SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120007.Seq
         (661 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF533894-1|AAM97679.1|  156|Anopheles gambiae ascorbate transpor...    26   1.2  
AY187041-1|AAO39755.1|  272|Anopheles gambiae putative antennal ...    25   1.6  
AF313909-1|AAL99382.1| 1024|Anopheles gambiae collagen IV alpha ...    24   3.7  

>AF533894-1|AAM97679.1|  156|Anopheles gambiae ascorbate transporter
           protein.
          Length = 156

 Score = 25.8 bits (54), Expect = 1.2
 Identities = 15/41 (36%), Positives = 23/41 (56%), Gaps = 3/41 (7%)
 Frame = -3

Query: 566 PG*ILTSQLTLPRMLPNIIGSTLLCRCLLGF---DLVPATP 453
           PG I T   T+   L  ++G+T+L   +LG    +L+P TP
Sbjct: 53  PGAIQTGNQTVDSTLSVLLGTTILVGGVLGCVLDNLIPGTP 93


>AY187041-1|AAO39755.1|  272|Anopheles gambiae putative antennal
           carrier protein TOL-1 protein.
          Length = 272

 Score = 25.4 bits (53), Expect = 1.6
 Identities = 15/52 (28%), Positives = 24/52 (46%)
 Frame = +2

Query: 452 KVSLEPNQILTGIGIIVCFR*YSATFWAESVEMSIFSPDSGSLILESGHIFY 607
           K+ LE N  + G  +++    +    W E   M I    S  L  ++GH+FY
Sbjct: 137 KMRLEGNYHMQGRILVIPLNGHGKC-WFEPSGMDIIMRTSTDLYQKNGHVFY 187


>AF313909-1|AAL99382.1| 1024|Anopheles gambiae collagen IV alpha 1
           chain protein.
          Length = 1024

 Score = 24.2 bits (50), Expect = 3.7
 Identities = 10/21 (47%), Positives = 11/21 (52%)
 Frame = -3

Query: 170 DVGPAGGPAPRDGVQDARAPG 108
           DVGP G P P+       APG
Sbjct: 156 DVGPKGEPGPKGPAGHPGAPG 176


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 677,114
Number of Sequences: 2352
Number of extensions: 13927
Number of successful extensions: 48
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 48
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 48
length of database: 563,979
effective HSP length: 62
effective length of database: 418,155
effective search space used: 65650335
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -