SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120003.Seq
         (731 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF291654-1|AAG00600.1| 1340|Anopheles gambiae thioester-containi...    25   2.4  
AF283269-1|AAG15374.1|  114|Anopheles gambiae ribosomal protein ...    25   2.4  
AJ439060-14|CAD27765.1|  471|Anopheles gambiae putative acetyltr...    24   5.6  
AJ459961-1|CAD31060.1|  700|Anopheles gambiae prophenoloxidase 8...    23   9.7  

>AF291654-1|AAG00600.1| 1340|Anopheles gambiae thioester-containing
            protein I protein.
          Length = 1340

 Score = 25.0 bits (52), Expect = 2.4
 Identities = 10/21 (47%), Positives = 12/21 (57%)
 Frame = +1

Query: 535  VNGFKYNQVDDHVVCEYCEAE 597
            +N  K  +VD   VCE CE E
Sbjct: 1312 LNAIKVYEVDKQNVCEICEEE 1332


>AF283269-1|AAG15374.1|  114|Anopheles gambiae ribosomal protein S26
           protein.
          Length = 114

 Score = 25.0 bits (52), Expect = 2.4
 Identities = 11/48 (22%), Positives = 26/48 (54%), Gaps = 3/48 (6%)
 Frame = -3

Query: 696 KRFVLSNLVGIRAIRRQGYVCIFNTLVFGPIF---YFCFTILAHNVIV 562
           K+FV+ N+V   A+R      ++++ V   ++   ++C +   H+ +V
Sbjct: 36  KKFVIRNIVEAAAVRDISDASVYSSYVLPKLYAKLHYCVSCAIHSKVV 83


>AJ439060-14|CAD27765.1|  471|Anopheles gambiae putative
           acetyltransferase protein.
          Length = 471

 Score = 23.8 bits (49), Expect = 5.6
 Identities = 9/19 (47%), Positives = 14/19 (73%)
 Frame = -3

Query: 354 EHVWVVLV*RHVYMAQFSF 298
           EH++V L  +HV+ A+F F
Sbjct: 131 EHIFVALRDQHVFRAKFRF 149


>AJ459961-1|CAD31060.1|  700|Anopheles gambiae prophenoloxidase 8
           protein.
          Length = 700

 Score = 23.0 bits (47), Expect = 9.7
 Identities = 7/11 (63%), Positives = 10/11 (90%)
 Frame = +2

Query: 65  ISFSHSKCAPF 97
           +SF+H +CAPF
Sbjct: 490 VSFTHLQCAPF 500


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 705,119
Number of Sequences: 2352
Number of extensions: 14008
Number of successful extensions: 22
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 21
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 22
length of database: 563,979
effective HSP length: 63
effective length of database: 415,803
effective search space used: 74844540
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -