SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120017.Seq
         (731 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

M93690-1|AAA29364.1|  613|Anopheles gambiae ORF1 protein.              29   0.15 
AB090813-1|BAC57901.1|  724|Anopheles gambiae gag-like protein p...    29   0.20 
AJ535208-1|CAD59408.1| 1133|Anopheles gambiae SMC6 protein protein.    28   0.26 
AB090816-1|BAC57907.1|  455|Anopheles gambiae gag-like protein p...    26   1.0  
X95912-1|CAA65156.1|  696|Anopheles gambiae immune factor protein.     26   1.4  
AJ439060-4|CAD27755.1|  151|Anopheles gambiae putative sRNP prot...    25   2.4  
AB090821-1|BAC57917.1|  353|Anopheles gambiae gag-like protein p...    25   2.4  
AY347946-1|AAR28374.1|  640|Anopheles gambiae putative NPY GPCR ...    25   3.2  
AY928182-1|AAX22219.1|  335|Anopheles gambiae phenoloxidase inhi...    24   4.2  
AY263175-1|AAP78790.1|  814|Anopheles gambiae TmcA-like protein ...    24   4.2  
AY146723-1|AAO12083.1|  155|Anopheles gambiae odorant-binding pr...    24   4.2  
AY146721-1|AAO12081.1|  144|Anopheles gambiae odorant-binding pr...    24   4.2  
AF437884-1|AAL84179.1|  144|Anopheles gambiae odorant binding pr...    24   4.2  
AB090820-1|BAC57915.1|  527|Anopheles gambiae gag-like protein p...    24   4.2  
AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein.            24   5.6  
CR954256-3|CAJ14144.1|  659|Anopheles gambiae cyclin protein.          23   7.4  
AJ438610-4|CAD27476.1|  593|Anopheles gambiae putative transcrip...    23   7.4  
U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse tra...    23   9.7  
AY645022-1|AAT92558.1|  165|Anopheles gambiae hairy protein.           23   9.7  
AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/T...    23   9.7  
AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/T...    23   9.7  

>M93690-1|AAA29364.1|  613|Anopheles gambiae ORF1 protein.
          Length = 613

 Score = 29.1 bits (62), Expect = 0.15
 Identities = 19/56 (33%), Positives = 27/56 (48%)
 Frame = +3

Query: 87  HQRANLQQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQRTDARRRRIYLVQQ 254
           HQ+   QQ+ RV+   + + Q   + QQQ +    +  QQE  T   RRR    QQ
Sbjct: 269 HQQREQQQQQRVQ-QQNQQHQRQQQQQQQQRQQQQQQEQQELWTTVVRRRQNTQQQ 323



 Score = 27.1 bits (57), Expect = 0.60
 Identities = 19/75 (25%), Positives = 30/75 (40%)
 Frame = +3

Query: 30  LQHPSAAAEVSL*SGNGHIHQRANLQQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQE 209
           LQ  +AAA +    G      R   Q   +       +Q    E QQQ +    +  QQ+
Sbjct: 190 LQQQAAAAPMMTAQGAHSSRNRRGRQGPQQQEQRQQQQQHQQREQQQQQQQQQQQQQQQQ 249

Query: 210 QRTDARRRRIYLVQQ 254
           Q+    ++R +  QQ
Sbjct: 250 QQQQRNQQREWQQQQ 264



 Score = 26.6 bits (56), Expect = 0.79
 Identities = 15/55 (27%), Positives = 25/55 (45%)
 Frame = +3

Query: 90  QRANLQQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQRTDARRRRIYLVQQ 254
           Q+   QQ+ + +      QQ   + QQQ +    R  QQ+QR   + ++    QQ
Sbjct: 238 QQQQQQQQQQQQQQQQRNQQREWQQQQQQQQHQQREQQQQQRVQQQNQQHQRQQQ 292



 Score = 25.8 bits (54), Expect = 1.4
 Identities = 17/57 (29%), Positives = 27/57 (47%)
 Frame = +3

Query: 90  QRANLQQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQRTDARRRRIYLVQQCV 260
           Q+   QQR + +     +QQ   + QQQ +    R  QQ+Q+    ++R    QQ V
Sbjct: 225 QQQQHQQREQQQQQQQQQQQQ-QQQQQQQQRNQQREWQQQQQQQQHQQREQQQQQRV 280


>AB090813-1|BAC57901.1|  724|Anopheles gambiae gag-like protein
           protein.
          Length = 724

 Score = 28.7 bits (61), Expect = 0.20
 Identities = 18/71 (25%), Positives = 34/71 (47%)
 Frame = +3

Query: 42  SAAAEVSL*SGNGHIHQRANLQQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQRTD 221
           +A A +   SG G   + A  +Q+   R   + +QQ   + QQQ +    +  Q++Q+  
Sbjct: 154 AANATLQQSSGQGGNRETARKRQQRLRRRERERQQQQQQQQQQQQQQQQQQQQQRQQQQQ 213

Query: 222 ARRRRIYLVQQ 254
            +++R    QQ
Sbjct: 214 CQQQRQQQPQQ 224



 Score = 26.6 bits (56), Expect = 0.79
 Identities = 15/50 (30%), Positives = 25/50 (50%)
 Frame = +3

Query: 90  QRANLQQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQRTDARRRRI 239
           QR   QQ+ + +     RQQ   + QQQH+    +  QQ+Q+    R+ +
Sbjct: 335 QRQQQQQQQQQQRQQQQRQQQ-QQQQQQHQQQQQQWQQQQQQQQQPRQSL 383



 Score = 26.2 bits (55), Expect = 1.0
 Identities = 14/55 (25%), Positives = 27/55 (49%)
 Frame = +3

Query: 90  QRANLQQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQRTDARRRRIYLVQQ 254
           Q+   QQ+ R +     ++Q   + QQQ +    R  QQ+Q+   ++++    QQ
Sbjct: 318 QQQQRQQQQRQQQRQQQQRQQQQQQQQQQRQQQQRQQQQQQQQQHQQQQQQWQQQ 372



 Score = 26.2 bits (55), Expect = 1.0
 Identities = 14/55 (25%), Positives = 28/55 (50%)
 Frame = +3

Query: 90  QRANLQQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQRTDARRRRIYLVQQ 254
           Q+   QQ+ + +     RQQ   + QQQ +    +  QQ+Q+   ++++ +  QQ
Sbjct: 319 QQQRQQQQRQQQRQQQQRQQQQQQQQQQRQQQQRQQQQQQQQQHQQQQQQWQQQQ 373



 Score = 25.8 bits (54), Expect = 1.4
 Identities = 14/55 (25%), Positives = 26/55 (47%)
 Frame = +3

Query: 90  QRANLQQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQRTDARRRRIYLVQQ 254
           QR   Q + + +     RQQ   + Q+Q +    +  QQ+Q+   ++R+    QQ
Sbjct: 305 QRQQQQHQQQQQQQQQQRQQQQRQQQRQQQQRQQQQQQQQQQRQQQQRQQQQQQQ 359



 Score = 25.8 bits (54), Expect = 1.4
 Identities = 14/52 (26%), Positives = 25/52 (48%)
 Frame = +3

Query: 90  QRANLQQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQRTDARRRRIYL 245
           Q+   QQR + +     +QQ  H+ QQQ      +  QQ +++   R++  L
Sbjct: 340 QQQQQQQRQQQQRQQQQQQQQQHQQQQQQWQQQQQQQQQPRQSLPHRKQTQL 391



 Score = 25.4 bits (53), Expect = 1.8
 Identities = 16/58 (27%), Positives = 27/58 (46%)
 Frame = +3

Query: 81  HIHQRANLQQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQRTDARRRRIYLVQQ 254
           H  Q+   QQ+ + +     RQQ   + QQQ +    R  QQ Q+   ++++    QQ
Sbjct: 311 HQQQQQQQQQQRQQQQRQQQRQQQQRQQQQQQQ-QQQRQQQQRQQQQQQQQQHQQQQQ 367



 Score = 25.4 bits (53), Expect = 1.8
 Identities = 14/55 (25%), Positives = 27/55 (49%)
 Frame = +3

Query: 90  QRANLQQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQRTDARRRRIYLVQQ 254
           Q+   QQR + R     +QQ   + QQ+ +    +  QQ+Q+   ++++    QQ
Sbjct: 320 QQRQQQQRQQQRQQQQRQQQQQQQQQQRQQQQRQQQQQQQQQHQQQQQQWQQQQQ 374



 Score = 24.6 bits (51), Expect = 3.2
 Identities = 15/55 (27%), Positives = 24/55 (43%)
 Frame = +3

Query: 90  QRANLQQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQRTDARRRRIYLVQQ 254
           Q+   QQ+         RQQ   +  QQ +    +  QQ+QR   R+++    QQ
Sbjct: 286 QQQQQQQQGERYVPPQLRQQRQQQQHQQQQQQQQQQRQQQQRQQQRQQQQRQQQQ 340



 Score = 23.8 bits (49), Expect = 5.6
 Identities = 14/56 (25%), Positives = 26/56 (46%)
 Frame = +3

Query: 87  HQRANLQQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQRTDARRRRIYLVQQ 254
           HQ+   Q + + +     RQ   H  Q Q +L      QQ+Q+  +++++    QQ
Sbjct: 362 HQQQQQQWQQQQQQQQQPRQSLPHRKQTQLQLSPRLQQQQQQQQQSQQQQQQQPQQ 417



 Score = 23.4 bits (48), Expect = 7.4
 Identities = 13/55 (23%), Positives = 27/55 (49%)
 Frame = +3

Query: 90  QRANLQQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQRTDARRRRIYLVQQ 254
           Q+   QQ+ + +     +QQ   + QQQ +    +  QQ+++   R+++    QQ
Sbjct: 307 QQQQHQQQQQQQQQQRQQQQRQQQRQQQQRQQQQQQQQQQRQQQQRQQQQQQQQQ 361



 Score = 23.0 bits (47), Expect = 9.7
 Identities = 13/56 (23%), Positives = 28/56 (50%), Gaps = 1/56 (1%)
 Frame = +3

Query: 90  QRANLQQRARVRAAYDARQQNGH-EPQQQHKLGSDRTVQQEQRTDARRRRIYLVQQ 254
           QR   ++R R +     +QQ    + QQQ +    +  QQ+++   +++++   QQ
Sbjct: 177 QRLRRRERERQQQQQQQQQQQQQQQQQQQQQRQQQQQCQQQRQQQPQQQQLQQPQQ 232



 Score = 23.0 bits (47), Expect = 9.7
 Identities = 12/49 (24%), Positives = 24/49 (48%)
 Frame = +3

Query: 90  QRANLQQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQRTDARRRR 236
           QR   Q++ + +     RQQ   + QQQ +    +  QQ Q+   ++++
Sbjct: 330 QRQQQQRQQQQQQQQQQRQQQQRQQQQQQQQQHQQQQQQWQQQQQQQQQ 378



 Score = 23.0 bits (47), Expect = 9.7
 Identities = 16/87 (18%), Positives = 33/87 (37%)
 Frame = +3

Query: 90  QRANLQQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQRTDARRRRIYLVQQCVDFV 269
           Q+   QQ+ + +     +QQ     QQQ +    +  QQ+ R     R+   +Q      
Sbjct: 339 QQQQQQQQRQQQQRQQQQQQQQQHQQQQQQWQQQQQQQQQPRQSLPHRKQTQLQLSPRLQ 398

Query: 270 QKIIRYYRCNDMSELSPLMIHFINTIR 350
           Q+  +  +     +  P  + +   +R
Sbjct: 399 QQQQQQQQSQQQQQQQPQQLLWTTVVR 425


>AJ535208-1|CAD59408.1| 1133|Anopheles gambiae SMC6 protein protein.
          Length = 1133

 Score = 28.3 bits (60), Expect = 0.26
 Identities = 12/40 (30%), Positives = 21/40 (52%)
 Frame = +3

Query: 114 ARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQRTDARRR 233
           AR++A+ D  QQ  H+ Q  HK+      +  +  + R+R
Sbjct: 838 ARIQASIDKEQQARHDLQTNHKVKQQALKRSTESMEERKR 877


>AB090816-1|BAC57907.1|  455|Anopheles gambiae gag-like protein
           protein.
          Length = 455

 Score = 26.2 bits (55), Expect = 1.0
 Identities = 14/53 (26%), Positives = 30/53 (56%)
 Frame = +3

Query: 93  RANLQQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQRTDARRRRIYLVQ 251
           +++ QQR + + +   +QQ   + QQQ +   ++  QQ+Q+   RR +  L++
Sbjct: 179 KSSSQQREQQQRSLQQQQQQQQQQQQQQQ---EQQQQQQQQRKIRRPKADLIE 228


>X95912-1|CAA65156.1|  696|Anopheles gambiae immune factor protein.
          Length = 696

 Score = 25.8 bits (54), Expect = 1.4
 Identities = 15/50 (30%), Positives = 19/50 (38%)
 Frame = +3

Query: 72  GNGHIHQRANLQQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQRTD 221
           GN   H  +N QQ  +   A    QQ   + QQQ +        Q  R D
Sbjct: 629 GNYQQHSASNQQQAIKALLATQQLQQQQQQQQQQQQQQQQGQTGQADRID 678


>AJ439060-4|CAD27755.1|  151|Anopheles gambiae putative sRNP
           protein.
          Length = 151

 Score = 25.0 bits (52), Expect = 2.4
 Identities = 13/33 (39%), Positives = 18/33 (54%), Gaps = 1/33 (3%)
 Frame = -3

Query: 648 HVTDSATM-YWTAKLSCLPASAKASLPNISAPP 553
           H+ D+ T  Y   K++  P +A    PNIS PP
Sbjct: 48  HLIDATTAAYKAGKIAPNPFTAGPPKPNISIPP 80


>AB090821-1|BAC57917.1|  353|Anopheles gambiae gag-like protein
           protein.
          Length = 353

 Score = 25.0 bits (52), Expect = 2.4
 Identities = 22/62 (35%), Positives = 28/62 (45%), Gaps = 3/62 (4%)
 Frame = +3

Query: 90  QRANLQQRARVRAAYDARQQNGHE-PQQQHKLGSDRTVQQ--EQRTDARRRRIYLVQQCV 260
           Q+   QQR   R A    QQ      QQQH+  S+ T  Q  EQ  + +RR   L Q  +
Sbjct: 73  QQQQQQQRQPQRQAVVGTQQQQQRRQQQQHQQRSNATQAQRREQLRNEQRRPARLRQDQI 132

Query: 261 DF 266
            F
Sbjct: 133 IF 134


>AY347946-1|AAR28374.1|  640|Anopheles gambiae putative NPY GPCR
           protein.
          Length = 640

 Score = 24.6 bits (51), Expect = 3.2
 Identities = 13/38 (34%), Positives = 19/38 (50%)
 Frame = +1

Query: 601 TTQLGRPVHGGGIGDVQHSHSVTVQSAAGQQLHDSVAQ 714
           T   G     GG G +  S++ +  SAAG +L D  A+
Sbjct: 30  TGPAGNGTGSGGFGALAGSNASSAGSAAGPELFDMYAR 67


>AY928182-1|AAX22219.1|  335|Anopheles gambiae phenoloxidase
           inhibitor protein protein.
          Length = 335

 Score = 24.2 bits (50), Expect = 4.2
 Identities = 7/15 (46%), Positives = 9/15 (60%)
 Frame = -2

Query: 61  DTSAAAEGCCNKNCH 17
           D+    E CC+ NCH
Sbjct: 313 DSCTRHENCCSSNCH 327


>AY263175-1|AAP78790.1|  814|Anopheles gambiae TmcA-like protein
           protein.
          Length = 814

 Score = 24.2 bits (50), Expect = 4.2
 Identities = 11/25 (44%), Positives = 15/25 (60%), Gaps = 1/25 (4%)
 Frame = +2

Query: 641 VTCNIPIPLPFNQQLANN-YMTLLL 712
           +TCN+P  + F    +NN Y  LLL
Sbjct: 583 LTCNVPHEVVFRASRSNNFYFALLL 607


>AY146723-1|AAO12083.1|  155|Anopheles gambiae odorant-binding
           protein AgamOBP17 protein.
          Length = 155

 Score = 24.2 bits (50), Expect = 4.2
 Identities = 7/32 (21%), Positives = 16/32 (50%)
 Frame = +3

Query: 318 PLMIHFINTIRDMCIDTNPINVNVVKRFESEE 413
           P ++  +  + D+C+    +    +K+F  EE
Sbjct: 32  PELLEALKPLHDICLGKTGVTEEAIKKFSDEE 63


>AY146721-1|AAO12081.1|  144|Anopheles gambiae odorant-binding
           protein AgamOBP1 protein.
          Length = 144

 Score = 24.2 bits (50), Expect = 4.2
 Identities = 7/32 (21%), Positives = 16/32 (50%)
 Frame = +3

Query: 318 PLMIHFINTIRDMCIDTNPINVNVVKRFESEE 413
           P ++  +  + D+C+    +    +K+F  EE
Sbjct: 32  PELLEALKPLHDICLGKTGVTEEAIKKFSDEE 63


>AF437884-1|AAL84179.1|  144|Anopheles gambiae odorant binding
           protein protein.
          Length = 144

 Score = 24.2 bits (50), Expect = 4.2
 Identities = 7/32 (21%), Positives = 16/32 (50%)
 Frame = +3

Query: 318 PLMIHFINTIRDMCIDTNPINVNVVKRFESEE 413
           P ++  +  + D+C+    +    +K+F  EE
Sbjct: 32  PELLEALKPLHDICLGKTGVTEEAIKKFSDEE 63


>AB090820-1|BAC57915.1|  527|Anopheles gambiae gag-like protein
           protein.
          Length = 527

 Score = 24.2 bits (50), Expect = 4.2
 Identities = 20/56 (35%), Positives = 29/56 (51%), Gaps = 4/56 (7%)
 Frame = +3

Query: 78  GHIHQRANL-QQRARVRAAYDARQQNGHEP---QQQHKLGSDRTVQQEQRTDARRR 233
           G+     NL QQ A+ + A+   QQ  H+    QQQ ++G     QQE+R   R+R
Sbjct: 251 GNKQNGVNLPQQSAQRQPAHRQHQQWPHQQNGQQQQQRMGIH---QQEKRRPRRKR 303


>AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein.
          Length = 3398

 Score = 23.8 bits (49), Expect = 5.6
 Identities = 23/83 (27%), Positives = 29/83 (34%), Gaps = 1/83 (1%)
 Frame = +1

Query: 28   YYNTPPPPLRYPSNPATAIFTNAQTYNNAPGYVPPTTRDNKMDTSRSNSTNSVA-IAPYN 204
            Y N     LRYP + A + FT    YN   G V       K       S N+   +   N
Sbjct: 2073 YENGKLHSLRYPMDSAASSFTLIYDYNK-NGEVKSIKESTKRVPMFEFSYNADGMVETMN 2131

Query: 205  KSKEPTLDAGESIWYNNVWILFK 273
               +PT     +  YN    L K
Sbjct: 2132 VRTDPTHTFQRNFTYNEPGFLIK 2154


>CR954256-3|CAJ14144.1|  659|Anopheles gambiae cyclin protein.
          Length = 659

 Score = 23.4 bits (48), Expect = 7.4
 Identities = 12/35 (34%), Positives = 16/35 (45%)
 Frame = +1

Query: 622 VHGGGIGDVQHSHSVTVQSAAGQQLHDSVAQARHS 726
           V GGG G  +  +  T +   G   HD    +RHS
Sbjct: 600 VGGGGGGYDRDDYRRTEKDYRGNGKHDKYGSSRHS 634


>AJ438610-4|CAD27476.1|  593|Anopheles gambiae putative
           transcription factor protein.
          Length = 593

 Score = 23.4 bits (48), Expect = 7.4
 Identities = 9/25 (36%), Positives = 14/25 (56%)
 Frame = +1

Query: 31  YNTPPPPLRYPSNPATAIFTNAQTY 105
           +N PPPP   P  P + + + A +Y
Sbjct: 373 HNQPPPPPYQPPQPYSLMASVAPSY 397


>U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse
           transcriptase protein.
          Length = 1049

 Score = 23.0 bits (47), Expect = 9.7
 Identities = 11/55 (20%), Positives = 23/55 (41%)
 Frame = -1

Query: 425 AYHGLLRFKPLYHVYVDRVRVDAHVTNSVYKMNHERTKF*HVIAPVISNNFLNKI 261
           AY  +  ++P      +   VD    N + ++NH       ++  + +NN   K+
Sbjct: 244 AYSSITHYEPTARSLANNTFVDGFKFNGLVQLNHINNSHGRMLDLLYANNAAAKL 298


>AY645022-1|AAT92558.1|  165|Anopheles gambiae hairy protein.
          Length = 165

 Score = 23.0 bits (47), Expect = 9.7
 Identities = 12/51 (23%), Positives = 22/51 (43%)
 Frame = +1

Query: 31  YNTPPPPLRYPSNPATAIFTNAQTYNNAPGYVPPTTRDNKMDTSRSNSTNS 183
           Y+ PP P      P         + N++ GY+    + +   +S S+S+ S
Sbjct: 72  YHAPPSPANSHYEPMECHSAVNSSSNSSTGYLHQHQQSSSSSSSSSSSSMS 122


>AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/Thr
            phosphatase protein.
          Length = 1977

 Score = 23.0 bits (47), Expect = 9.7
 Identities = 9/27 (33%), Positives = 14/27 (51%)
 Frame = +1

Query: 628  GGGIGDVQHSHSVTVQSAAGQQLHDSV 708
            GG    +QH  +VT  +AA   + D +
Sbjct: 1916 GGNASFLQHRTNVTAAAAASMMMRDRI 1942


>AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/Thr
            phosphatase protein.
          Length = 1978

 Score = 23.0 bits (47), Expect = 9.7
 Identities = 9/27 (33%), Positives = 14/27 (51%)
 Frame = +1

Query: 628  GGGIGDVQHSHSVTVQSAAGQQLHDSV 708
            GG    +QH  +VT  +AA   + D +
Sbjct: 1917 GGNASFLQHRTNVTAAAAASMMMRDRI 1943


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 776,916
Number of Sequences: 2352
Number of extensions: 18230
Number of successful extensions: 127
Number of sequences better than 10.0: 21
Number of HSP's better than 10.0 without gapping: 66
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 100
length of database: 563,979
effective HSP length: 63
effective length of database: 415,803
effective search space used: 74844540
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -