SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120002.Seq
         (725 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ535207-1|CAD59407.1| 1036|Anopheles gambiae SMC5 protein protein.    25   3.2  
AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine pr...    25   3.2  
AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22...    25   3.2  
AY062203-1|AAL58564.1|  149|Anopheles gambiae cytochrome P450 CY...    24   4.2  
DQ370045-1|ABD18606.1|  285|Anopheles gambiae putative TIL domai...    24   5.5  
M93689-2|AAA29367.1|  975|Anopheles gambiae protein ( Anopheles ...    23   9.6  

>AJ535207-1|CAD59407.1| 1036|Anopheles gambiae SMC5 protein protein.
          Length = 1036

 Score = 24.6 bits (51), Expect = 3.2
 Identities = 13/59 (22%), Positives = 26/59 (44%)
 Frame = +1

Query: 37  FTTSFGTCIPLRLRIQNKTDVKTDFIAEVSHSSIQIDKECCLGPLEKGKILVWFEPTQL 213
           F+ SF         I N+T  +  ++ ++   +IQ+D  C   P ++ +      P +L
Sbjct: 95  FSRSFDHSAKSTFEIDNQTVSQQAYLQQIRAFNIQVDNLCQFLPQDRVQDFTKMNPREL 153


>AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine
           protease protein.
          Length = 1322

 Score = 24.6 bits (51), Expect = 3.2
 Identities = 13/30 (43%), Positives = 18/30 (60%)
 Frame = -1

Query: 356 DIFKFNSCRSTSLNFVRACGLGSVAIPLIL 267
           D  KF +C + +  FV+ CG G+   PLIL
Sbjct: 303 DCRKFLNCNNGA-RFVQDCGPGTAFNPLIL 331


>AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22D
           protein.
          Length = 1322

 Score = 24.6 bits (51), Expect = 3.2
 Identities = 13/30 (43%), Positives = 18/30 (60%)
 Frame = -1

Query: 356 DIFKFNSCRSTSLNFVRACGLGSVAIPLIL 267
           D  KF +C + +  FV+ CG G+   PLIL
Sbjct: 302 DCRKFLNCNNGA-RFVQDCGPGTAFNPLIL 330


>AY062203-1|AAL58564.1|  149|Anopheles gambiae cytochrome P450
           CYP4C25 protein.
          Length = 149

 Score = 24.2 bits (50), Expect = 4.2
 Identities = 10/22 (45%), Positives = 11/22 (50%)
 Frame = -1

Query: 224 FCTPNCVGSNHTKIFPFSNGPK 159
           F   NC G N     PFS GP+
Sbjct: 124 FLPENCRGRNPYAXIPFSAGPR 145


>DQ370045-1|ABD18606.1|  285|Anopheles gambiae putative TIL domain
           protein protein.
          Length = 285

 Score = 23.8 bits (49), Expect = 5.5
 Identities = 9/11 (81%), Positives = 9/11 (81%)
 Frame = +1

Query: 43  TSFGTCIPLRL 75
           T FG CIPLRL
Sbjct: 105 TEFGKCIPLRL 115


>M93689-2|AAA29367.1|  975|Anopheles gambiae protein ( Anopheles
           gambiae T1 retroposon. ).
          Length = 975

 Score = 23.0 bits (47), Expect = 9.6
 Identities = 10/32 (31%), Positives = 18/32 (56%)
 Frame = -2

Query: 178 LFLMVPSNILYLFELKNEIPQL*NLFSHRFYF 83
           L + +PS++     ++NE+P   N  S R+ F
Sbjct: 248 LEIALPSSLFRASRVRNELPSAPNSLSVRYNF 279


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 735,255
Number of Sequences: 2352
Number of extensions: 14845
Number of successful extensions: 32
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 32
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 32
length of database: 563,979
effective HSP length: 63
effective length of database: 415,803
effective search space used: 74012934
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -