SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120006.Seq
         (617 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein.            24   4.5  
AY027891-1|AAK15783.1|  801|Anopheles gambiae collagen IV alpha ...    23   6.0  
CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein.          23   7.9  

>AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein.
          Length = 3320

 Score = 23.8 bits (49), Expect = 4.5
 Identities = 12/60 (20%), Positives = 29/60 (48%)
 Frame = +1

Query: 256  AKAEEILERGLKVREYELRRDNFSATGNFGFGIQEHIDLGIKYDPSIGIYGLDFYVVLGR 435
            A   + LE    + +++L  +N  +  NF FG+     L ++++ +  +  ++ Y V  +
Sbjct: 3258 AALSDELEESRHILQHKLYSNNSQSLNNFKFGLHTQEILPLQFNKASSMATINEYRVCSK 3317


>AY027891-1|AAK15783.1|  801|Anopheles gambiae collagen IV alpha 1
           chain precursor protein.
          Length = 801

 Score = 23.4 bits (48), Expect = 6.0
 Identities = 7/20 (35%), Positives = 12/20 (60%)
 Frame = +1

Query: 430 GRPGFNVAHRRRKTGKVGFP 489
           G+PG+ +  ++   G  GFP
Sbjct: 498 GQPGYGIPGQKGNAGMAGFP 517


>CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein.
          Length = 1494

 Score = 23.0 bits (47), Expect = 7.9
 Identities = 8/15 (53%), Positives = 10/15 (66%)
 Frame = -1

Query: 515  HSTSFVRRWGNPTFP 471
            HS SF   +G+P FP
Sbjct: 1014 HSNSFSYNYGSPAFP 1028


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 603,957
Number of Sequences: 2352
Number of extensions: 13462
Number of successful extensions: 25
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 24
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 25
length of database: 563,979
effective HSP length: 61
effective length of database: 420,507
effective search space used: 60553008
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -