SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120024.Seq
         (770 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ989011-1|ABK97612.1|  467|Anopheles gambiae gustatory receptor...    26   1.1  
AY578803-1|AAT07308.1|  474|Anopheles gambiae mothers against Dp...    24   6.0  
AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoi...    24   6.0  

>DQ989011-1|ABK97612.1|  467|Anopheles gambiae gustatory receptor 22
           protein.
          Length = 467

 Score = 26.2 bits (55), Expect = 1.1
 Identities = 11/25 (44%), Positives = 15/25 (60%)
 Frame = -1

Query: 368 PSILTPRGEVSGPTTITPCSAAYLW 294
           P + +P+G     TT T CS A+LW
Sbjct: 87  PIMRSPKGVDMPRTTFTWCSKAFLW 111


>AY578803-1|AAT07308.1|  474|Anopheles gambiae mothers against Dpp
           protein.
          Length = 474

 Score = 23.8 bits (49), Expect = 6.0
 Identities = 12/27 (44%), Positives = 16/27 (59%), Gaps = 1/27 (3%)
 Frame = +3

Query: 651 VKAFSGYL-GEDKSKWAEWDATELVKK 728
           VK   G+  G+++ KWAE     LVKK
Sbjct: 28  VKKLLGWKQGDEEEKWAEKAVDSLVKK 54


>AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA
           topoisomerase protein.
          Length = 1039

 Score = 23.8 bits (49), Expect = 6.0
 Identities = 13/40 (32%), Positives = 18/40 (45%)
 Frame = +2

Query: 194 LPPQAEGGDVKLPLLYYLSGQLVVNKTSSLNLVSRGMQPN 313
           +PP +       P    +   L  N +SS NLV+ GM  N
Sbjct: 868 MPPSSNSSPSSYPSPDVVISGLASNNSSSSNLVAAGMVIN 907


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 853,904
Number of Sequences: 2352
Number of extensions: 18163
Number of successful extensions: 41
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 38
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 41
length of database: 563,979
effective HSP length: 63
effective length of database: 415,803
effective search space used: 80249979
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -