SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120004.Seq
         (720 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

EU068741-1|ABU40241.1|  993|Anopheles gambiae anion exchanger pr...    25   2.4  
AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-sign...    25   2.4  
AJ459961-1|CAD31060.1|  700|Anopheles gambiae prophenoloxidase 8...    25   3.1  
AJ459962-1|CAD31061.1|  685|Anopheles gambiae prophenoloxidase 9...    24   5.4  
AJ459960-1|CAD31059.1|  696|Anopheles gambiae prophenoloxidase 7...    24   5.4  
AJ010195-1|CAA09034.1|  687|Anopheles gambiae prophenoloxidase p...    24   5.4  
AF515521-1|AAM61888.1|  233|Anopheles gambiae glutathione S-tran...    24   5.4  
AF004916-1|AAB94672.1|  686|Anopheles gambiae pro-phenol oxidase...    24   5.4  
AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein.           23   7.2  
AF004915-1|AAB94671.1|  688|Anopheles gambiae pro-phenol oxidase...    23   7.2  
CR954257-8|CAJ14159.1|  562|Anopheles gambiae putative esterase ...    23   9.5  
AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcript...    23   9.5  

>EU068741-1|ABU40241.1|  993|Anopheles gambiae anion exchanger
           protein.
          Length = 993

 Score = 25.0 bits (52), Expect = 2.4
 Identities = 15/38 (39%), Positives = 22/38 (57%), Gaps = 1/38 (2%)
 Frame = -2

Query: 599 DTREQNVFGFVVSRMLLVVA*TLCITRCVPL-*NFGIF 489
           D +EQ V GFVVS ++ +      I R +P+   FG+F
Sbjct: 840 DVKEQRVSGFVVSVLVGLSVVMAPILRLIPMSVLFGVF 877


>AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative
           FGF-signaling promoter protein.
          Length = 1197

 Score = 25.0 bits (52), Expect = 2.4
 Identities = 13/37 (35%), Positives = 19/37 (51%)
 Frame = +2

Query: 281 FRRRRQSIQNDDR*AFSWK*RKRYQANFNSKRNQLPR 391
           F+    SIQ  ++    WK R   Q +F  K++QL R
Sbjct: 869 FKNNVFSIQEVEQLVTLWKNRNDVQKSFREKQDQLAR 905


>AJ459961-1|CAD31060.1|  700|Anopheles gambiae prophenoloxidase 8
           protein.
          Length = 700

 Score = 24.6 bits (51), Expect = 3.1
 Identities = 9/22 (40%), Positives = 12/22 (54%)
 Frame = +3

Query: 603 RRIAFFRRDQRPNASRWCWRSI 668
           +R+AFFR D   N   W W  +
Sbjct: 208 QRMAFFREDIGVNLHHWHWHLV 229


>AJ459962-1|CAD31061.1|  685|Anopheles gambiae prophenoloxidase 9
           protein.
          Length = 685

 Score = 23.8 bits (49), Expect = 5.4
 Identities = 8/22 (36%), Positives = 12/22 (54%)
 Frame = +3

Query: 603 RRIAFFRRDQRPNASRWCWRSI 668
           +R+A+FR D   N   W W  +
Sbjct: 194 QRLAYFREDIGVNLHHWHWHLV 215


>AJ459960-1|CAD31059.1|  696|Anopheles gambiae prophenoloxidase 7
           protein.
          Length = 696

 Score = 23.8 bits (49), Expect = 5.4
 Identities = 8/22 (36%), Positives = 12/22 (54%)
 Frame = +3

Query: 603 RRIAFFRRDQRPNASRWCWRSI 668
           +R+A+FR D   N   W W  +
Sbjct: 207 QRLAYFREDIGVNLHHWHWHLV 228


>AJ010195-1|CAA09034.1|  687|Anopheles gambiae prophenoloxidase
           protein.
          Length = 687

 Score = 23.8 bits (49), Expect = 5.4
 Identities = 8/22 (36%), Positives = 12/22 (54%)
 Frame = +3

Query: 603 RRIAFFRRDQRPNASRWCWRSI 668
           +R+A+FR D   N   W W  +
Sbjct: 194 QRLAYFREDIGVNLHHWHWHLV 215


>AF515521-1|AAM61888.1|  233|Anopheles gambiae glutathione
           S-transferase u1 protein.
          Length = 233

 Score = 23.8 bits (49), Expect = 5.4
 Identities = 13/37 (35%), Positives = 21/37 (56%)
 Frame = +1

Query: 211 DDGWFICNSHLIKRLKCQKWFCPFSTKTTINSK*RSL 321
           DDG+F+  S+ I +  C+K + P S     + K R+L
Sbjct: 57  DDGFFLSESNAILQYLCEK-YAPTSDLYPNDPKDRAL 92


>AF004916-1|AAB94672.1|  686|Anopheles gambiae pro-phenol oxidase
           subunit 2 protein.
          Length = 686

 Score = 23.8 bits (49), Expect = 5.4
 Identities = 8/22 (36%), Positives = 12/22 (54%)
 Frame = +3

Query: 603 RRIAFFRRDQRPNASRWCWRSI 668
           +R+A+FR D   N   W W  +
Sbjct: 193 QRLAYFREDIGVNLHHWHWHLV 214


>AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein.
          Length = 1459

 Score = 23.4 bits (48), Expect = 7.2
 Identities = 10/26 (38%), Positives = 13/26 (50%)
 Frame = -2

Query: 155 TMDAKMQRLTLICRGAIPTGISAILL 78
           T+DA   RLT +    IP  I  + L
Sbjct: 633 TLDASFNRLTRVTPATIPNSIEFLFL 658


>AF004915-1|AAB94671.1|  688|Anopheles gambiae pro-phenol oxidase
           subunit 1 protein.
          Length = 688

 Score = 23.4 bits (48), Expect = 7.2
 Identities = 8/22 (36%), Positives = 12/22 (54%)
 Frame = +3

Query: 603 RRIAFFRRDQRPNASRWCWRSI 668
           +R+A+FR D   N   W W  +
Sbjct: 193 QRMAYFREDIGVNMHHWHWHLV 214


>CR954257-8|CAJ14159.1|  562|Anopheles gambiae putative esterase
           protein.
          Length = 562

 Score = 23.0 bits (47), Expect = 9.5
 Identities = 12/42 (28%), Positives = 18/42 (42%), Gaps = 3/42 (7%)
 Frame = +3

Query: 573 PEHVLFACVARRIA---FFRRDQRPNASRWCWRSII*QLQWI 689
           PE V+   +  R+    FF  D    A  W  +  +  LQW+
Sbjct: 142 PEDVVVVTINYRLGILGFFSTDDVHAAGNWGMKDCVMALQWV 183


>AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcriptase
           protein.
          Length = 1099

 Score = 23.0 bits (47), Expect = 9.5
 Identities = 11/24 (45%), Positives = 14/24 (58%)
 Frame = -2

Query: 143 KMQRLTLICRGAIPTGISAILLPL 72
           K QRL LI +   P+G+S    PL
Sbjct: 470 KRQRLVLIPKPGKPSGVSCSYRPL 493


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 737,416
Number of Sequences: 2352
Number of extensions: 14214
Number of successful extensions: 75
Number of sequences better than 10.0: 12
Number of HSP's better than 10.0 without gapping: 72
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 75
length of database: 563,979
effective HSP length: 63
effective length of database: 415,803
effective search space used: 73181328
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -