SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120016.Seq
         (678 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF387862-2|AAL56548.1|  942|Anopheles gambiae pol polyprotein pr...    25   2.9  
AY391745-1|AAR28995.1|  460|Anopheles gambiae putative GPCR prot...    23   6.7  
AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein.            23   8.9  
AY705396-1|AAU12505.1|  710|Anopheles gambiae nicotinic acetylch...    23   8.9  

>AF387862-2|AAL56548.1|  942|Anopheles gambiae pol polyprotein
           protein.
          Length = 942

 Score = 24.6 bits (51), Expect = 2.9
 Identities = 13/38 (34%), Positives = 19/38 (50%)
 Frame = +2

Query: 152 RRSYDFCFAYVDDILVYSRDALQHAAHLRTLFKRLKIT 265
           R  + F   YVDD+LV   +  ++     TL +  KIT
Sbjct: 615 RDRWSFILLYVDDMLVACSEDREYEDIENTLKRHFKIT 652


>AY391745-1|AAR28995.1|  460|Anopheles gambiae putative GPCR
           protein.
          Length = 460

 Score = 23.4 bits (48), Expect = 6.7
 Identities = 18/63 (28%), Positives = 28/63 (44%), Gaps = 2/63 (3%)
 Frame = +2

Query: 173 FAYVDDILVYSRDALQHAAHLRTLFKRLKITESLLIQQN--ACLVLLRLLFSETEYPPTE 346
           FA     L Y R   + A   R L  ++K+T+ LLI  +   CL L   +     +  T 
Sbjct: 291 FALFTLSLRYDRLLYRTAGENRMLHSQMKVTKMLLIVSSVFVCLNLPSYVMRVRAFVETG 350

Query: 347 HNH 355
           H++
Sbjct: 351 HSY 353


>AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein.
          Length = 3398

 Score = 23.0 bits (47), Expect = 8.9
 Identities = 7/16 (43%), Positives = 13/16 (81%)
 Frame = -1

Query: 612  AKGVPPELQMTSYLYR 565
            A   PP++++TSY+Y+
Sbjct: 2604 ASDQPPDVRVTSYIYK 2619


>AY705396-1|AAU12505.1|  710|Anopheles gambiae nicotinic
           acetylcholine receptor subunitalpha 3 protein.
          Length = 710

 Score = 23.0 bits (47), Expect = 8.9
 Identities = 17/55 (30%), Positives = 25/55 (45%), Gaps = 2/55 (3%)
 Frame = +1

Query: 442 YRRFLRNAAKLQAPLVNAIVATEVKVSHR--SLGHLSSKNALMPVKIACHLQLWW 600
           Y   L N  KL  P+VN   A  VK+  +   L  ++ KN +M   +    Q W+
Sbjct: 28  YDDLLSNYNKLVRPVVNVTDALTVKIKLKLSQLIDVNLKNQIMTTNLWVE-QTWY 81


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 663,382
Number of Sequences: 2352
Number of extensions: 12436
Number of successful extensions: 24
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 22
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 24
length of database: 563,979
effective HSP length: 62
effective length of database: 418,155
effective search space used: 68159265
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -