SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20083
         (676 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CR541695-1|CAG46496.1|  414|Homo sapiens IDH1 protein.                137   4e-32
CR536499-1|CAG38738.1|  414|Homo sapiens IDH1 protein.                137   4e-32
BX537411-1|CAD97653.1|  414|Homo sapiens hypothetical protein pr...   137   4e-32
BC093020-1|AAH93020.1|  414|Homo sapiens isocitrate dehydrogenas...   137   4e-32
BC012846-1|AAH12846.1|  414|Homo sapiens IDH1 protein protein.        137   4e-32
AF113917-1|AAD29284.1|  414|Homo sapiens NADP+-dependent isocitr...   137   4e-32
AF020038-1|AAD02918.1|  414|Homo sapiens NADP-dependent isocitra...   137   4e-32
AC016697-3|AAX93221.1|  414|Homo sapiens unknown protein.             137   4e-32
X69433-1|CAA49208.1|  452|Homo sapiens isocitrate  dehydrogenase...   136   7e-32
BC071828-1|AAH71828.1|  452|Homo sapiens isocitrate dehydrogenas...   136   7e-32
BC009244-1|AAH09244.1|  452|Homo sapiens isocitrate dehydrogenas...   136   7e-32
AK222916-1|BAD96636.1|  452|Homo sapiens isocitrate dehydrogenas...   136   7e-32
CR533522-1|CAG38553.1|  414|Homo sapiens IDH1 protein.                134   2e-31
DQ403082-1|ABD77215.1|  371|Homo sapiens isocitrate dehydrogenas...   112   9e-25
U52144-1|AAC50455.1|  419|Homo sapiens isocitrate dehydrogenase ...   102   1e-21
U62389-1|AAB17375.1|  154|Homo sapiens putative cytosolic NADP-d...    97   4e-20
AK090454-1|BAC03435.1|  708|Homo sapiens FLJ00375 protein protein.     31   2.8  

>CR541695-1|CAG46496.1|  414|Homo sapiens IDH1 protein.
          Length = 414

 Score =  137 bits (331), Expect = 4e-32
 Identities = 61/83 (73%), Positives = 73/83 (87%)
 Frame = +1

Query: 259 GDEMTRIMWAKIKERLIFPYVKVDCLYFDLGLPHRDATDDQVTIDSAHAILKHNVGIKCA 438
           GDEMTRI+W  IKE+LIFPYV++D   +DLG+ +RDAT+DQVT D+A AI KHNVG+KCA
Sbjct: 15  GDEMTRIIWELIKEKLIFPYVELDLHSYDLGIENRDATNDQVTKDAAEAIKKHNVGVKCA 74

Query: 439 TITPDEQRVEEFKLKKMWLSPNG 507
           TITPDE+RVEEFKLK+MW SPNG
Sbjct: 75  TITPDEKRVEEFKLKQMWKSPNG 97



 Score =  103 bits (246), Expect = 8e-22
 Identities = 44/59 (74%), Positives = 51/59 (86%)
 Frame = +3

Query: 498 PERKIRNILGGTVFREPILCQSIPRVVPGWTKPIVIGRHAHGDQYKAQDFVVPKPGKVE 674
           P   IRNILGGTVFRE I+C++IPR+V GW KPI+IGRHA+GDQY+A DFVVP PGKVE
Sbjct: 95  PNGTIRNILGGTVFREAIICKNIPRLVSGWVKPIIIGRHAYGDQYRATDFVVPGPGKVE 153


>CR536499-1|CAG38738.1|  414|Homo sapiens IDH1 protein.
          Length = 414

 Score =  137 bits (331), Expect = 4e-32
 Identities = 61/83 (73%), Positives = 73/83 (87%)
 Frame = +1

Query: 259 GDEMTRIMWAKIKERLIFPYVKVDCLYFDLGLPHRDATDDQVTIDSAHAILKHNVGIKCA 438
           GDEMTRI+W  IKE+LIFPYV++D   +DLG+ +RDAT+DQVT D+A AI KHNVG+KCA
Sbjct: 15  GDEMTRIIWELIKEKLIFPYVELDLHSYDLGIENRDATNDQVTKDAAEAIKKHNVGVKCA 74

Query: 439 TITPDEQRVEEFKLKKMWLSPNG 507
           TITPDE+RVEEFKLK+MW SPNG
Sbjct: 75  TITPDEKRVEEFKLKQMWKSPNG 97



 Score =  103 bits (246), Expect = 8e-22
 Identities = 44/59 (74%), Positives = 51/59 (86%)
 Frame = +3

Query: 498 PERKIRNILGGTVFREPILCQSIPRVVPGWTKPIVIGRHAHGDQYKAQDFVVPKPGKVE 674
           P   IRNILGGTVFRE I+C++IPR+V GW KPI+IGRHA+GDQY+A DFVVP PGKVE
Sbjct: 95  PNGTIRNILGGTVFREAIICKNIPRLVSGWVKPIIIGRHAYGDQYRATDFVVPGPGKVE 153


>BX537411-1|CAD97653.1|  414|Homo sapiens hypothetical protein
           protein.
          Length = 414

 Score =  137 bits (331), Expect = 4e-32
 Identities = 61/83 (73%), Positives = 73/83 (87%)
 Frame = +1

Query: 259 GDEMTRIMWAKIKERLIFPYVKVDCLYFDLGLPHRDATDDQVTIDSAHAILKHNVGIKCA 438
           GDEMTRI+W  IKE+LIFPYV++D   +DLG+ +RDAT+DQVT D+A AI KHNVG+KCA
Sbjct: 15  GDEMTRIIWELIKEKLIFPYVELDLHSYDLGIENRDATNDQVTKDAAEAIKKHNVGVKCA 74

Query: 439 TITPDEQRVEEFKLKKMWLSPNG 507
           TITPDE+RVEEFKLK+MW SPNG
Sbjct: 75  TITPDEKRVEEFKLKQMWKSPNG 97



 Score =  103 bits (246), Expect = 8e-22
 Identities = 44/59 (74%), Positives = 51/59 (86%)
 Frame = +3

Query: 498 PERKIRNILGGTVFREPILCQSIPRVVPGWTKPIVIGRHAHGDQYKAQDFVVPKPGKVE 674
           P   IRNILGGTVFRE I+C++IPR+V GW KPI+IGRHA+GDQY+A DFVVP PGKVE
Sbjct: 95  PNGTIRNILGGTVFREAIICKNIPRLVSGWVKPIIIGRHAYGDQYRATDFVVPGPGKVE 153


>BC093020-1|AAH93020.1|  414|Homo sapiens isocitrate dehydrogenase 1
           (NADP+), soluble protein.
          Length = 414

 Score =  137 bits (331), Expect = 4e-32
 Identities = 61/83 (73%), Positives = 73/83 (87%)
 Frame = +1

Query: 259 GDEMTRIMWAKIKERLIFPYVKVDCLYFDLGLPHRDATDDQVTIDSAHAILKHNVGIKCA 438
           GDEMTRI+W  IKE+LIFPYV++D   +DLG+ +RDAT+DQVT D+A AI KHNVG+KCA
Sbjct: 15  GDEMTRIIWELIKEKLIFPYVELDLHSYDLGIENRDATNDQVTKDAAEAIKKHNVGVKCA 74

Query: 439 TITPDEQRVEEFKLKKMWLSPNG 507
           TITPDE+RVEEFKLK+MW SPNG
Sbjct: 75  TITPDEKRVEEFKLKQMWKSPNG 97



 Score =  103 bits (246), Expect = 8e-22
 Identities = 44/59 (74%), Positives = 51/59 (86%)
 Frame = +3

Query: 498 PERKIRNILGGTVFREPILCQSIPRVVPGWTKPIVIGRHAHGDQYKAQDFVVPKPGKVE 674
           P   IRNILGGTVFRE I+C++IPR+V GW KPI+IGRHA+GDQY+A DFVVP PGKVE
Sbjct: 95  PNGTIRNILGGTVFREAIICKNIPRLVSGWVKPIIIGRHAYGDQYRATDFVVPGPGKVE 153


>BC012846-1|AAH12846.1|  414|Homo sapiens IDH1 protein protein.
          Length = 414

 Score =  137 bits (331), Expect = 4e-32
 Identities = 61/83 (73%), Positives = 73/83 (87%)
 Frame = +1

Query: 259 GDEMTRIMWAKIKERLIFPYVKVDCLYFDLGLPHRDATDDQVTIDSAHAILKHNVGIKCA 438
           GDEMTRI+W  IKE+LIFPYV++D   +DLG+ +RDAT+DQVT D+A AI KHNVG+KCA
Sbjct: 15  GDEMTRIIWELIKEKLIFPYVELDLHSYDLGIENRDATNDQVTKDAAEAIKKHNVGVKCA 74

Query: 439 TITPDEQRVEEFKLKKMWLSPNG 507
           TITPDE+RVEEFKLK+MW SPNG
Sbjct: 75  TITPDEKRVEEFKLKQMWKSPNG 97



 Score =  103 bits (246), Expect = 8e-22
 Identities = 44/59 (74%), Positives = 51/59 (86%)
 Frame = +3

Query: 498 PERKIRNILGGTVFREPILCQSIPRVVPGWTKPIVIGRHAHGDQYKAQDFVVPKPGKVE 674
           P   IRNILGGTVFRE I+C++IPR+V GW KPI+IGRHA+GDQY+A DFVVP PGKVE
Sbjct: 95  PNGTIRNILGGTVFREAIICKNIPRLVSGWVKPIIIGRHAYGDQYRATDFVVPGPGKVE 153


>AF113917-1|AAD29284.1|  414|Homo sapiens NADP+-dependent isocitrate
           dehydrogenase protein.
          Length = 414

 Score =  137 bits (331), Expect = 4e-32
 Identities = 61/83 (73%), Positives = 73/83 (87%)
 Frame = +1

Query: 259 GDEMTRIMWAKIKERLIFPYVKVDCLYFDLGLPHRDATDDQVTIDSAHAILKHNVGIKCA 438
           GDEMTRI+W  IKE+LIFPYV++D   +DLG+ +RDAT+DQVT D+A AI KHNVG+KCA
Sbjct: 15  GDEMTRIIWELIKEKLIFPYVELDLHSYDLGIENRDATNDQVTKDAAEAIKKHNVGVKCA 74

Query: 439 TITPDEQRVEEFKLKKMWLSPNG 507
           TITPDE+RVEEFKLK+MW SPNG
Sbjct: 75  TITPDEKRVEEFKLKQMWKSPNG 97



 Score =  103 bits (246), Expect = 8e-22
 Identities = 44/59 (74%), Positives = 51/59 (86%)
 Frame = +3

Query: 498 PERKIRNILGGTVFREPILCQSIPRVVPGWTKPIVIGRHAHGDQYKAQDFVVPKPGKVE 674
           P   IRNILGGTVFRE I+C++IPR+V GW KPI+IGRHA+GDQY+A DFVVP PGKVE
Sbjct: 95  PNGTIRNILGGTVFREAIICKNIPRLVSGWVKPIIIGRHAYGDQYRATDFVVPGPGKVE 153


>AF020038-1|AAD02918.1|  414|Homo sapiens NADP-dependent isocitrate
           dehydrogenase protein.
          Length = 414

 Score =  137 bits (331), Expect = 4e-32
 Identities = 61/83 (73%), Positives = 73/83 (87%)
 Frame = +1

Query: 259 GDEMTRIMWAKIKERLIFPYVKVDCLYFDLGLPHRDATDDQVTIDSAHAILKHNVGIKCA 438
           GDEMTRI+W  IKE+LIFPYV++D   +DLG+ +RDAT+DQVT D+A AI KHNVG+KCA
Sbjct: 15  GDEMTRIIWELIKEKLIFPYVELDLHSYDLGIENRDATNDQVTKDAAEAIKKHNVGVKCA 74

Query: 439 TITPDEQRVEEFKLKKMWLSPNG 507
           TITPDE+RVEEFKLK+MW SPNG
Sbjct: 75  TITPDEKRVEEFKLKQMWKSPNG 97



 Score =  103 bits (246), Expect = 8e-22
 Identities = 44/59 (74%), Positives = 51/59 (86%)
 Frame = +3

Query: 498 PERKIRNILGGTVFREPILCQSIPRVVPGWTKPIVIGRHAHGDQYKAQDFVVPKPGKVE 674
           P   IRNILGGTVFRE I+C++IPR+V GW KPI+IGRHA+GDQY+A DFVVP PGKVE
Sbjct: 95  PNGTIRNILGGTVFREAIICKNIPRLVSGWVKPIIIGRHAYGDQYRATDFVVPGPGKVE 153


>AC016697-3|AAX93221.1|  414|Homo sapiens unknown protein.
          Length = 414

 Score =  137 bits (331), Expect = 4e-32
 Identities = 61/83 (73%), Positives = 73/83 (87%)
 Frame = +1

Query: 259 GDEMTRIMWAKIKERLIFPYVKVDCLYFDLGLPHRDATDDQVTIDSAHAILKHNVGIKCA 438
           GDEMTRI+W  IKE+LIFPYV++D   +DLG+ +RDAT+DQVT D+A AI KHNVG+KCA
Sbjct: 15  GDEMTRIIWELIKEKLIFPYVELDLHSYDLGIENRDATNDQVTKDAAEAIKKHNVGVKCA 74

Query: 439 TITPDEQRVEEFKLKKMWLSPNG 507
           TITPDE+RVEEFKLK+MW SPNG
Sbjct: 75  TITPDEKRVEEFKLKQMWKSPNG 97



 Score =  103 bits (246), Expect = 8e-22
 Identities = 44/59 (74%), Positives = 51/59 (86%)
 Frame = +3

Query: 498 PERKIRNILGGTVFREPILCQSIPRVVPGWTKPIVIGRHAHGDQYKAQDFVVPKPGKVE 674
           P   IRNILGGTVFRE I+C++IPR+V GW KPI+IGRHA+GDQY+A DFVVP PGKVE
Sbjct: 95  PNGTIRNILGGTVFREAIICKNIPRLVSGWVKPIIIGRHAYGDQYRATDFVVPGPGKVE 153


>X69433-1|CAA49208.1|  452|Homo sapiens isocitrate  dehydrogenase
           (NADP+) protein.
          Length = 452

 Score =  136 bits (329), Expect = 7e-32
 Identities = 62/84 (73%), Positives = 70/84 (83%)
 Frame = +1

Query: 256 DGDEMTRIMWAKIKERLIFPYVKVDCLYFDLGLPHRDATDDQVTIDSAHAILKHNVGIKC 435
           DGDEMTRI+W  IKE+LI P+V +   YFDLGLP+RD TDDQVTIDSA A  K++V +KC
Sbjct: 54  DGDEMTRIIWQFIKEKLILPHVDIQLKYFDLGLPNRDQTDDQVTIDSALATQKYSVAVKC 113

Query: 436 ATITPDEQRVEEFKLKKMWLSPNG 507
           ATITPDE RVEEFKLKKMW SPNG
Sbjct: 114 ATITPDEARVEEFKLKKMWKSPNG 137



 Score =  101 bits (243), Expect = 2e-21
 Identities = 43/56 (76%), Positives = 48/56 (85%)
 Frame = +3

Query: 498 PERKIRNILGGTVFREPILCQSIPRVVPGWTKPIVIGRHAHGDQYKAQDFVVPKPG 665
           P   IRNILGGTVFREPI+C++IPR+VPGWTKPI IGRHAHGDQYKA DFV  + G
Sbjct: 135 PNGTIRNILGGTVFREPIICKNIPRLVPGWTKPITIGRHAHGDQYKATDFVADRAG 190


>BC071828-1|AAH71828.1|  452|Homo sapiens isocitrate dehydrogenase 2
           (NADP+), mitochondrial protein.
          Length = 452

 Score =  136 bits (329), Expect = 7e-32
 Identities = 62/84 (73%), Positives = 70/84 (83%)
 Frame = +1

Query: 256 DGDEMTRIMWAKIKERLIFPYVKVDCLYFDLGLPHRDATDDQVTIDSAHAILKHNVGIKC 435
           DGDEMTRI+W  IKE+LI P+V +   YFDLGLP+RD TDDQVTIDSA A  K++V +KC
Sbjct: 54  DGDEMTRIIWQFIKEKLILPHVDIQLKYFDLGLPNRDQTDDQVTIDSALATQKYSVAVKC 113

Query: 436 ATITPDEQRVEEFKLKKMWLSPNG 507
           ATITPDE RVEEFKLKKMW SPNG
Sbjct: 114 ATITPDEARVEEFKLKKMWKSPNG 137



 Score =  101 bits (243), Expect = 2e-21
 Identities = 43/56 (76%), Positives = 48/56 (85%)
 Frame = +3

Query: 498 PERKIRNILGGTVFREPILCQSIPRVVPGWTKPIVIGRHAHGDQYKAQDFVVPKPG 665
           P   IRNILGGTVFREPI+C++IPR+VPGWTKPI IGRHAHGDQYKA DFV  + G
Sbjct: 135 PNGTIRNILGGTVFREPIICKNIPRLVPGWTKPITIGRHAHGDQYKATDFVADRAG 190


>BC009244-1|AAH09244.1|  452|Homo sapiens isocitrate dehydrogenase 2
           (NADP+), mitochondrial protein.
          Length = 452

 Score =  136 bits (329), Expect = 7e-32
 Identities = 62/84 (73%), Positives = 70/84 (83%)
 Frame = +1

Query: 256 DGDEMTRIMWAKIKERLIFPYVKVDCLYFDLGLPHRDATDDQVTIDSAHAILKHNVGIKC 435
           DGDEMTRI+W  IKE+LI P+V +   YFDLGLP+RD TDDQVTIDSA A  K++V +KC
Sbjct: 54  DGDEMTRIIWQFIKEKLILPHVDIQLKYFDLGLPNRDQTDDQVTIDSALATQKYSVAVKC 113

Query: 436 ATITPDEQRVEEFKLKKMWLSPNG 507
           ATITPDE RVEEFKLKKMW SPNG
Sbjct: 114 ATITPDEARVEEFKLKKMWKSPNG 137



 Score =  101 bits (243), Expect = 2e-21
 Identities = 43/56 (76%), Positives = 48/56 (85%)
 Frame = +3

Query: 498 PERKIRNILGGTVFREPILCQSIPRVVPGWTKPIVIGRHAHGDQYKAQDFVVPKPG 665
           P   IRNILGGTVFREPI+C++IPR+VPGWTKPI IGRHAHGDQYKA DFV  + G
Sbjct: 135 PNGTIRNILGGTVFREPIICKNIPRLVPGWTKPITIGRHAHGDQYKATDFVADRAG 190


>AK222916-1|BAD96636.1|  452|Homo sapiens isocitrate dehydrogenase 2
           (NADP+), mitochondrial precursor variant protein.
          Length = 452

 Score =  136 bits (329), Expect = 7e-32
 Identities = 62/84 (73%), Positives = 70/84 (83%)
 Frame = +1

Query: 256 DGDEMTRIMWAKIKERLIFPYVKVDCLYFDLGLPHRDATDDQVTIDSAHAILKHNVGIKC 435
           DGDEMTRI+W  IKE+LI P+V +   YFDLGLP+RD TDDQVTIDSA A  K++V +KC
Sbjct: 54  DGDEMTRIIWQFIKEKLILPHVDIQLKYFDLGLPNRDQTDDQVTIDSALATQKYSVAVKC 113

Query: 436 ATITPDEQRVEEFKLKKMWLSPNG 507
           ATITPDE RVEEFKLKKMW SPNG
Sbjct: 114 ATITPDEARVEEFKLKKMWKSPNG 137



 Score =  101 bits (243), Expect = 2e-21
 Identities = 43/56 (76%), Positives = 48/56 (85%)
 Frame = +3

Query: 498 PERKIRNILGGTVFREPILCQSIPRVVPGWTKPIVIGRHAHGDQYKAQDFVVPKPG 665
           P   IRNILGGTVFREPI+C++IPR+VPGWTKPI IGRHAHGDQYKA DFV  + G
Sbjct: 135 PNGTIRNILGGTVFREPIICKNIPRLVPGWTKPITIGRHAHGDQYKATDFVADRAG 190


>CR533522-1|CAG38553.1|  414|Homo sapiens IDH1 protein.
          Length = 414

 Score =  134 bits (325), Expect = 2e-31
 Identities = 60/83 (72%), Positives = 72/83 (86%)
 Frame = +1

Query: 259 GDEMTRIMWAKIKERLIFPYVKVDCLYFDLGLPHRDATDDQVTIDSAHAILKHNVGIKCA 438
           GDEMTRI+W  IKE+LI PYV++D   +DLG+ +RDAT+DQVT D+A AI KHNVG+KCA
Sbjct: 15  GDEMTRIIWELIKEKLIIPYVELDLHSYDLGIENRDATNDQVTKDAAEAIKKHNVGVKCA 74

Query: 439 TITPDEQRVEEFKLKKMWLSPNG 507
           TITPDE+RVEEFKLK+MW SPNG
Sbjct: 75  TITPDEKRVEEFKLKQMWKSPNG 97



 Score =  101 bits (242), Expect = 2e-21
 Identities = 43/59 (72%), Positives = 51/59 (86%)
 Frame = +3

Query: 498 PERKIRNILGGTVFREPILCQSIPRVVPGWTKPIVIGRHAHGDQYKAQDFVVPKPGKVE 674
           P   IRNILGGTVFRE I+C++IPR+V GW +PI+IGRHA+GDQY+A DFVVP PGKVE
Sbjct: 95  PNGTIRNILGGTVFREAIICKNIPRLVSGWVEPIIIGRHAYGDQYRATDFVVPGPGKVE 153


>DQ403082-1|ABD77215.1|  371|Homo sapiens isocitrate dehydrogenase 1
           protein.
          Length = 371

 Score =  112 bits (270), Expect = 9e-25
 Identities = 50/68 (73%), Positives = 60/68 (88%)
 Frame = +1

Query: 304 LIFPYVKVDCLYFDLGLPHRDATDDQVTIDSAHAILKHNVGIKCATITPDEQRVEEFKLK 483
           LIFPYV++D   +DLG+ +RDAT+DQVT D+A AI KHNVG+KCATITPDE+RVEEFKLK
Sbjct: 1   LIFPYVELDLHSYDLGIENRDATNDQVTKDAAEAIKKHNVGVKCATITPDEKRVEEFKLK 60

Query: 484 KMWLSPNG 507
           +MW SPNG
Sbjct: 61  QMWKSPNG 68



 Score =  103 bits (246), Expect = 8e-22
 Identities = 44/59 (74%), Positives = 51/59 (86%)
 Frame = +3

Query: 498 PERKIRNILGGTVFREPILCQSIPRVVPGWTKPIVIGRHAHGDQYKAQDFVVPKPGKVE 674
           P   IRNILGGTVFRE I+C++IPR+V GW KPI+IGRHA+GDQY+A DFVVP PGKVE
Sbjct: 66  PNGTIRNILGGTVFREAIICKNIPRLVSGWVKPIIIGRHAYGDQYRATDFVVPGPGKVE 124


>U52144-1|AAC50455.1|  419|Homo sapiens isocitrate dehydrogenase
           protein.
          Length = 419

 Score =  102 bits (244), Expect = 1e-21
 Identities = 47/61 (77%), Positives = 51/61 (83%)
 Frame = +1

Query: 325 VDCLYFDLGLPHRDATDDQVTIDSAHAILKHNVGIKCATITPDEQRVEEFKLKKMWLSPN 504
           V   YFDLGLP+RD TDDQVTIDSA A  K++V +KCATITPDE RVEEFKLKKMW SPN
Sbjct: 44  VQLKYFDLGLPNRDQTDDQVTIDSALATQKYSVAVKCATITPDEARVEEFKLKKMWKSPN 103

Query: 505 G 507
           G
Sbjct: 104 G 104



 Score = 99.1 bits (236), Expect = 1e-20
 Identities = 42/56 (75%), Positives = 47/56 (83%)
 Frame = +3

Query: 498 PERKIRNILGGTVFREPILCQSIPRVVPGWTKPIVIGRHAHGDQYKAQDFVVPKPG 665
           P   IRNI GGTVFREPI+C++IPR+VPGWTKPI IGRHAHGDQYKA DFV  + G
Sbjct: 102 PNGTIRNIHGGTVFREPIICKNIPRLVPGWTKPITIGRHAHGDQYKATDFVADRAG 157


>U62389-1|AAB17375.1|  154|Homo sapiens putative cytosolic
           NADP-dependent isocitrate dehydrogenase protein.
          Length = 154

 Score = 97.5 bits (232), Expect = 4e-20
 Identities = 41/54 (75%), Positives = 48/54 (88%)
 Frame = +3

Query: 513 RNILGGTVFREPILCQSIPRVVPGWTKPIVIGRHAHGDQYKAQDFVVPKPGKVE 674
           RNILGGTVF E I+C++IPR+V GW KPI+IGRHA+GDQY+A DFVVP PGKVE
Sbjct: 1   RNILGGTVFXEAIICKNIPRLVSGWVKPIIIGRHAYGDQYRATDFVVPGPGKVE 54


>AK090454-1|BAC03435.1|  708|Homo sapiens FLJ00375 protein protein.
          Length = 708

 Score = 31.5 bits (68), Expect = 2.8
 Identities = 13/34 (38%), Positives = 16/34 (47%)
 Frame = +3

Query: 567 PRVVPGWTKPIVIGRHAHGDQYKAQDFVVPKPGK 668
           PR   GW +P +   H H DQ       +P PGK
Sbjct: 20  PRAFKGWARPWLAQCHLHADQQPRAMHRMPDPGK 53


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 98,055,243
Number of Sequences: 237096
Number of extensions: 2027828
Number of successful extensions: 3866
Number of sequences better than 10.0: 17
Number of HSP's better than 10.0 without gapping: 3751
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3866
length of database: 76,859,062
effective HSP length: 88
effective length of database: 55,994,614
effective search space used: 7615267504
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -