SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120028.Seq
         (721 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY578799-1|AAT07304.1|  679|Anopheles gambiae brinker protein.         24   5.4  
EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calc...    23   7.2  
AY943929-1|AAX49502.1|  755|Anopheles gambiae laccase-2 isoform ...    23   7.2  
AY943928-1|AAX49501.1|  753|Anopheles gambiae laccase-2 isoform ...    23   7.2  
DQ370045-1|ABD18606.1|  285|Anopheles gambiae putative TIL domai...    23   9.5  
DQ370039-1|ABD18600.1|  168|Anopheles gambiae putative TIL domai...    23   9.5  
AY146759-1|AAO12074.1|  356|Anopheles gambiae odorant-binding pr...    23   9.5  

>AY578799-1|AAT07304.1|  679|Anopheles gambiae brinker protein.
          Length = 679

 Score = 23.8 bits (49), Expect = 5.4
 Identities = 12/26 (46%), Positives = 16/26 (61%)
 Frame = -1

Query: 676 ADCSMLSLASSSFKRNSNCSNLLPTS 599
           + CS LS ASS+   +S   +L PTS
Sbjct: 236 SSCSPLSTASSASCSSSAAGSLCPTS 261


>EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calcium
           channel alpha1 subunit protein.
          Length = 1893

 Score = 23.4 bits (48), Expect = 7.2
 Identities = 10/16 (62%), Positives = 12/16 (75%)
 Frame = -3

Query: 476 SNALLLLSKFNRIKIF 429
           SNALL+ S  NR +IF
Sbjct: 833 SNALLIFSPTNRFRIF 848


>AY943929-1|AAX49502.1|  755|Anopheles gambiae laccase-2 isoform B
           protein.
          Length = 755

 Score = 23.4 bits (48), Expect = 7.2
 Identities = 7/11 (63%), Positives = 9/11 (81%)
 Frame = +2

Query: 374 PNAISTRWAHC 406
           PNA +T W+HC
Sbjct: 185 PNATNTVWSHC 195


>AY943928-1|AAX49501.1|  753|Anopheles gambiae laccase-2 isoform A
           protein.
          Length = 753

 Score = 23.4 bits (48), Expect = 7.2
 Identities = 7/11 (63%), Positives = 9/11 (81%)
 Frame = +2

Query: 374 PNAISTRWAHC 406
           PNA +T W+HC
Sbjct: 185 PNATNTVWSHC 195


>DQ370045-1|ABD18606.1|  285|Anopheles gambiae putative TIL domain
           protein protein.
          Length = 285

 Score = 23.0 bits (47), Expect = 9.5
 Identities = 8/29 (27%), Positives = 13/29 (44%)
 Frame = -1

Query: 343 NGKLDRCPNCNQVCRRAQFQDLCKNLLHC 257
           N  L  C  CNQ+       ++C+   +C
Sbjct: 213 NEALQACGTCNQITCSGISTEVCRRSCYC 241


>DQ370039-1|ABD18600.1|  168|Anopheles gambiae putative TIL domain
           polypeptide protein.
          Length = 168

 Score = 23.0 bits (47), Expect = 9.5
 Identities = 16/57 (28%), Positives = 27/57 (47%), Gaps = 8/57 (14%)
 Frame = -3

Query: 518 FVAQSSRSPSV*RCSNALLLLSKFNRIKIF---NNPCL-----VANNAPNELRSRLD 372
           FV +S     + +CSN  + LSK +   +F     PCL     + +N  N +  R++
Sbjct: 76  FVRESKEGKCIPKCSNENMPLSKTSTAILFVRLVTPCLYLRVNIDSNPVNHIMDRME 132


>AY146759-1|AAO12074.1|  356|Anopheles gambiae odorant-binding
           protein AgamOBP45 protein.
          Length = 356

 Score = 23.0 bits (47), Expect = 9.5
 Identities = 17/71 (23%), Positives = 27/71 (38%)
 Frame = -1

Query: 517 LSRNHHARLQFEGAATRCFCCQNLTASKFSTTPAWSRTMRPTS*DRVWISACEK*FRLNG 338
           L R ++     + AA +   C+        TT   + T  PT+      +AC      N 
Sbjct: 266 LGRAYYEYDVLQAAAAKMTVCEVAVEPPAMTTTTTTTTTTPTT-----ATACPSTTEFNY 320

Query: 337 KLDRCPNCNQV 305
           K   C NC ++
Sbjct: 321 KELNCQNCGRL 331


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 663,246
Number of Sequences: 2352
Number of extensions: 13317
Number of successful extensions: 36
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 36
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 36
length of database: 563,979
effective HSP length: 63
effective length of database: 415,803
effective search space used: 73181328
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -