SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120009.Seq
         (721 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

EF014219-1|ABJ91581.1|  647|Anopheles gambiae cation proton anti...    29   0.19 
AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-conta...    25   1.8  
DQ342048-1|ABC69940.1|  847|Anopheles gambiae STIP protein.            25   2.4  
AJ459961-1|CAD31060.1|  700|Anopheles gambiae prophenoloxidase 8...    24   4.1  
AY705396-1|AAU12505.1|  710|Anopheles gambiae nicotinic acetylch...    24   5.4  
AY324314-1|AAQ89699.1|  153|Anopheles gambiae insulin-like pepti...    23   9.5  

>EF014219-1|ABJ91581.1|  647|Anopheles gambiae cation proton
           antiporter protein.
          Length = 647

 Score = 28.7 bits (61), Expect = 0.19
 Identities = 12/21 (57%), Positives = 16/21 (76%)
 Frame = -2

Query: 132 PLCPRYRQFSQDISGILLCTL 70
           PLCP YRQF++ +S IL+  L
Sbjct: 141 PLCPSYRQFARILSIILIGVL 161


>AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative
           TPR-containing phosphoprotein protein.
          Length = 1200

 Score = 25.4 bits (53), Expect = 1.8
 Identities = 11/33 (33%), Positives = 17/33 (51%)
 Frame = +3

Query: 162 EKMFHEQCIQRWRREHTRDPFNRAIKYYFNFPQ 260
           E M  E C Q  R  H +  +++A +YY+   Q
Sbjct: 301 EAMRAESCYQLARAFHVQRDYDQAFQYYYQSTQ 333


>DQ342048-1|ABC69940.1|  847|Anopheles gambiae STIP protein.
          Length = 847

 Score = 25.0 bits (52), Expect = 2.4
 Identities = 12/31 (38%), Positives = 16/31 (51%), Gaps = 4/31 (12%)
 Frame = +3

Query: 540 LDLCASVKLTP----FKPMRPPKPMQCWIHP 620
           L+    VKLT     + P+    P+ CWIHP
Sbjct: 542 LEQIVLVKLTAAVIEWDPLTDTVPIHCWIHP 572


>AJ459961-1|CAD31060.1|  700|Anopheles gambiae prophenoloxidase 8
           protein.
          Length = 700

 Score = 24.2 bits (50), Expect = 4.1
 Identities = 11/28 (39%), Positives = 13/28 (46%)
 Frame = -2

Query: 198 ANAECIVRETFFPSLTCQCRALPLCPRY 115
           AN    VRE ++P L         CPRY
Sbjct: 275 ANLREPVREAYYPKLLRTSNNRTFCPRY 302


>AY705396-1|AAU12505.1|  710|Anopheles gambiae nicotinic
           acetylcholine receptor subunitalpha 3 protein.
          Length = 710

 Score = 23.8 bits (49), Expect = 5.4
 Identities = 14/39 (35%), Positives = 21/39 (53%), Gaps = 1/39 (2%)
 Frame = +3

Query: 321 KLIAFTSAFINALHKKTPWTLNSILGIFLKNAIM-TNVW 434
           KL+       +AL  K    L+ ++ + LKN IM TN+W
Sbjct: 37  KLVRPVVNVTDALTVKIKLKLSQLIDVNLKNQIMTTNLW 75


>AY324314-1|AAQ89699.1|  153|Anopheles gambiae insulin-like peptide
           7 precursor protein.
          Length = 153

 Score = 23.0 bits (47), Expect = 9.5
 Identities = 16/48 (33%), Positives = 24/48 (50%)
 Frame = +2

Query: 398 NFFKKCNHDERMVRDGRQPHQLCTER*FIFDK**LHYLNVFDQETDQV 541
           N F+K + +  M   G +PHQL  E     ++  LH LN  D+  D +
Sbjct: 65  NGFRKKSENVLMTLAGPEPHQLLDELERDIER--LHTLN--DRSADMI 108


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 742,854
Number of Sequences: 2352
Number of extensions: 15997
Number of successful extensions: 36
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 35
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 36
length of database: 563,979
effective HSP length: 63
effective length of database: 415,803
effective search space used: 73181328
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -