SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120026.Seq
         (729 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ010195-1|CAA09034.1|  687|Anopheles gambiae prophenoloxidase p...    29   0.19 
AY873992-1|AAW71999.1|  259|Anopheles gambiae nanos protein.           26   1.4  
AY583530-1|AAS93544.1|  260|Anopheles gambiae NOS protein protein.     26   1.4  
AY062207-1|AAL58568.1|  504|Anopheles gambiae cytochrome P450 CY...    25   3.2  
AY524130-1|AAS17758.1|  211|Anopheles gambiae superoxide dismuta...    24   5.5  
AJ130949-1|CAA10258.1|  401|Anopheles gambiae SG1 protein protein.     24   5.5  
AF283269-1|AAG15374.1|  114|Anopheles gambiae ribosomal protein ...    23   7.3  
DQ989013-1|ABK97614.1|  378|Anopheles gambiae gustatory receptor...    23   9.7  

>AJ010195-1|CAA09034.1|  687|Anopheles gambiae prophenoloxidase
           protein.
          Length = 687

 Score = 28.7 bits (61), Expect = 0.19
 Identities = 23/75 (30%), Positives = 38/75 (50%), Gaps = 8/75 (10%)
 Frame = -2

Query: 446 IPHGRATRPLGLLDLSVPTVKQNVFIVV---NHLLLAFG-----HFAFVLHDRHYVEDIV 291
           IP+ R  RP+ L ++++P  +Q  F      +HLLL  G      F   L   ++ +D V
Sbjct: 556 IPYERTFRPMALSNINLPETEQFRFCNCGWPHHLLLPKGTAEGMKFDLFLMISNFADDTV 615

Query: 290 NVLFFQEIYNSNSWS 246
           N  F ++I  ++S S
Sbjct: 616 NQEFNEDINCNDSHS 630


>AY873992-1|AAW71999.1|  259|Anopheles gambiae nanos protein.
          Length = 259

 Score = 25.8 bits (54), Expect = 1.4
 Identities = 10/31 (32%), Positives = 17/31 (54%)
 Frame = +1

Query: 106 AGRFKGLQKSNMVNMPEQQSSTETAAVCKNE 198
           A   K +   ++ N P+QQS+T     C+N+
Sbjct: 118 AAELKNMVLQDISNQPKQQSTTRPLRKCRNK 148


>AY583530-1|AAS93544.1|  260|Anopheles gambiae NOS protein protein.
          Length = 260

 Score = 25.8 bits (54), Expect = 1.4
 Identities = 10/31 (32%), Positives = 17/31 (54%)
 Frame = +1

Query: 106 AGRFKGLQKSNMVNMPEQQSSTETAAVCKNE 198
           A   K +   ++ N P+QQS+T     C+N+
Sbjct: 119 AAELKNMVLQDISNQPKQQSTTRPLRKCRNK 149


>AY062207-1|AAL58568.1|  504|Anopheles gambiae cytochrome P450
           CYP6S2 protein.
          Length = 504

 Score = 24.6 bits (51), Expect = 3.2
 Identities = 13/35 (37%), Positives = 18/35 (51%)
 Frame = -1

Query: 612 KFALVSTAVCLFLLAGIAALSLEDDDVDRSAIFLP 508
           +F  + T + L +L      SLED DVDR  +  P
Sbjct: 445 RFGKLQTCLGLAMLLKSYTFSLEDCDVDRPLLIDP 479


>AY524130-1|AAS17758.1|  211|Anopheles gambiae superoxide dismutase
           2 protein.
          Length = 211

 Score = 23.8 bits (49), Expect = 5.5
 Identities = 12/40 (30%), Positives = 22/40 (55%)
 Frame = -2

Query: 416 GLLDLSVPTVKQNVFIVVNHLLLAFGHFAFVLHDRHYVED 297
           G + +S P+  + VFI +N + L  G   F +H++  + D
Sbjct: 35  GNVTISQPSCTEPVFIDINVVGLTPGKHGFHIHEKGDLTD 74


>AJ130949-1|CAA10258.1|  401|Anopheles gambiae SG1 protein protein.
          Length = 401

 Score = 23.8 bits (49), Expect = 5.5
 Identities = 9/19 (47%), Positives = 16/19 (84%)
 Frame = +1

Query: 205 LNKLESSSYNKSNMDQLLL 261
           L+ LES ++N++N ++LLL
Sbjct: 293 LSTLESEAWNQANFERLLL 311


>AF283269-1|AAG15374.1|  114|Anopheles gambiae ribosomal protein S26
           protein.
          Length = 114

 Score = 23.4 bits (48), Expect = 7.3
 Identities = 10/27 (37%), Positives = 17/27 (62%)
 Frame = +3

Query: 21  NVLSVRCVFITNELPGCWALKKYIIKN 101
           +V +VRC      +P   A+KK++I+N
Sbjct: 16  HVKAVRCTNCARCVPKDKAIKKFVIRN 42


>DQ989013-1|ABK97614.1|  378|Anopheles gambiae gustatory receptor 24
           protein.
          Length = 378

 Score = 23.0 bits (47), Expect = 9.7
 Identities = 11/32 (34%), Positives = 14/32 (43%)
 Frame = -2

Query: 143 TMFDFCKPLKRPACILDDIFF*CPTAWQFVCD 48
           TM DF      P C+LD I +     W   C+
Sbjct: 150 TMVDFKLLQVIPYCVLDTITYMMGGYWYMACE 181


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 793,335
Number of Sequences: 2352
Number of extensions: 17596
Number of successful extensions: 24
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 24
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 24
length of database: 563,979
effective HSP length: 63
effective length of database: 415,803
effective search space used: 74428737
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -