SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120031.Seq
         (726 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY062199-1|AAL58560.1|  151|Anopheles gambiae cytochrome P450 CY...    23   7.3  
DQ986315-1|ABK59975.1|  504|Anopheles gambiae catalase protein.        23   9.6  
DQ980210-1|ABL09378.1|  504|Anopheles gambiae catalase protein.        23   9.6  
DQ980209-1|ABL09377.1|  504|Anopheles gambiae catalase protein.        23   9.6  
DQ980208-1|ABL09376.1|  504|Anopheles gambiae catalase protein.        23   9.6  
DQ980207-1|ABL09375.1|  504|Anopheles gambiae catalase protein.        23   9.6  
DQ980206-1|ABL09374.1|  504|Anopheles gambiae catalase protein.        23   9.6  
DQ980205-1|ABL09373.1|  504|Anopheles gambiae catalase protein.        23   9.6  
DQ980204-1|ABL09372.1|  504|Anopheles gambiae catalase protein.        23   9.6  
DQ980203-1|ABL09371.1|  504|Anopheles gambiae catalase protein.        23   9.6  
DQ980202-1|ABL09370.1|  504|Anopheles gambiae catalase protein.        23   9.6  
DQ980201-1|ABL09369.1|  504|Anopheles gambiae catalase protein.        23   9.6  
DQ980200-1|ABL09368.1|  504|Anopheles gambiae catalase protein.        23   9.6  
DQ980199-1|ABL09367.1|  504|Anopheles gambiae catalase protein.        23   9.6  
AY505416-1|AAR90327.1|  485|Anopheles gambiae catalase 1 protein.      23   9.6  
AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcript...    23   9.6  

>AY062199-1|AAL58560.1|  151|Anopheles gambiae cytochrome P450
           CYP4H19 protein.
          Length = 151

 Score = 23.4 bits (48), Expect = 7.3
 Identities = 11/36 (30%), Positives = 16/36 (44%)
 Frame = +3

Query: 573 HAAVENDEGAILQRIFHTTVRHVPRSLYERQRFPHL 680
           H  ++      LQ +     RHVP +    Q FP+L
Sbjct: 27  HPEIQEKLHQELQDVLGVDYRHVPLTYNTLQNFPYL 62


>DQ986315-1|ABK59975.1|  504|Anopheles gambiae catalase protein.
          Length = 504

 Score = 23.0 bits (47), Expect = 9.6
 Identities = 9/16 (56%), Positives = 10/16 (62%)
 Frame = -3

Query: 511 SHGVPYGGKRVSKTLG 464
           SHG P G K  S+T G
Sbjct: 26  SHGAPVGTKTASETAG 41


>DQ980210-1|ABL09378.1|  504|Anopheles gambiae catalase protein.
          Length = 504

 Score = 23.0 bits (47), Expect = 9.6
 Identities = 9/16 (56%), Positives = 10/16 (62%)
 Frame = -3

Query: 511 SHGVPYGGKRVSKTLG 464
           SHG P G K  S+T G
Sbjct: 26  SHGAPVGTKTASETAG 41


>DQ980209-1|ABL09377.1|  504|Anopheles gambiae catalase protein.
          Length = 504

 Score = 23.0 bits (47), Expect = 9.6
 Identities = 9/16 (56%), Positives = 10/16 (62%)
 Frame = -3

Query: 511 SHGVPYGGKRVSKTLG 464
           SHG P G K  S+T G
Sbjct: 26  SHGAPVGTKTASETAG 41


>DQ980208-1|ABL09376.1|  504|Anopheles gambiae catalase protein.
          Length = 504

 Score = 23.0 bits (47), Expect = 9.6
 Identities = 9/16 (56%), Positives = 10/16 (62%)
 Frame = -3

Query: 511 SHGVPYGGKRVSKTLG 464
           SHG P G K  S+T G
Sbjct: 26  SHGAPVGTKTASETAG 41


>DQ980207-1|ABL09375.1|  504|Anopheles gambiae catalase protein.
          Length = 504

 Score = 23.0 bits (47), Expect = 9.6
 Identities = 9/16 (56%), Positives = 10/16 (62%)
 Frame = -3

Query: 511 SHGVPYGGKRVSKTLG 464
           SHG P G K  S+T G
Sbjct: 26  SHGAPVGTKTASETAG 41


>DQ980206-1|ABL09374.1|  504|Anopheles gambiae catalase protein.
          Length = 504

 Score = 23.0 bits (47), Expect = 9.6
 Identities = 9/16 (56%), Positives = 10/16 (62%)
 Frame = -3

Query: 511 SHGVPYGGKRVSKTLG 464
           SHG P G K  S+T G
Sbjct: 26  SHGAPVGTKTASETAG 41


>DQ980205-1|ABL09373.1|  504|Anopheles gambiae catalase protein.
          Length = 504

 Score = 23.0 bits (47), Expect = 9.6
 Identities = 9/16 (56%), Positives = 10/16 (62%)
 Frame = -3

Query: 511 SHGVPYGGKRVSKTLG 464
           SHG P G K  S+T G
Sbjct: 26  SHGAPVGTKTASETAG 41


>DQ980204-1|ABL09372.1|  504|Anopheles gambiae catalase protein.
          Length = 504

 Score = 23.0 bits (47), Expect = 9.6
 Identities = 9/16 (56%), Positives = 10/16 (62%)
 Frame = -3

Query: 511 SHGVPYGGKRVSKTLG 464
           SHG P G K  S+T G
Sbjct: 26  SHGAPVGTKTASETAG 41


>DQ980203-1|ABL09371.1|  504|Anopheles gambiae catalase protein.
          Length = 504

 Score = 23.0 bits (47), Expect = 9.6
 Identities = 9/16 (56%), Positives = 10/16 (62%)
 Frame = -3

Query: 511 SHGVPYGGKRVSKTLG 464
           SHG P G K  S+T G
Sbjct: 26  SHGAPVGTKTASETAG 41


>DQ980202-1|ABL09370.1|  504|Anopheles gambiae catalase protein.
          Length = 504

 Score = 23.0 bits (47), Expect = 9.6
 Identities = 9/16 (56%), Positives = 10/16 (62%)
 Frame = -3

Query: 511 SHGVPYGGKRVSKTLG 464
           SHG P G K  S+T G
Sbjct: 26  SHGAPVGTKTASETAG 41


>DQ980201-1|ABL09369.1|  504|Anopheles gambiae catalase protein.
          Length = 504

 Score = 23.0 bits (47), Expect = 9.6
 Identities = 9/16 (56%), Positives = 10/16 (62%)
 Frame = -3

Query: 511 SHGVPYGGKRVSKTLG 464
           SHG P G K  S+T G
Sbjct: 26  SHGAPVGTKTASETAG 41


>DQ980200-1|ABL09368.1|  504|Anopheles gambiae catalase protein.
          Length = 504

 Score = 23.0 bits (47), Expect = 9.6
 Identities = 9/16 (56%), Positives = 10/16 (62%)
 Frame = -3

Query: 511 SHGVPYGGKRVSKTLG 464
           SHG P G K  S+T G
Sbjct: 26  SHGAPVGTKTASETAG 41


>DQ980199-1|ABL09367.1|  504|Anopheles gambiae catalase protein.
          Length = 504

 Score = 23.0 bits (47), Expect = 9.6
 Identities = 9/16 (56%), Positives = 10/16 (62%)
 Frame = -3

Query: 511 SHGVPYGGKRVSKTLG 464
           SHG P G K  S+T G
Sbjct: 26  SHGAPVGTKTASETAG 41


>AY505416-1|AAR90327.1|  485|Anopheles gambiae catalase 1 protein.
          Length = 485

 Score = 23.0 bits (47), Expect = 9.6
 Identities = 9/16 (56%), Positives = 10/16 (62%)
 Frame = -3

Query: 511 SHGVPYGGKRVSKTLG 464
           SHG P G K  S+T G
Sbjct: 10  SHGAPVGTKTASETAG 25


>AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcriptase
           protein.
          Length = 1099

 Score = 23.0 bits (47), Expect = 9.6
 Identities = 13/40 (32%), Positives = 22/40 (55%)
 Frame = +2

Query: 251 SSKSAHLTKLLSSQATYLYHFACLMKYKDIQKYEVQQLIE 370
           S   A   KLL+S +  +  +A  +  K++QK E  +L+E
Sbjct: 769 SEPRASKAKLLASVSESVMRYAAPVWSKELQKREPGRLLE 808


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 776,420
Number of Sequences: 2352
Number of extensions: 15746
Number of successful extensions: 44
Number of sequences better than 10.0: 16
Number of HSP's better than 10.0 without gapping: 43
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 44
length of database: 563,979
effective HSP length: 63
effective length of database: 415,803
effective search space used: 74012934
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -