SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120012.Seq
         (701 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY500851-1|AAS77205.1|  605|Anopheles gambiae G-protein coupled ...    25   2.3  
AY578804-1|AAT07309.1|  133|Anopheles gambiae maverick protein.        24   4.0  
AY578799-1|AAT07304.1|  679|Anopheles gambiae brinker protein.         24   5.3  
AF000953-1|AAB96576.1|  433|Anopheles gambiae carboxypeptidase A...    23   7.0  
AY146747-1|AAO12062.1|  288|Anopheles gambiae odorant-binding pr...    23   9.3  
AJ618931-1|CAF02009.1|  288|Anopheles gambiae odorant-binding pr...    23   9.3  

>AY500851-1|AAS77205.1|  605|Anopheles gambiae G-protein coupled
           receptor 3 protein.
          Length = 605

 Score = 25.0 bits (52), Expect = 2.3
 Identities = 9/24 (37%), Positives = 16/24 (66%)
 Frame = +3

Query: 180 DAVSRHVDKKYKYTYSESGARLPP 251
           D+ S H+++  + T+S +  RLPP
Sbjct: 65  DSGSSHLERTIELTFSPADCRLPP 88


>AY578804-1|AAT07309.1|  133|Anopheles gambiae maverick protein.
          Length = 133

 Score = 24.2 bits (50), Expect = 4.0
 Identities = 8/18 (44%), Positives = 12/18 (66%)
 Frame = +1

Query: 637 PTSTACTPGFRKLCREKM 690
           P +TACT G ++ CR  +
Sbjct: 21  PKTTACTAGNKRCCRHPL 38


>AY578799-1|AAT07304.1|  679|Anopheles gambiae brinker protein.
          Length = 679

 Score = 23.8 bits (49), Expect = 5.3
 Identities = 11/25 (44%), Positives = 17/25 (68%)
 Frame = -3

Query: 426 LPVHST*GITSSKSHSCNSMAYGSL 352
           +PV S   ++++ S SC+S A GSL
Sbjct: 233 IPVSSCSPLSTASSASCSSSAAGSL 257


>AF000953-1|AAB96576.1|  433|Anopheles gambiae carboxypeptidase A
           protein.
          Length = 433

 Score = 23.4 bits (48), Expect = 7.0
 Identities = 11/40 (27%), Positives = 18/40 (45%)
 Frame = +3

Query: 126 VKFVAKDIASSLKYGNCKDAVSRHVDKKYKYTYSESGARL 245
           VK +AK   +  KYGN  DA+         ++Y     ++
Sbjct: 343 VKSLAKRYGTQYKYGNVIDAIYPASGSSVDWSYGAQDVKI 382


>AY146747-1|AAO12062.1|  288|Anopheles gambiae odorant-binding
           protein AgamOBP42 protein.
          Length = 288

 Score = 23.0 bits (47), Expect = 9.3
 Identities = 13/31 (41%), Positives = 15/31 (48%)
 Frame = -2

Query: 244 SLAPDSLYVYLYFLSTCLLTASLQFPYFKLL 152
           SLA  SLY   YF  T L T     P  +L+
Sbjct: 246 SLAARSLYECYYFADTLLPTFERILPLLRLV 276


>AJ618931-1|CAF02009.1|  288|Anopheles gambiae odorant-binding
           protein OBPjj83d protein.
          Length = 288

 Score = 23.0 bits (47), Expect = 9.3
 Identities = 13/31 (41%), Positives = 15/31 (48%)
 Frame = -2

Query: 244 SLAPDSLYVYLYFLSTCLLTASLQFPYFKLL 152
           SLA  SLY   YF  T L T     P  +L+
Sbjct: 246 SLAARSLYECYYFADTLLPTFERILPLLRLV 276


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 719,157
Number of Sequences: 2352
Number of extensions: 13919
Number of successful extensions: 27
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 27
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 27
length of database: 563,979
effective HSP length: 62
effective length of database: 418,155
effective search space used: 71504505
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -