SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120005.Seq
         (647 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-sign...    25   2.1  
EU068741-1|ABU40241.1|  993|Anopheles gambiae anion exchanger pr...    24   4.8  
AF515521-1|AAM61888.1|  233|Anopheles gambiae glutathione S-tran...    24   4.8  
AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein.           23   6.3  
AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcript...    23   8.3  

>AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative
           FGF-signaling promoter protein.
          Length = 1197

 Score = 25.0 bits (52), Expect = 2.1
 Identities = 13/37 (35%), Positives = 19/37 (51%)
 Frame = +2

Query: 281 FRRRRQSIQNDDR*AFSWK*RKRYQANFNSKRNQLPR 391
           F+    SIQ  ++    WK R   Q +F  K++QL R
Sbjct: 869 FKNNVFSIQEVEQLVTLWKNRNDVQKSFREKQDQLAR 905


>EU068741-1|ABU40241.1|  993|Anopheles gambiae anion exchanger
           protein.
          Length = 993

 Score = 23.8 bits (49), Expect = 4.8
 Identities = 12/31 (38%), Positives = 18/31 (58%)
 Frame = -3

Query: 600 DTREQNVFGFVVSRMLLVVA*TLCITRCVPL 508
           D +EQ V GFVVS ++ +      I R +P+
Sbjct: 840 DVKEQRVSGFVVSVLVGLSVVMAPILRLIPM 870


>AF515521-1|AAM61888.1|  233|Anopheles gambiae glutathione
           S-transferase u1 protein.
          Length = 233

 Score = 23.8 bits (49), Expect = 4.8
 Identities = 13/37 (35%), Positives = 21/37 (56%)
 Frame = +1

Query: 211 DDGWFICNSHLIKRLKCQKWFCPFSTKTTINSK*RSL 321
           DDG+F+  S+ I +  C+K + P S     + K R+L
Sbjct: 57  DDGFFLSESNAILQYLCEK-YAPTSDLYPNDPKDRAL 92


>AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein.
          Length = 1459

 Score = 23.4 bits (48), Expect = 6.3
 Identities = 10/26 (38%), Positives = 13/26 (50%)
 Frame = -1

Query: 155 TMDAKMQRLTLICRGAIPTGISAILL 78
           T+DA   RLT +    IP  I  + L
Sbjct: 633 TLDASFNRLTRVTPATIPNSIEFLFL 658


>AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcriptase
           protein.
          Length = 1099

 Score = 23.0 bits (47), Expect = 8.3
 Identities = 11/24 (45%), Positives = 14/24 (58%)
 Frame = -1

Query: 143 KMQRLTLICRGAIPTGISAILLPL 72
           K QRL LI +   P+G+S    PL
Sbjct: 470 KRQRLVLIPKPGKPSGVSCSYRPL 493


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 670,268
Number of Sequences: 2352
Number of extensions: 12916
Number of successful extensions: 61
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 60
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 61
length of database: 563,979
effective HSP length: 62
effective length of database: 418,155
effective search space used: 63977715
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -