SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120008.Seq
         (681 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY957503-1|AAY41942.1|  596|Anopheles gambiae vasa-like protein ...    81   3e-17
AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein.         25   2.9  
AY263175-1|AAP78790.1|  814|Anopheles gambiae TmcA-like protein ...    23   8.9  
AJ441131-8|CAD29637.1|  756|Anopheles gambiae putative 5-oxoprol...    23   8.9  
AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/T...    23   8.9  
AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative 5-oxoprol...    23   8.9  
AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/T...    23   8.9  

>AY957503-1|AAY41942.1|  596|Anopheles gambiae vasa-like protein
           protein.
          Length = 596

 Score = 81.0 bits (191), Expect = 3e-17
 Identities = 38/82 (46%), Positives = 57/82 (69%), Gaps = 4/82 (4%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQI----RPDRQTLMWSAT 424
           GRL+DF+++G    +   ++VLDEADRMLDMGF P I K++       +  RQTLM+SAT
Sbjct: 308 GRLLDFIDRGYVTFENVNFVVLDEADRMLDMGFLPSIEKVMGHATMPEKQQRQTLMFSAT 367

Query: 425 WPKEVKKLAEDYLGDYIQINIG 490
           +P E+++LA  +L +YI + +G
Sbjct: 368 FPAEIQELAGKFLHNYICVFVG 389



 Score = 54.0 bits (124), Expect = 4e-09
 Identities = 29/86 (33%), Positives = 48/86 (55%), Gaps = 2/86 (2%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHI-NNQPPIR-RGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRN 176
           GSGKT A++LP I H+ + +  +  R   P  +++APTRELA QI      F H + ++ 
Sbjct: 221 GSGKTAAFMLPMIHHLLDKEDSLELRTRNPYIVIVAPTRELAIQIHDEGRKFAHGTKLKV 280

Query: 177 TCVFGGAPKREQARDLERGVEIVIAT 254
              +GG   + Q + +  G  +++AT
Sbjct: 281 CVSYGGTAVQHQLQLMRGGCHVLVAT 306


>AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein.
          Length = 2259

 Score = 24.6 bits (51), Expect = 2.9
 Identities = 8/25 (32%), Positives = 17/25 (68%)
 Frame = +2

Query: 263 LIDFLEKGTTNLQRCTYLVLDEADR 337
           L+ ++E+GT  +Q  + L++DE  +
Sbjct: 133 LLQYIEQGTVRVQDISLLIVDECHK 157


>AY263175-1|AAP78790.1|  814|Anopheles gambiae TmcA-like protein
           protein.
          Length = 814

 Score = 23.0 bits (47), Expect = 8.9
 Identities = 8/19 (42%), Positives = 10/19 (52%)
 Frame = +3

Query: 318 FLMRLIVCWIWDLNHKSEK 374
           F+  +  CW WDL  K  K
Sbjct: 515 FVRYMNSCWCWDLEKKFPK 533


>AJ441131-8|CAD29637.1|  756|Anopheles gambiae putative
           5-oxoprolinase protein.
          Length = 756

 Score = 23.0 bits (47), Expect = 8.9
 Identities = 9/25 (36%), Positives = 15/25 (60%)
 Frame = -1

Query: 186 THTCYEHKMCVQNLQQLAEFVVLTL 112
           ++ C EH++CV  + Q   F  +TL
Sbjct: 199 SYACPEHELCVGRIAQELGFQHVTL 223


>AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/Thr
           phosphatase protein.
          Length = 1977

 Score = 23.0 bits (47), Expect = 8.9
 Identities = 8/27 (29%), Positives = 17/27 (62%)
 Frame = +2

Query: 392 PDRQTLMWSATWPKEVKKLAEDYLGDY 472
           P+R+ ++W A   ++++   E YLG +
Sbjct: 559 PNRERVLWPAHNVRDLRLWTEVYLGSW 585


>AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative
           5-oxoprolinase protein.
          Length = 1344

 Score = 23.0 bits (47), Expect = 8.9
 Identities = 9/25 (36%), Positives = 15/25 (60%)
 Frame = -1

Query: 186 THTCYEHKMCVQNLQQLAEFVVLTL 112
           ++ C EH++CV  + Q   F  +TL
Sbjct: 199 SYACPEHELCVGRIAQELGFQHVTL 223


>AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/Thr
           phosphatase protein.
          Length = 1978

 Score = 23.0 bits (47), Expect = 8.9
 Identities = 8/27 (29%), Positives = 17/27 (62%)
 Frame = +2

Query: 392 PDRQTLMWSATWPKEVKKLAEDYLGDY 472
           P+R+ ++W A   ++++   E YLG +
Sbjct: 559 PNRERVLWPAHNVRDLRLWTEVYLGSW 585


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 736,359
Number of Sequences: 2352
Number of extensions: 16078
Number of successful extensions: 29
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 26
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 27
length of database: 563,979
effective HSP length: 62
effective length of database: 418,155
effective search space used: 68577420
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -