SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120019.Seq
         (804 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY536865-1|AAT07965.1|  650|Anopheles gambiae tryptophan transpo...    29   0.22 
AJ626713-1|CAF25029.1|  650|Anopheles gambiae tryptophan transpo...    29   0.22 
AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 pro...    27   0.90 
AF283269-1|AAG15374.1|  114|Anopheles gambiae ribosomal protein ...    25   2.7  
AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein.         24   4.8  
AJ439060-14|CAD27765.1|  471|Anopheles gambiae putative acetyltr...    24   6.3  
L76038-1|AAC27383.1|  683|Anopheles gambiae prophenoloxidase pro...    23   8.3  
AF031626-1|AAD01936.1|  683|Anopheles gambiae prophenoloxidase p...    23   8.3  

>AY536865-1|AAT07965.1|  650|Anopheles gambiae tryptophan
           transporter protein.
          Length = 650

 Score = 28.7 bits (61), Expect = 0.22
 Identities = 14/31 (45%), Positives = 18/31 (58%)
 Frame = +3

Query: 558 RDFFTRVAETKLYVSFAIVAYVIGILTKTPG 650
           RD F ++    + V  AIV Y IGI+  TPG
Sbjct: 447 RDRFPQLQPALVAVGIAIVGYGIGIIYTTPG 477


>AJ626713-1|CAF25029.1|  650|Anopheles gambiae tryptophan
           transporter protein.
          Length = 650

 Score = 28.7 bits (61), Expect = 0.22
 Identities = 14/31 (45%), Positives = 18/31 (58%)
 Frame = +3

Query: 558 RDFFTRVAETKLYVSFAIVAYVIGILTKTPG 650
           RD F ++    + V  AIV Y IGI+  TPG
Sbjct: 447 RDRFPQLQPALVAVGIAIVGYGIGIIYTTPG 477


>AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 protein.
          Length = 2051

 Score = 26.6 bits (56), Expect = 0.90
 Identities = 10/24 (41%), Positives = 13/24 (54%)
 Frame = -2

Query: 560  PLPQCS*SCHAMRQAKNYKRIHTR 489
            PLP C+  C A  +A  Y  +H R
Sbjct: 1985 PLPTCASQCKATEKAPKYVDVHCR 2008


>AF283269-1|AAG15374.1|  114|Anopheles gambiae ribosomal protein S26
           protein.
          Length = 114

 Score = 25.0 bits (52), Expect = 2.7
 Identities = 11/48 (22%), Positives = 26/48 (54%), Gaps = 3/48 (6%)
 Frame = -2

Query: 407 KRFVLSNLVGIRAIRRQGYVCIFNTLVFGPIF---YFCFTILAHNVIV 273
           K+FV+ N+V   A+R      ++++ V   ++   ++C +   H+ +V
Sbjct: 36  KKFVIRNIVEAAAVRDISDASVYSSYVLPKLYAKLHYCVSCAIHSKVV 83


>AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein.
          Length = 2259

 Score = 24.2 bits (50), Expect = 4.8
 Identities = 9/30 (30%), Positives = 16/30 (53%)
 Frame = +2

Query: 398 RIVWRQHYHQRCTSKRRQTQVCVQMHVQFT 487
           R+ W  HY +RC   R +T   +   ++F+
Sbjct: 203 RLCWELHYLERCLRARIETASDITSVLRFS 232


>AJ439060-14|CAD27765.1|  471|Anopheles gambiae putative
           acetyltransferase protein.
          Length = 471

 Score = 23.8 bits (49), Expect = 6.3
 Identities = 9/19 (47%), Positives = 14/19 (73%)
 Frame = -2

Query: 65  EHVWVVLV*RHVYMAQFSF 9
           EH++V L  +HV+ A+F F
Sbjct: 131 EHIFVALRDQHVFRAKFRF 149


>L76038-1|AAC27383.1|  683|Anopheles gambiae prophenoloxidase
           protein.
          Length = 683

 Score = 23.4 bits (48), Expect = 8.3
 Identities = 12/49 (24%), Positives = 20/49 (40%)
 Frame = -3

Query: 556 FRNVRNHVTQCGRPKITNVSIRDCKLDMHLYTHLGLPSFTSTALMVMLS 410
           FRN+  +  +   P+    +   C    H+    GLP      L +M+S
Sbjct: 559 FRNLDQNRPEADTPQEAEFNFCGCGWPAHMLIPKGLPEGLPADLFIMVS 607


>AF031626-1|AAD01936.1|  683|Anopheles gambiae prophenoloxidase
           protein.
          Length = 683

 Score = 23.4 bits (48), Expect = 8.3
 Identities = 12/49 (24%), Positives = 20/49 (40%)
 Frame = -3

Query: 556 FRNVRNHVTQCGRPKITNVSIRDCKLDMHLYTHLGLPSFTSTALMVMLS 410
           FRN+  +  +   P+    +   C    H+    GLP      L +M+S
Sbjct: 559 FRNLDQNRPEADTPQEAEFNFCGCGWPAHMLIPKGLPEGLPADLFIMVS 607


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 810,617
Number of Sequences: 2352
Number of extensions: 17381
Number of successful extensions: 31
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 30
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 31
length of database: 563,979
effective HSP length: 63
effective length of database: 415,803
effective search space used: 84823812
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -