEAEKQFSTPTTCTSAC 297
           D   DM++  ++    LN H +  +  + R   AE   Q  T  T  S C
Sbjct: 102 DRSADMIYQALVTLQHLNTHEEHNFHRVRRQVVAECCYQSCTLDTLKSYC 151


>EF588664-1|ABQ96850.1|  177|Anopheles gambiae transposase protein.
          Length = 177

 Score = 23.8 bits (49), Expect = 5.4
 Identities = 11/25 (44%), Positives = 15/25 (60%)
 Frame = +3

Query: 396 YIGKLADDEYILIADRMYVDLIYSE 470
           Y+ KL + E   + DRM +DLI  E
Sbjct: 95  YLKKLINSETKKVLDRMLLDLICKE 119


>EF588655-1|ABQ96841.1|  177|Anopheles gambiae transposase protein.
          Length = 177

 Score = 23.8 bits (49), Expect = 5.4
 Identities = 11/25 (44%), Positives = 15/25 (60%)
 Frame = +3

Query: 396 YIGKLADDEYILIADRMYVDLIYSE 470
           Y+ KL + E   + DRM +DLI  E
Sbjct: 95  YLKKLINSETKKVLDRMLLDLICKE 119


>EF588642-1|ABQ96832.1|  177|Anopheles gambiae transposase protein.
          Length = 177

 Score = 23.8 bits (49), Expect = 5.4
 Identities = 11/25 (44%), Positives = 15/25 (60%)
 Frame = +3

Query: 396 YIGKLADDEYILIADRMYVDLIYSE 470
           Y+ KL + E   + DRM +DLI  E
Sbjct: 95  YLKKLINSETKKVLDRMLLDLICKE 119


>EF588641-1|ABQ96831.1|  177|Anopheles gambiae transposase protein.
          Length = 177

 Score = 23.8 bits (49), Expect = 5.4
 Identities = 11/25 (44%), Positives = 15/25 (60%)
 Frame = +3

Query: 396 YIGKLADDEYILIADRMYVDLIYSE 470
           Y+ KL + E   + DRM +DLI  E
Sbjct: 95  YLKKLINSETKKVLDRMLLDLICKE 119


>EF588640-1|ABQ96830.1|  177|Anopheles gambiae transposase protein.
          Length = 177

 Score = 23.8 bits (49), Expect = 5.4
 Identities = 11/25 (44%), Positives = 15/25 (60%)
 Frame = +3

Query: 396 YIGKLADDEYILIADRMYVDLIYSE 470
           Y+ KL + E   + DRM +DLI  E
Sbjct: 95  YLKKLINSETKKVLDRMLLDLICKE 119


>EF588638-1|ABQ96828.1|  177|Anopheles gambiae transposase protein.
          Length = 177

 Score = 23.8 bits (49), Expect = 5.4
 Identities = 11/25 (44%), Positives = 15/25 (60%)
 Frame = +3

Query: 396 YIGKLADDEYILIADRMYVDLIYSE 470
           Y+ KL + E   + DRM +DLI  E
Sbjct: 95  YLKKLINSETKKVLDRMLLDLICKE 119


>EF588633-1|ABQ96823.1|  177|Anopheles gambiae transposase protein.
          Length = 177

 Score = 23.8 bits (49), Expect = 5.4
 Identities = 11/25 (44%), Positives = 15/25 (60%)
 Frame = +3

Query: 396 YIGKLADDEYILIADRMYVDLIYSE 470
           Y+ KL + E   + DRM +DLI  E
Sbjct: 95  YLKKLINSETKKVLDRMLLDLICKE 119


>EF588631-1|ABQ96821.1|  177|Anopheles gambiae transposase protein.
          Length = 177

 Score = 23.8 bits (49), Expect = 5.4
 Identities = 11/25 (44%), Positives = 15/25 (60%)
 Frame = +3

Query: 396 YIGKLADDEYILIADRMYVDLIYSE 470
           Y+ KL + E   + DRM +DLI  E
Sbjct: 95  YLKKLINSETKKVLDRMLLDLICKE 119


>EF588627-1|ABQ96817.1|  177|Anopheles gambiae transposase protein.
          Length = 177

 Score = 23.8 bits (49), Expect = 5.4
 Identities = 11/25 (44%), Positives = 15/25 (60%)
 Frame = +3

Query: 396 YIGKLADDEYILIADRMYVDLIYSE 470
           Y+ KL + E   + DRM +DLI  E
Sbjct: 95  YLKKLINSETKKVLDRMLLDLICKE 119


>EF588620-1|ABQ96810.1|  177|Anopheles gambiae transposase protein.
          Length = 177

 Score = 23.8 bits (49), Expect = 5.4
 Identities = 11/25 (44%), Positives = 15/25 (60%)
 Frame = +3

Query: 396 YIGKLADDEYILIADRMYVDLIYSE 470
           Y+ KL + E   + DRM +DLI  E
Sbjct: 95  YLKKLINSETKKVLDRMLLDLICKE 119


>EF588609-1|ABQ96800.1|  177|Anopheles gambiae transposase protein.
          Length = 177

 Score = 23.8 bits (49), Expect = 5.4
 Identities = 11/25 (44%), Positives = 15/25 (60%)
 Frame = +3

Query: 396 YIGKLADDEYILIADRMYVDLIYSE 470
           Y+ KL + E   + DRM +DLI  E
Sbjct: 95  YLKKLINSETKKVLDRMLLDLICKE 119


>EF588600-1|ABQ96791.1|  177|Anopheles gambiae transposase protein.
          Length = 177

 Score = 23.8 bits (49), Expect = 5.4
 Identities = 11/25 (44%), Positives = 15/25 (60%)
 Frame = +3

Query: 396 YIGKLADDEYILIADRMYVDLIYSE 470
           Y+ KL + E   + DRM +DLI  E
Sbjct: 95  YLKKLINSETKKVLDRMLLDLICKE 119


>EF588599-1|ABQ96790.1|  177|Anopheles gambiae transposase protein.
          Length = 177

 Score = 23.8 bits (49), Expect = 5.4
 Identities = 11/25 (44%), Positives = 15/25 (60%)
 Frame = +3

Query: 396 YIGKLADDEYILIADRMYVDLIYSE 470
           Y+ KL + E   + DRM +DLI  E
Sbjct: 95  YLKKLINSETKKVLDRMLLDLICKE 119


>EF588598-1|ABQ96789.1|  177|Anopheles gambiae transposase protein.
          Length = 177

 Score = 23.8 bits (49), Expect = 5.4
 Identities = 11/25 (44%), Positives = 15/25 (60%)
 Frame = +3

Query: 396 YIGKLADDEYILIADRMYVDLIYSE 470
           Y+ KL + E   + DRM +DLI  E
Sbjct: 95  YLKKLINSETKKVLDRMLLDLICKE 119


>EF588597-1|ABQ96788.1|  177|Anopheles gambiae transposase protein.
          Length = 177

 Score = 23.8 bits (49), Expect = 5.4
 Identities = 11/25 (44%), Positives = 15/25 (60%)
 Frame = +3

Query: 396 YIGKLADDEYILIADRMYVDLIYSE 470
           Y+ KL + E   + DRM +DLI  E
Sbjct: 95  YLKKLINSETKKVLDRMLLDLICKE 119


>EF588596-1|ABQ96787.1|  177|Anopheles gambiae transposase protein.
          Length = 177

 Score = 23.8 bits (49), Expect = 5.4
 Identities = 11/25 (44%), Positives = 15/25 (60%)
 Frame = +3

Query: 396 YIGKLADDEYILIADRMYVDLIYSE 470
           Y+ KL + E   + DRM +DLI  E
Sbjct: 95  YLKKLINSETKKVLDRMLLDLICKE 119


>EF588591-1|ABQ96785.1|  177|Anopheles gambiae transposase protein.
          Length = 177

 Score = 23.8 bits (49), Expect = 5.4
 Identities = 11/25 (44%), Positives = 15/25 (60%)
 Frame = +3

Query: 396 YIGKLADDEYILIADRMYVDLIYSE 470
           Y+ KL + E   + DRM +DLI  E
Sbjct: 95  YLKKLINSETKKVLDRMLLDLICKE 119


>EF588574-1|ABQ96770.1|  177|Anopheles gambiae transposase protein.
          Length = 177

 Score = 23.8 bits (49), Expect = 5.4
 Identities = 11/25 (44%), Positives = 15/25 (60%)
 Frame = +3

Query: 396 YIGKLADDEYILIADRMYVDLIYSE 470
           Y+ KL + E   + DRM +DLI  E
Sbjct: 95  YLKKLINSETKKVLDRMLLDLICKE 119


>EF588569-1|ABQ96767.1|  177|Anopheles gambiae transposase protein.
          Length = 177

 Score = 23.8 bits (49), Expect = 5.4
 Identities = 11/25 (44%), Positives = 15/25 (60%)
 Frame = +3

Query: 396 YIGKLADDEYILIADRMYVDLIYSE 470
           Y+ KL + E   + DRM +DLI  E
Sbjct: 95  YLKKLINSETKKVLDRMLLDLICKE 119


>EF588563-1|ABQ96761.1|  177|Anopheles gambiae transposase protein.
          Length = 177

 Score = 23.8 bits (49), Expect = 5.4
 Identities = 11/25 (44%), Positives = 15/25 (60%)
 Frame = +3

Query: 396 YIGKLADDEYILIADRMYVDLIYSE 470
           Y+ KL + E   + DRM +DLI  E
Sbjct: 95  YLKKLINSETKKVLDRMLLDLICKE 119


>EF588561-1|ABQ96759.1|  177|Anopheles gambiae transposase protein.
          Length = 177

 Score = 23.8 bits (49), Expect = 5.4
 Identities = 11/25 (44%), Positives = 15/25 (60%)
 Frame = +3

Query: 396 YIGKLADDEYILIADRMYVDLIYSE 470
           Y+ KL + E   + DRM +DLI  E
Sbjct: 95  YLKKLINSETKKVLDRMLLDLICKE 119


>EF588560-1|ABQ96758.1|  177|Anopheles gambiae transposase protein.
          Length = 177

 Score = 23.8 bits (49), Expect = 5.4
 Identities = 11/25 (44%), Positives = 15/25 (60%)
 Frame = +3

Query: 396 YIGKLADDEYILIADRMYVDLIYSE 470
           Y+ KL + E   + DRM +DLI  E
Sbjct: 95  YLKKLINSETKKVLDRMLLDLICKE 119


>EF588555-1|ABQ96753.1|  177|Anopheles gambiae transposase protein.
          Length = 177

 Score = 23.8 bits (49), Expect = 5.4
 Identities = 11/25 (44%), Positives = 15/25 (60%)
 Frame = +3

Query: 396 YIGKLADDEYILIADRMYVDLIYSE 470
           Y+ KL + E   + DRM +DLI  E
Sbjct: 95  YLKKLINSETKKVLDRMLLDLICKE 119


>EF588553-1|ABQ96751.1|  177|Anopheles gambiae transposase protein.
          Length = 177

 Score = 23.8 bits (49), Expect = 5.4
 Identities = 11/25 (44%), Positives = 15/25 (60%)
 Frame = +3

Query: 396 YIGKLADDEYILIADRMYVDLIYSE 470
           Y+ KL + E   + DRM +DLI  E
Sbjct: 95  YLKKLINSETKKVLDRMLLDLICKE 119


>EF588527-1|ABQ63483.1|  177|Anopheles gambiae transposase protein.
          Length = 177

 Score = 23.8 bits (49), Expect = 5.4
 Identities = 11/25 (44%), Positives = 15/25 (60%)
 Frame = +3

Query: 396 YIGKLADDEYILIADRMYVDLIYSE 470
           Y+ KL + E   + DRM +DLI  E
Sbjct: 95  YLKKLINSETKKVLDRMLLDLICKE 119


>EF588526-1|ABQ63482.1|  177|Anopheles gambiae transposase protein.
          Length = 177

 Score = 23.8 bits (49), Expect = 5.4
 Identities = 11/25 (44%), Positives = 15/25 (60%)
 Frame = +3

Query: 396 YIGKLADDEYILIADRMYVDLIYSE 470
           Y+ KL + E   + DRM +DLI  E
Sbjct: 95  YLKKLINSETKKVLDRMLLDLICKE 119


>EF588524-1|ABQ63480.1|  177|Anopheles gambiae transposase protein.
          Length = 177

 Score = 23.8 bits (49), Expect = 5.4
 Identities = 11/25 (44%), Positives = 15/25 (60%)
 Frame = +3

Query: 396 YIGKLADDEYILIADRMYVDLIYSE 470
           Y+ KL + E   + DRM +DLI  E
Sbjct: 95  YLKKLINSETKKVLDRMLLDLICKE 119


>EF588523-1|ABQ63479.1|  177|Anopheles gambiae transposase protein.
          Length = 177

 Score = 23.8 bits (49), Expect = 5.4
 Identities = 11/25 (44%), Positives = 15/25 (60%)
 Frame = +3

Query: 396 YIGKLADDEYILIADRMYVDLIYSE 470
           Y+ KL + E   + DRM +DLI  E
Sbjct: 95  YLKKLINSETKKVLDRMLLDLICKE 119


>EF588494-1|ABQ96730.1|  177|Anopheles gambiae transposase protein.
          Length = 177

 Score = 23.8 bits (49), Expect = 5.4
 Identities = 11/25 (44%), Positives = 15/25 (60%)
 Frame = +3

Query: 396 YIGKLADDEYILIADRMYVDLIYSE 470
           Y+ KL + E   + DRM +DLI  E
Sbjct: 95  YLKKLINSETKKVLDRMLLDLICKE 119


>EF588492-1|ABQ96728.1|  177|Anopheles gambiae transposase protein.
          Length = 177

 Score = 23.8 bits (49), Expect = 5.4
 Identities = 11/25 (44%), Positives = 15/25 (60%)
 Frame = +3

Query: 396 YIGKLADDEYILIADRMYVDLIYSE 470
           Y+ KL + E   + DRM +DLI  E
Sbjct: 95  YLKKLINSETKKVLDRMLLDLICKE 119


>EF588457-1|ABQ96693.1|  177|Anopheles gambiae transposase protein.
          Length = 177

 Score = 23.8 bits (49), Expect = 5.4
 Identities = 11/25 (44%), Positives = 15/25 (60%)
 Frame = +3

Query: 396 YIGKLADDEYILIADRMYVDLIYSE 470
           Y+ KL + E   + DRM +DLI  E
Sbjct: 95  YLKKLINSETKKVLDRMLLDLICKE 119


>EF588456-1|ABQ96692.1|  177|Anopheles gambiae transposase protein.
          Length = 177

 Score = 23.8 bits (49), Expect = 5.4
 Identities = 11/25 (44%), Positives = 15/25 (60%)
 Frame = +3

Query: 396 YIGKLADDEYILIADRMYVDLIYSE 470
           Y+ KL + E   + DRM +DLI  E
Sbjct: 95  YLKKLINSETKKVLDRMLLDLICKE 119


>EF588455-1|ABQ96691.1|  177|Anopheles gambiae transposase protein.
          Length = 177

 Score = 23.8 bits (49), Expect = 5.4
 Identities = 11/25 (44%), Positives = 15/25 (60%)
 Frame = +3

Query: 396 YIGKLADDEYILIADRMYVDLIYSE 470
           Y+ KL + E   + DRM +DLI  E
Sbjct: 95  YLKKLINSETKKVLDRMLLDLICKE 119


>EF588436-1|ABQ96672.1|  177|Anopheles gambiae transposase protein.
          Length = 177

 Score = 23.8 bits (49), Expect = 5.4
 Identities = 11/25 (44%), Positives = 15/25 (60%)
 Frame = +3

Query: 396 YIGKLADDEYILIADRMYVDLIYSE 470
           Y+ KL + E   + DRM +DLI  E
Sbjct: 95  YLKKLINSETKKVLDRMLLDLICKE 119


>EF588435-1|ABQ96671.1|  177|Anopheles gambiae transposase protein.
          Length = 177

 Score = 23.8 bits (49), Expect = 5.4
 Identities = 11/25 (44%), Positives = 15/25 (60%)
 Frame = +3

Query: 396 YIGKLADDEYILIADRMYVDLIYSE 470
           Y+ KL + E   + DRM +DLI  E
Sbjct: 95  YLKKLINSETKKVLDRMLLDLICKE 119


>EF588434-1|ABQ96670.1|  177|Anopheles gambiae transposase protein.
          Length = 177

 Score = 23.8 bits (49), Expect = 5.4
 Identities = 11/25 (44%), Positives = 15/25 (60%)
 Frame = +3

Query: 396 YIGKLADDEYILIADRMYVDLIYSE 470
           Y+ KL + E   + DRM +DLI  E
Sbjct: 95  YLKKLINSETKKVLDRMLLDLICKE 119


>EF588433-1|ABQ96669.1|  177|Anopheles gambiae transposase protein.
          Length = 177

 Score = 23.8 bits (49), Expect = 5.4
 Identities = 11/25 (44%), Positives = 15/25 (60%)
 Frame = +3

Query: 396 YIGKLADDEYILIADRMYVDLIYSE 470
           Y+ KL + E   + DRM +DLI  E
Sbjct: 95  YLKKLINSETKKVLDRMLLDLICKE 119


>EF588432-1|ABQ96668.1|  177|Anopheles gambiae transposase protein.
          Length = 177

 Score = 23.8 bits (49), Expect = 5.4
 Identities = 11/25 (44%), Positives = 15/25 (60%)
 Frame = +3

Query: 396 YIGKLADDEYILIADRMYVDLIYSE 470
           Y+ KL + E   + DRM +DLI  E
Sbjct: 95  YLKKLINSETKKVLDRMLLDLICKE 119


>EF588431-1|ABQ96667.1|  177|Anopheles gambiae transposase protein.
          Length = 177

 Score = 23.8 bits (49), Expect = 5.4
 Identities = 11/25 (44%), Positives = 15/25 (60%)
 Frame = +3

Query: 396 YIGKLADDEYILIADRMYVDLIYSE 470
           Y+ KL + E   + DRM +DLI  E
Sbjct: 95  YLKKLINSETKKVLDRMLLDLICKE 119


>EF588430-1|ABQ96666.1|  177|Anopheles gambiae transposase protein.
          Length = 177

 Score = 23.8 bits (49), Expect = 5.4
 Identities = 11/25 (44%), Positives = 15/25 (60%)
 Frame = +3

Query: 396 YIGKLADDEYILIADRMYVDLIYSE 470
           Y+ KL + E   + DRM +DLI  E
Sbjct: 95  YLKKLINSETKKVLDRMLLDLICKE 119


>EF588429-1|ABQ96665.1|  177|Anopheles gambiae transposase protein.
          Length = 177

 Score = 23.8 bits (49), Expect = 5.4
 Identities = 11/25 (44%), Positives = 15/25 (60%)
 Frame = +3

Query: 396 YIGKLADDEYILIADRMYVDLIYSE 470
           Y+ KL + E   + DRM +DLI  E
Sbjct: 95  YLKKLINSETKKVLDRMLLDLICKE 119


>EF588428-1|ABQ96664.1|  177|Anopheles gambiae transposase protein.
          Length = 177

 Score = 23.8 bits (49), Expect = 5.4
 Identities = 11/25 (44%), Positives = 15/25 (60%)
 Frame = +3

Query: 396 YIGKLADDEYILIADRMYVDLIYSE 470
           Y+ KL + E   + DRM +DLI  E
Sbjct: 95  YLKKLINSETKKVLDRMLLDLICKE 119


>AY785361-1|AAV52865.1|  960|Anopheles gambiae male-specific
           transcription factor FRU-MA protein.
          Length = 960

 Score = 23.8 bits (49), Expect = 5.4
 Identities = 14/53 (26%), Positives = 20/53 (37%)
 Frame = +1

Query: 106 NCKVTRPRNNYSDPDNENDMLHMTVLNSVFLNEHAKLYYRHLLRNDQAEAEKQ 264
           N       N  S  +N N+ LH   L    L EH +L      +  Q   ++Q
Sbjct: 205 NSSSNNNNNTISSNNNNNNSLHHGPLRDKELTEHEQLERLQQQQQQQTHHQQQ 257


>AY785360-1|AAV52864.1|  759|Anopheles gambiae male-specific
           transcription factor FRU-MB protein.
          Length = 759

 Score = 23.8 bits (49), Expect = 5.4
 Identities = 14/53 (26%), Positives = 20/53 (37%)
 Frame = +1

Query: 106 NCKVTRPRNNYSDPDNENDMLHMTVLNSVFLNEHAKLYYRHLLRNDQAEAEKQ 264
           N       N  S  +N N+ LH   L    L EH +L      +  Q   ++Q
Sbjct: 205 NSSSNNNNNTISSNNNNNNSLHHGPLRDKELTEHEQLERLQQQQQQQTHHQQQ 257


>AY725820-1|AAU50568.1|  593|Anopheles gambiae fruitless
           female-specific zinc-fingerC isoform protein.
          Length = 593

 Score = 23.8 bits (49), Expect = 5.4
 Identities = 14/53 (26%), Positives = 20/53 (37%)
 Frame = +1

Query: 106 NCKVTRPRNNYSDPDNENDMLHMTVLNSVFLNEHAKLYYRHLLRNDQAEAEKQ 264
           N       N  S  +N N+ LH   L    L EH +L      +  Q   ++Q
Sbjct: 157 NSSSNNNNNTISSNNNNNNSLHHGPLRDKELTEHEQLERLQQQQQQQTHHQQQ 209


>AY725819-1|AAU50567.1|  569|Anopheles gambiae fruitless
           male-specific zinc-fingerC isoform protein.
          Length = 569

 Score = 23.4 bits (48), Expect = 7.2
 Identities = 13/45 (28%), Positives = 19/45 (42%)
 Frame = +1

Query: 130 NNYSDPDNENDMLHMTVLNSVFLNEHAKLYYRHLLRNDQAEAEKQ 264
           N  S  +N N+ LH   L    L EH +L      +  Q   ++Q
Sbjct: 213 NTISSNNNNNNSLHHGPLRDKELTEHEQLERLQQQQQQQTHHQQQ 257


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 691,897
Number of Sequences: 2352
Number of extensions: 13273
Number of successful extensions: 255
Number of sequences better than 10.0: 52
Number of HSP's better than 10.0 without gapping: 255
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 255
length of database: 563,979
effective HSP length: 63
effective length of database: 415,803
effective search space used: 72765525
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -