SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20081
         (635 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U02019-1|AAC50056.1|  286|Homo sapiens p37 AUF1 protein.              107   4e-23
M94630-1|AAA35781.1|  328|Homo sapiens DNA-binding protein protein.   107   4e-23
D55674-1|BAA09525.1|  355|Homo sapiens heterogeneous nuclear rib...   107   4e-23
D55673-1|BAA09524.1|  215|Homo sapiens heterogeneous nuclear rib...   107   4e-23
D55672-1|BAA09523.1|  306|Homo sapiens heterogeneous nuclear rib...   107   4e-23
D55671-1|BAA09522.1|  267|Homo sapiens heterogeneous nuclear rib...   107   4e-23
BC026015-1|AAH26015.1|  306|Homo sapiens heterogeneous nuclear r...   107   4e-23
BC023977-1|AAH23977.1|  306|Homo sapiens heterogeneous nuclear r...   107   4e-23
BC002401-1|AAH02401.1|  355|Homo sapiens heterogeneous nuclear r...   107   4e-23
AF039575-1|AAB96683.1|  298|Homo sapiens heterogeneous nuclear r...   107   4e-23
AF026126-3|AAC23476.1|  336|Homo sapiens heterogeneous nuclear r...   107   4e-23
AF026126-2|AAC23475.1|  306|Homo sapiens heterogeneous nuclear r...   107   4e-23
AF026126-1|AAC23474.1|  355|Homo sapiens heterogeneous nuclear r...   107   4e-23
AC124016-1|AAY40913.1|  355|Homo sapiens unknown protein.             107   4e-23
D89092-1|BAA24361.1|  301|Homo sapiens hnRNP JKTBP protein.           100   4e-21
CR407623-1|CAG28551.1|  420|Homo sapiens HNRPDL protein.              100   4e-21
BC071944-1|AAH71944.1|  420|Homo sapiens heterogeneous nuclear r...   100   4e-21
BC011714-1|AAH11714.1|  420|Homo sapiens heterogeneous nuclear r...   100   4e-21
BC007392-1|AAH07392.2|  415|Homo sapiens HNRPDL protein protein.      100   4e-21
AY453824-1|AAR17782.1|  298|Homo sapiens CArG binding factor pro...   100   4e-21
AC124016-2|AAY40914.1|  420|Homo sapiens unknown protein.             100   4e-21
AB066484-1|BAB62188.1|  244|Homo sapiens JKTBP1delta6 protein.        100   4e-21
AB017019-1|BAA75241.1|  420|Homo sapiens JKTBP2 protein.              100   4e-21
AB017018-2|BAA75240.1|  301|Homo sapiens JKTBP1 protein.              100   4e-21
AB017018-1|BAA75239.1|  420|Homo sapiens JKTBP2 protein.              100   4e-21
U76713-1|AAC50956.1|  331|Homo sapiens ABBP-1 protein.                100   9e-21
M65028-1|AAA36575.1|  284|Homo sapiens hnRNP type A/B protein pr...   100   9e-21
BC036708-1|AAH36708.1|  332|Homo sapiens heterogeneous nuclear r...   100   9e-21
BC009359-1|AAH09359.1|  285|Homo sapiens heterogeneous nuclear r...   100   9e-21
BC004561-1|AAH04561.1|  285|Homo sapiens heterogeneous nuclear r...   100   9e-21
BC002625-1|AAH02625.1|  285|Homo sapiens heterogeneous nuclear r...   100   9e-21
BC001616-1|AAH01616.1|  285|Homo sapiens heterogeneous nuclear r...   100   9e-21
AK223425-1|BAD97145.1|  332|Homo sapiens heterogeneous nuclear r...   100   9e-21
AK097657-1|BAC05134.1|  332|Homo sapiens protein ( Homo sapiens ...   100   9e-21
D89678-1|BAA22860.1|  271|Homo sapiens A+U-rich element RNA bind...    99   2e-20
BC001526-1|AAH01526.1|  328|Homo sapiens musashi homolog 2 (Dros...    90   7e-18
AK093888-1|BAC04244.1|  251|Homo sapiens protein ( Homo sapiens ...    90   7e-18
AC003982-3|AAB95636.1|  362|Homo sapiens WUGSC:H_166H1.2 protein.      89   2e-17
AB012851-1|BAA33962.1|  362|Homo sapiens Musashi protein.              89   2e-17
X79536-1|CAA56072.1|  320|Homo sapiens hnRNPcore protein A1 prot...    85   3e-16
X12671-1|CAA31191.1|  320|Homo sapiens hnrnp a1 protein protein.       85   3e-16
X06747-1|CAA29922.1|  320|Homo sapiens protein ( Human hnRNP cor...    85   3e-16
BC121133-1|AAI21134.1|  320|Homo sapiens heterogeneous nuclear r...    85   3e-16
BC103707-1|AAI03708.1|  267|Homo sapiens HNRPA1 protein protein.       85   3e-16
BC074502-1|AAH74502.1|  320|Homo sapiens heterogeneous nuclear r...    85   3e-16
BC073162-1|AAH73162.1|  320|Homo sapiens heterogeneous nuclear r...    85   3e-16
BC071945-1|AAH71945.1|  320|Homo sapiens heterogeneous nuclear r...    85   3e-16
BC070315-1|AAH70315.1|  320|Homo sapiens HNRPA1 protein protein.       85   3e-16
BC052296-1|AAH52296.1|  320|Homo sapiens heterogeneous nuclear r...    85   3e-16
BC033714-1|AAH33714.1|  320|Homo sapiens heterogeneous nuclear r...    85   3e-16
BC012158-1|AAH12158.1|  320|Homo sapiens heterogeneous nuclear r...    85   3e-16
BC009600-1|AAH09600.1|  320|Homo sapiens heterogeneous nuclear r...    85   3e-16
BC002355-1|AAH02355.1|  320|Homo sapiens heterogeneous nuclear r...    85   3e-16
BC113470-1|AAI13471.1|  378|Homo sapiens LOC653115 protein protein.    84   3e-16
BC112027-1|AAI12028.1|  378|Homo sapiens heterogeneous nuclear r...    84   3e-16
AY363225-1|AAQ63629.1|  378|Homo sapiens heterogeneous nuclear r...    84   3e-16
AC079305-1|AAY14709.1|  378|Homo sapiens unknown protein.              84   3e-16
BC108266-1|AAI08267.1|  320|Homo sapiens heterogeneous nuclear r...    83   8e-16
AL137058-3|CAI16736.1|  320|Homo sapiens protein ( Human DNA seq...    83   8e-16
BC012062-1|AAH12062.1|  407|Homo sapiens DAZ associated protein ...    81   2e-15
AY678451-1|AAV97647.1|  454|Homo sapiens DAZAP1/MEF2D fusion pro...    81   2e-15
AF181719-1|AAF78364.1|  407|Homo sapiens DAZ associated protein ...    81   2e-15
U09123-1|AAB60650.1|  341|Homo sapiens hnRNP protein A2 protein.       80   6e-15
M29065-1|AAA36574.1|  341|Homo sapiens protein ( Human hnRNP A2 ...    80   6e-15
M29064-1|AAA60271.1|  353|Homo sapiens SNRPB1 protein.                 80   6e-15
D28877-2|BAA06032.1|  341|Homo sapiens hnRNP A2 protein protein.       80   6e-15
D28877-1|BAA06031.1|  353|Homo sapiens hnRNP B1 protein protein.       80   6e-15
BC000506-1|AAH00506.3|  249|Homo sapiens HNRPA2B1 protein protein.     80   6e-15
BC004945-1|AAH04945.1|  298|Homo sapiens Unknown (protein for IM...    77   4e-14
S63912-1|AAB27595.1|  269|Homo sapiens FBRNP protein.                  77   7e-14
AK056850-1|BAB71295.1|  289|Homo sapiens protein ( Homo sapiens ...    73   1e-12
AB073212-1|BAB70469.1|  179|Homo sapiens Musashi1 protein.             71   5e-12
AB072592-1|BAB69769.1|  181|Homo sapiens Musashi1 protein.             71   5e-12
AB072591-1|BAB69768.1|  181|Homo sapiens Musashi1 protein.             71   5e-12
AB072590-1|BAB69767.1|  180|Homo sapiens Musashi1 protein.             71   5e-12
AL354775-1|CAI12730.1|  276|Homo sapiens protein ( Human DNA seq...    70   6e-12
BC017560-1|AAH17560.1|  151|Homo sapiens MSI2 protein protein.         69   1e-11
U23803-1|AAA65094.1|  305|Homo sapiens heterogeneous ribonucleop...    67   4e-11
CR456986-1|CAG33267.1|  305|Homo sapiens HNRPA0 protein.               67   4e-11
BC030249-1|AAH30249.1|  305|Homo sapiens heterogeneous nuclear r...    67   4e-11
BC028976-1|AAH28976.1|  305|Homo sapiens heterogeneous nuclear r...    67   4e-11
BC019271-1|AAH19271.1|  305|Homo sapiens heterogeneous nuclear r...    67   4e-11
BC018949-1|AAH18949.1|  305|Homo sapiens heterogeneous nuclear r...    67   4e-11
BC012980-1|AAH12980.1|  305|Homo sapiens heterogeneous nuclear r...    67   4e-11
BC011972-1|AAH11972.1|  305|Homo sapiens heterogeneous nuclear r...    67   4e-11
BC009284-1|AAH09284.1|  305|Homo sapiens heterogeneous nuclear r...    67   4e-11
BC007271-1|AAH07271.1|  305|Homo sapiens heterogeneous nuclear r...    67   4e-11
BC001008-1|AAH01008.1|  305|Homo sapiens heterogeneous nuclear r...    67   4e-11
U28686-1|AAB17212.1|  157|Homo sapiens RNPL protein.                   64   4e-10
BC006825-1|AAH06825.1|  157|Homo sapiens RNA binding motif (RNP1...    64   4e-10
X03910-1|CAA27544.1|  225|Homo sapiens protein ( Human mRNA for ...    62   1e-09
AF069682-1|AAC24858.2|  392|Homo sapiens testes specific heterog...    62   2e-09
U23731-1|AAA70033.1|  414|Homo sapiens TAR DNA-binding protein-4...    61   3e-09
EF434182-1|ABO32291.1|  414|Homo sapiens TDP43 splice variant 1 ...    61   3e-09
EF434181-1|ABO32290.1|  416|Homo sapiens TDP43 protein.                61   3e-09
CR533534-1|CAG38565.1|  414|Homo sapiens TARDBP protein.               61   3e-09
BC095435-1|AAH95435.1|  414|Homo sapiens TAR DNA binding protein...    61   3e-09
BC071657-1|AAH71657.1|  414|Homo sapiens TARDBP protein protein.       61   3e-09
AL109811-2|CAI22099.1|  295|Homo sapiens TAR DNA binding protein...    61   3e-09
AL109811-1|CAI22098.1|  414|Homo sapiens TAR DNA binding protein...    61   3e-09
AK222754-1|BAD96474.1|  414|Homo sapiens TAR DNA binding protein...    61   3e-09
AF279289-1|AAF82129.1|  386|Homo sapiens testes-specific heterog...    61   4e-09
Z23064-1|CAA80599.1|  391|Homo sapiens hnRNP G protein protein.        60   5e-09
BC057796-1|AAH57796.1|  392|Homo sapiens RNA binding motif prote...    60   5e-09
BC007435-1|AAH07435.1|  391|Homo sapiens RNA binding motif prote...    60   5e-09
BC006550-1|AAH06550.1|  391|Homo sapiens RNA binding motif prote...    60   5e-09
AY464692-1|AAR28036.1|  391|Homo sapiens heterogeneous nuclear r...    60   5e-09
AL683813-6|CAI39448.1|  391|Homo sapiens RNA binding motif prote...    60   5e-09
AF266723-1|AAK58567.1|  391|Homo sapiens RBMX protein.                 60   5e-09
DQ120650-1|ABB92435.1|  384|Homo sapiens RBM1 protein.                 60   6e-09
BC012942-1|AAH12942.1|  390|Homo sapiens RNA binding motif prote...    60   6e-09
AL139416-3|CAI21694.1|  159|Homo sapiens RNA binding motif prote...    60   6e-09
AL139416-2|CAI21693.1|  390|Homo sapiens RNA binding motif prote...    60   6e-09
X04347-1|CAA27874.1|  196|Homo sapiens protein ( Human liver mRN...    60   9e-09
AY547318-1|AAS55633.1|  236|Homo sapiens unknown protein.              58   2e-08
AL136305-1|CAC36889.1|  236|Homo sapiens protein ( Human DNA seq...    58   2e-08
AK095016-1|BAC04474.1|  211|Homo sapiens protein ( Homo sapiens ...    58   2e-08
D78134-1|BAA11212.1|  172|Homo sapiens CIRP protein.                   58   3e-08
BT007210-1|AAP35874.1|  172|Homo sapiens cold inducible RNA bind...    58   3e-08
BC000901-1|AAH00901.1|  172|Homo sapiens cold inducible RNA bind...    58   3e-08
BC000403-1|AAH00403.1|  172|Homo sapiens cold inducible RNA bind...    58   3e-08
AF021336-1|AAC51787.1|  172|Homo sapiens DNA damage-inducible RN...    58   3e-08
AC004258-1|AAC04895.1|  172|Homo sapiens CIRP protein.                 58   3e-08
X75315-1|CAA53064.1|  230|Homo sapiens SEB4B protein.                  57   6e-08
X75314-1|CAA53063.1|  229|Homo sapiens SEB4D protein.                  57   6e-08
BC018711-1|AAH18711.1|  216|Homo sapiens RBM38 protein protein.        57   6e-08
AF432218-1|AAL99924.1|  216|Homo sapiens CLL-associated antigen ...    57   6e-08
U53209-1|AAC50658.1|  282|Homo sapiens transformer-2 alpha protein.    56   1e-07
BC017094-1|AAH17094.1|  282|Homo sapiens transformer-2 alpha pro...    56   1e-07
AC023105-1|AAQ96870.1|  282|Homo sapiens unknown protein.              56   1e-07
AB097048-1|BAC77401.1|  282|Homo sapiens putative MAPK activatin...    56   1e-07
AK128423-1|BAC87434.1|  135|Homo sapiens protein ( Homo sapiens ...    55   2e-07
X76059-1|CAA53659.1|  496|Homo sapiens protein ( H.sapiens mRNA ...    53   1e-06
L10911-1|AAA16347.1|  530|Homo sapiens splicing factor protein.        53   1e-06
L10910-1|AAA16346.1|  524|Homo sapiens splicing factor protein.        53   1e-06
BC141835-1|AAI41836.1|  530|Homo sapiens RNA binding motif prote...    53   1e-06
BC131543-1|AAI31544.1|  508|Homo sapiens RBM39 protein protein.        53   1e-06
BC070298-1|AAH70298.1|  459|Homo sapiens RBMY1A1 protein protein.      53   1e-06
AL357374-9|CAC11119.1|  524|Homo sapiens RNA binding motif prote...    53   1e-06
AL357374-8|CAC11118.1|  530|Homo sapiens RNA binding motif prote...    53   1e-06
M96954-1|AAA36384.1|  375|Homo sapiens nucleolysin TIAR protein.       52   2e-06
D64015-1|BAA21559.1|  265|Homo sapiens T-cluster binding protein...    52   2e-06
AY633610-1|AAV33303.1|  374|Homo sapiens aging-associated gene 7...    52   2e-06
U36608-1|AAC16917.1|  220|Homo sapiens Y-chromosome RNA recognit...    51   3e-06
BX537770-1|CAD97833.1|  373|Homo sapiens hypothetical protein pr...    51   3e-06
BC033674-1|AAH33674.1|  283|Homo sapiens bol, boule-like (Drosop...    51   3e-06
AM295005-1|CAL25726.1|  289|Homo sapiens boll protein protein.         51   3e-06
AK093453-1|BAC04171.1|  339|Homo sapiens protein ( Homo sapiens ...    51   3e-06
AK058099-1|BAB71664.1|  283|Homo sapiens protein ( Homo sapiens ...    51   3e-06
AF272858-1|AAK58689.1|  283|Homo sapiens BOULE protein.                51   3e-06
AC011997-1|AAX93045.1|  283|Homo sapiens unknown protein.              51   3e-06
X76060-1|CAA53660.1|  419|Homo sapiens YRRM2 protein.                  51   4e-06
U68063-1|AAB08701.1|  288|Homo sapiens transformer-2 beta protein.     51   4e-06
U61267-1|AAC28242.1|  288|Homo sapiens htra2-beta protein.             51   4e-06
BC030018-1|AAH30018.1|  496|Homo sapiens RNA binding motif prote...    51   4e-06
BC005898-1|AAH05898.1|  288|Homo sapiens splicing factor, argini...    51   4e-06
BC000451-1|AAH00451.1|  288|Homo sapiens splicing factor, argini...    51   4e-06
BC000160-1|AAH00160.1|  288|Homo sapiens splicing factor, argini...    51   4e-06
AK098191-1|BAC05256.1|  252|Homo sapiens protein ( Homo sapiens ...    51   4e-06
AF057159-3|AAD19278.1|  188|Homo sapiens transformer-2-beta isof...    51   4e-06
AF057159-1|AAD19277.1|  288|Homo sapiens transformer-2-beta isof...    51   4e-06
AB209208-1|BAD92445.1|  278|Homo sapiens splicing factor, argini...    51   4e-06
M60858-1|AAA59954.1|  707|Homo sapiens nucleolin protein.              49   1e-05
BC105582-1|AAI05583.1|  173|Homo sapiens RBMX2 protein protein.        49   1e-05
BC033750-1|AAH33750.1|  322|Homo sapiens RNA binding motif prote...    49   1e-05
BC003676-1|AAH03676.1|  163|Homo sapiens Unknown (protein for IM...    49   1e-05
AL050405-1|CAB43745.1|  322|Homo sapiens hypothetical protein pr...    49   1e-05
AL035423-8|CAI42444.1|  322|Homo sapiens RNA binding motif prote...    49   1e-05
AF151837-1|AAD34074.1|  351|Homo sapiens CGI-79 protein protein.       49   1e-05
BC015944-1|AAH15944.1|  214|Homo sapiens TIA1 protein protein.         49   2e-05
BC013889-1|AAH13889.1|  759|Homo sapiens RNA binding motif prote...    49   2e-05
AK222716-1|BAD96436.1|  759|Homo sapiens RNA binding motif prote...    49   2e-05
AK001239-1|BAA91575.1|  759|Homo sapiens protein ( Homo sapiens ...    49   2e-05
AC016700-3|AAX93193.1|  386|Homo sapiens unknown protein.              49   2e-05
AB209211-1|BAD92448.1|  464|Homo sapiens TIA1 protein variant pr...    49   2e-05
BC010939-1|AAH10939.1|  306|Homo sapiens poly(A) binding protein...    48   4e-05
AF026029-1|AAC39596.1|  306|Homo sapiens poly(A) binding protein...    48   4e-05
U51586-1|AAB41656.1|  541|Homo sapiens siah binding protein 1 pr...    47   5e-05
CR457143-1|CAG33424.1|  559|Homo sapiens SIAHBP1 protein.              47   5e-05
BC011979-1|AAH11979.1|  516|Homo sapiens SIAHBP1 protein protein.      47   5e-05
BC011265-1|AAH11265.1|  516|Homo sapiens SIAHBP1 protein protein.      47   5e-05
BC009734-1|AAH09734.1|  499|Homo sapiens SIAHBP1 protein protein.      47   5e-05
BC008875-1|AAH08875.1|  542|Homo sapiens fuse-binding protein-in...    47   5e-05
AF217197-1|AAF27522.2|  542|Homo sapiens FBP-interacting repress...    47   5e-05
AF190744-1|AAF05605.1|  556|Homo sapiens poly-U binding splicing...    47   5e-05
AF114818-1|AAF23589.1|  559|Homo sapiens Ro ribonucleoprotein-bi...    47   5e-05
BC024208-1|AAH24208.1|  423|Homo sapiens RNA binding motif prote...    47   6e-05
BC002566-1|AAH02566.1|  424|Homo sapiens RNA binding motif prote...    47   6e-05
AK001344-1|BAA91638.1|  406|Homo sapiens protein ( Homo sapiens ...    47   6e-05
AF275678-1|AAG24388.1|  418|Homo sapiens PP239 protein protein.        47   6e-05
AF087905-1|AAP97203.1|  425|Homo sapiens splicing factor SF2 pro...    47   6e-05
L35013-1|AAA60300.1|  424|Homo sapiens spliceosomal protein prot...    46   9e-05
DQ160195-1|AAZ93379.1|  314|Homo sapiens cyclophilin-33B protein.      46   9e-05
BC107736-1|AAI07737.1|  301|Homo sapiens peptidylprolyl isomeras...    46   9e-05
BC090883-1|AAH90883.1|  424|Homo sapiens splicing factor 3b, sub...    46   9e-05
BC013886-1|AAH13886.1|  424|Homo sapiens splicing factor 3b, sub...    46   9e-05
BC008451-1|AAH08451.1|  301|Homo sapiens peptidylprolyl isomeras...    46   9e-05
BC004898-1|AAH04898.1|  301|Homo sapiens peptidylprolyl isomeras...    46   9e-05
BC004273-1|AAH04273.1|  424|Homo sapiens splicing factor 3b, sub...    46   9e-05
AL591493-2|CAI12554.1|  424|Homo sapiens splicing factor 3b, sub...    46   9e-05
AL591493-1|CAI12553.1|  190|Homo sapiens splicing factor 3b, sub...    46   9e-05
AL590487-2|CAI12648.1|  424|Homo sapiens splicing factor 3b, sub...    46   9e-05
AL590487-1|CAI12647.1|  190|Homo sapiens splicing factor 3b, sub...    46   9e-05
AL049824-4|CAI19350.1|  301|Homo sapiens peptidylprolyl isomeras...    46   9e-05
AL049824-2|CAI19348.1|  296|Homo sapiens peptidylprolyl isomeras...    46   9e-05
AL049824-1|CAI19347.1|  314|Homo sapiens peptidylprolyl isomeras...    46   9e-05
AL035404-8|CAI19579.1|  301|Homo sapiens peptidylprolyl isomeras...    46   9e-05
AL035404-6|CAI19577.1|  296|Homo sapiens peptidylprolyl isomeras...    46   9e-05
AL035404-5|CAI19576.1|  314|Homo sapiens peptidylprolyl isomeras...    46   9e-05
AL033527-11|CAI19410.1|  296|Homo sapiens peptidylprolyl isomera...    46   9e-05
AL033527-10|CAI19409.1|  314|Homo sapiens peptidylprolyl isomera...    46   9e-05
AK223322-1|BAD97042.1|  424|Homo sapiens splicing factor 3b, sub...    46   9e-05
AF104013-1|AAD19907.1|  296|Homo sapiens peptidyl-prolyl cis-tra...    46   9e-05
AF104012-1|AAD19906.1|  301|Homo sapiens peptidyl-prolyl cis-tra...    46   9e-05
AF042386-1|AAC00007.1|  296|Homo sapiens cyclophilin-33B protein.      46   9e-05
AF042385-1|AAC00006.1|  301|Homo sapiens cyclophilin-33A protein.      46   9e-05
U29943-1|AAA70417.1|  346|Homo sapiens Hel-N2 protein.                 46   1e-04
U12431-1|AAA69698.1|  359|Homo sapiens ELAV-like neuronal protei...    46   1e-04
D26158-1|BAA21838.1|  350|Homo sapiens PLE21 protein protein.          46   1e-04
BC030692-1|AAH30692.1|  346|Homo sapiens ELAVL2 protein protein.       46   1e-04
BC014144-1|AAH14144.1|  367|Homo sapiens ELAVL3 protein protein.       46   1e-04
AL161628-4|CAI13378.1|  387|Homo sapiens ELAV (embryonic lethal,...    46   1e-04
AL161628-3|CAI13377.1|  189|Homo sapiens ELAV (embryonic lethal,...    46   1e-04
AL161628-2|CAC22160.1|  359|Homo sapiens ELAV (embryonic lethal,...    46   1e-04
AL161628-1|CAI13376.1|  346|Homo sapiens ELAV (embryonic lethal,...    46   1e-04
AB209294-1|BAD92531.1|  367|Homo sapiens ELAV (embryonic lethal,...    46   1e-04
M62843-1|AAA58396.1|  380|Homo sapiens brain protein protein.          46   1e-04
L26405-1|AAA58677.1|  359|Homo sapiens huc protein.                    46   1e-04
CR541823-1|CAG46622.1|  174|Homo sapiens RBM8A protein.                46   1e-04
BC036071-1|AAH36071.1|  366|Homo sapiens ELAVL4 protein protein.       46   1e-04
AY036909-1|AAK67714.1|  360|Homo sapiens HUC protein.                  46   1e-04
AY033998-1|AAK57541.1|  380|Homo sapiens HUDPRO1 protein.              46   1e-04
AY033997-1|AAK57540.1|  366|Homo sapiens HUD1 protein.                 46   1e-04
AY033996-1|AAK57539.1|  383|Homo sapiens HUD4 protein.                 46   1e-04
AY033995-1|AAK57538.1|  366|Homo sapiens HUD3 protein.                 46   1e-04
AL592182-6|CAI15792.1|  385|Homo sapiens ELAV (embryonic lethal,...    46   1e-04
AL592182-5|CAI15793.1|  371|Homo sapiens ELAV (embryonic lethal,...    46   1e-04
AL592182-4|CAI15791.1|  380|Homo sapiens ELAV (embryonic lethal,...    46   1e-04
AL592182-3|CAI15790.1|  366|Homo sapiens ELAV (embryonic lethal,...    46   1e-04
AL592182-2|CAI15789.1|  383|Homo sapiens ELAV (embryonic lethal,...    46   1e-04
AL592182-1|CAI15788.1|  366|Homo sapiens ELAV (embryonic lethal,...    46   1e-04
AL583843-6|CAI14638.1|  385|Homo sapiens ELAV (embryonic lethal,...    46   1e-04
AL583843-5|CAI14639.1|  371|Homo sapiens ELAV (embryonic lethal,...    46   1e-04
AL583843-4|CAI14637.1|  380|Homo sapiens ELAV (embryonic lethal,...    46   1e-04
AL583843-3|CAI14636.1|  366|Homo sapiens ELAV (embryonic lethal,...    46   1e-04
AL583843-2|CAI14635.1|  383|Homo sapiens ELAV (embryonic lethal,...    46   1e-04
AL583843-1|CAI14634.1|  366|Homo sapiens ELAV (embryonic lethal,...    46   1e-04
X84841-1|CAA59278.1|  437|Homo sapiens 68 kDa (U1) ribonucleopro...    45   3e-04
X06812-1|CAA29961.1|  301|Homo sapiens protein ( Human mRNA for ...    45   3e-04
X04654-1|CAA28352.1|  614|Homo sapiens protein ( Human mRNA for ...    45   3e-04
M57939-2|AAA36573.1|  428|Homo sapiens ribonucleoprotein antigen...    45   3e-04
M57939-1|AAA36572.1|  437|Homo sapiens ribonucleoprotein antigen...    45   3e-04
M22636-1|AAA03001.1|  437|Homo sapiens protein ( Human U1 small ...    45   3e-04
BC001315-1|AAH01315.1|  437|Homo sapiens small nuclear ribonucle...    45   3e-04
CR457257-1|CAG33538.1|  423|Homo sapiens RNPC4 protein.                44   3e-04
AF026564-1|AAC16916.1|  318|Homo sapiens RNA binding protein pro...    44   3e-04
U77476-1|AAB84361.1|  295|Homo sapiens DAZLA protein protein.          44   5e-04
CR541805-1|CAG46604.1|  174|Homo sapiens RBM8A protein.                44   5e-04
BC071577-1|AAH71577.1|  174|Homo sapiens RNA binding motif prote...    44   5e-04
BC017088-1|AAH17088.1|  174|Homo sapiens RNA binding motif prote...    44   5e-04
AY034002-1|AAK57545.1|  318|Homo sapiens Hu antigen C long protein.    44   5e-04
AF403012-1|AAL26999.1|  174|Homo sapiens ribonucleoprotein RBM8 ...    44   5e-04
AF299118-1|AAG27091.1|  174|Homo sapiens RNA-binding protein Y14...    44   5e-04
AF231512-1|AAG16782.1|  158|Homo sapiens RNA binding motif prote...    44   5e-04
AF231511-1|AAG16781.1|  173|Homo sapiens RNA binding motif prote...    44   5e-04
AF198620-1|AAF37551.1|  173|Homo sapiens RNA binding motif prote...    44   5e-04
AF182415-1|AAG14951.1|  158|Homo sapiens MDS014 protein.               44   5e-04
AF127761-1|AAD21089.1|  174|Homo sapiens ribonucleoprotein RBM8 ...    44   5e-04
U66726-1|AAB39935.1|  295|Homo sapiens germline specific RNA bin...    44   6e-04
U66078-1|AAB63596.1|  295|Homo sapiens DAZLA protein.                  44   6e-04
U65918-1|AAC50813.1|  295|Homo sapiens RNA binding protein protein.    44   6e-04
U44799-1|AAA86655.1|  246|Homo sapiens U1-snRNP binding protein ...    44   6e-04
U44798-1|AAA86654.1|  246|Homo sapiens U1-snRNP binding protein ...    44   6e-04
BC111955-1|AAI11956.1|  251|Homo sapiens U11/U12 snRNP 35K, isof...    44   6e-04
BC093671-1|AAH93671.1|  251|Homo sapiens U11/U12 snRNP 35K protein.    44   6e-04
BC054034-1|AAH54034.1|  246|Homo sapiens U11/U12 snRNP 35K protein.    44   6e-04
BC047678-1|AAH47678.1|  251|Homo sapiens U11/U12 snRNP 35K protein.    44   6e-04
BC028101-1|AAH28101.1|  485|Homo sapiens bruno-like 5, RNA bindi...    44   6e-04
BC027595-1|AAH27595.1|  295|Homo sapiens deleted in azoospermia-...    44   6e-04
BC017895-1|AAH17895.1|  109|Homo sapiens chromosome 14 open read...    44   6e-04
BC009622-1|AAH09622.1|  251|Homo sapiens U11/U12 snRNP 35K protein.    44   6e-04
BC006516-1|AAH06516.3|  482|Homo sapiens NCL protein protein.          44   6e-04
BC006494-1|AAH06494.3|  482|Homo sapiens NCL protein protein.          44   6e-04
BC002343-1|AAH02343.3|  482|Homo sapiens NCL protein protein.          44   6e-04
AY860853-1|AAX58600.1|  109|Homo sapiens SRA stem-loop-interacti...    44   6e-04
AK127608-1|BAC87055.1|  603|Homo sapiens protein ( Homo sapiens ...    44   6e-04
AK091742-1|BAC03738.1|  687|Homo sapiens protein ( Homo sapiens ...    44   6e-04
AJ272055-1|CAC81241.1|  109|Homo sapiens hypothetical protein pr...    44   6e-04
AF329266-1|AAK07476.1|  481|Homo sapiens CUG-BP and ETR-3 like f...    44   6e-04
AF271779-1|AAG44790.1|  109|Homo sapiens DC50 protein.                 44   6e-04
AF253980-1|AAG44629.1|  109|Homo sapiens DC23 protein.                 44   6e-04
AC017104-2|AAY24247.1|  710|Homo sapiens unknown protein.              44   6e-04
AB209067-1|BAD92304.1|  421|Homo sapiens bruno-like 5, RNA bindi...    44   6e-04
X06815-1|CAA29964.1|  216|Homo sapiens hU1-70K-like protein (216...    43   8e-04
U21663-1|AAB02393.1|  366|Homo sapiens DAZ protein protein.            43   8e-04
M57935-1|AAA36571.1|  166|Homo sapiens ribonucleoprotein antigen...    43   8e-04
BC114927-1|AAI14928.1|  613|Homo sapiens DAZ1 protein protein.         43   8e-04
BC113006-1|AAI13007.1|  534|Homo sapiens deleted in azoospermia ...    43   8e-04
BC113005-1|AAI13006.1|  438|Homo sapiens deleted in azoospermia ...    43   8e-04
BC047617-1|AAH47617.1|  390|Homo sapiens deleted in azoospermia ...    43   8e-04
BC047480-1|AAH47480.1|  390|Homo sapiens deleted in azoospermia ...    43   8e-04
BC006137-1|AAH06137.1|  960|Homo sapiens RBM19 protein protein.        43   8e-04
BC004289-1|AAH04289.1|  960|Homo sapiens RBM19 protein protein.        43   8e-04
AF414184-1|AAL24502.1|  534|Homo sapiens deleted in azoospermia ...    43   8e-04
AF271088-1|AAF91406.1|  501|Homo sapiens deleted in azoospermia ...    43   8e-04
AF271087-1|AAF91405.1|  458|Homo sapiens deleted in azoospermia ...    43   8e-04
AF248482-1|AAF91331.1|  331|Homo sapiens deleted in azoospermia ...    43   8e-04
AF248481-1|AAF91330.1|  486|Homo sapiens deleted in azoospermia ...    43   8e-04
AF248480-1|AAF91329.1|  558|Homo sapiens deleted in azoospermia ...    43   8e-04
AB014582-1|BAA31657.2|  973|Homo sapiens KIAA0682 protein protein.     43   8e-04
X64044-1|CAA45409.1|  475|Homo sapiens splicing factor U2AF prot...    43   0.001
BC029451-1|AAH29451.1|  425|Homo sapiens RNA binding motif prote...    43   0.001
BC026077-1|AAH26077.1|  161|Homo sapiens RBMY2FP protein protein.      43   0.001
BC024238-1|AAH24238.1|  293|Homo sapiens MKI67 (FHA domain) inte...    43   0.001
BC022990-1|AAH22990.1|  293|Homo sapiens MKI67 (FHA domain) inte...    43   0.001
AL732292-3|CAM28277.1|  408|Homo sapiens novel protein protein.        43   0.001
AL732292-2|CAI21936.1|  430|Homo sapiens RNA binding motif prote...    43   0.001
AL133418-4|CAM28326.1|  408|Homo sapiens novel protein protein.        43   0.001
AL133418-3|CAI22960.1|  430|Homo sapiens RNA binding motif prote...    43   0.001
AC018737-1|AAY14830.1|  293|Homo sapiens unknown protein.              43   0.001
AB044971-1|BAB41210.1|  293|Homo sapiens nucleolar phosphoprotei...    43   0.001
U38175-1|AAB41913.1|  326|Homo sapiens HuR RNA binding protein p...    42   0.001
BX537888-1|CAD97884.1|  500|Homo sapiens hypothetical protein pr...    42   0.001
BT009793-1|AAP88795.1|  326|Homo sapiens ELAV (embryonic lethal,...    42   0.001
BC018135-1|AAH18135.1|  471|Homo sapiens pre-mRNA cleavage facto...    42   0.001
BC003376-1|AAH03376.1|  326|Homo sapiens ELAV (embryonic lethal,...    42   0.001
AJ275970-1|CAC81661.1|  471|Homo sapiens pre-mRNA cleavage facto...    42   0.001
CR457134-1|CAG33415.1|  320|Homo sapiens EIF3S4 protein.               42   0.002
BT006889-1|AAP35535.1|  320|Homo sapiens eukaryotic translation ...    42   0.002
BC011731-1|AAH11731.1|  449|Homo sapiens GTPase activating prote...    42   0.002
BC008469-1|AAH08469.1|  320|Homo sapiens eukaryotic translation ...    42   0.002
BC000733-1|AAH00733.1|  320|Homo sapiens eukaryotic translation ...    42   0.002
AY236872-1|AAP75556.1|  419|Homo sapiens RNA binding motif singl...    42   0.002
AF145284-1|AAD51932.1|  482|Homo sapiens RNA-binding protein iso...    42   0.002
AF094850-1|AAG15419.1|  320|Homo sapiens eukaryotic translation ...    42   0.002
AF092453-1|AAG15396.1|  320|Homo sapiens eukaryotic translation ...    42   0.002
AF053535-1|AAC95292.1|  449|Homo sapiens ras-GAP/RNA binding pro...    42   0.002
AF020833-1|AAB71866.1|  320|Homo sapiens eukaryotic translation ...    42   0.002
AB014560-1|BAA31635.2|  490|Homo sapiens KIAA0660 protein protein.     42   0.002
U63289-1|AAC50895.1|  482|Homo sapiens CUG-BP/hNab50 protein.          42   0.002
U32519-1|AAB07787.1|  466|Homo sapiens GAP SH3 binding protein p...    42   0.002
CR536535-1|CAG38772.1|  466|Homo sapiens G3BP protein.                 42   0.002
BT019384-1|AAV38191.1|  466|Homo sapiens Ras-GTPase-activating p...    42   0.002
BC117315-1|AAI17316.1|  433|Homo sapiens RBMS3 protein protein.        42   0.002
BC031079-1|AAH31079.1|  483|Homo sapiens CUG triplet repeat, RNA...    42   0.002
BC028239-1|AAH28239.1|  616|Homo sapiens cleavage stimulation fa...    42   0.002
BC022543-1|AAH22543.1|  217|Homo sapiens zinc finger CCHC-type a...    42   0.002
BC010177-1|AAH10177.1|  140|Homo sapiens ZCRB1 protein protein.        42   0.002
BC010074-1|AAH10074.1|  173|Homo sapiens FUSIP1 protein protein.       42   0.002
BC006997-1|AAH06997.1|  466|Homo sapiens GTPase activating prote...    42   0.002
BC005099-1|AAH05099.1|  141|Homo sapiens Unknown (protein for IM...    42   0.002
BC005039-1|AAH05039.1|  262|Homo sapiens FUS interacting protein...    42   0.002
BC001107-1|AAH01107.1|  183|Homo sapiens FUS interacting protein...    42   0.002
AY236871-1|AAP75555.1|  437|Homo sapiens RNA binding motif singl...    42   0.002
AY150181-1|AAN65381.1|  183|Homo sapiens splicing factor SRp38-2...    42   0.002
AY150180-1|AAN65380.1|  262|Homo sapiens splicing factor SRp38 p...    42   0.002
AY130299-1|AAN05429.1|  616|Homo sapiens tCstF-64 protein.             42   0.002
AY048592-2|AAL06099.1|  262|Homo sapiens TLS-associated SR prote...    42   0.002
AY048592-1|AAL06098.1|  183|Homo sapiens TLS-associated SR prote...    42   0.002
AL590609-10|CAI14808.1|  262|Homo sapiens FUS interacting protei...    42   0.002
AL590609-9|CAI14807.1|  261|Homo sapiens FUS interacting protein...    42   0.002
AL590609-8|CAI14805.1|  173|Homo sapiens FUS interacting protein...    42   0.002
AL590609-7|CAI14806.1|  172|Homo sapiens FUS interacting protein...    42   0.002
AL590609-6|CAI14803.1|  183|Homo sapiens FUS interacting protein...    42   0.002
AL590609-5|CAI14804.1|  182|Homo sapiens FUS interacting protein...    42   0.002
AL109839-1|CAI95631.1|  614|Homo sapiens chromosome 20 open read...    42   0.002
AL008725-4|CAI95662.1|  614|Homo sapiens chromosome 20 open read...    42   0.002
AK222994-1|BAD96714.1|  262|Homo sapiens FUS interacting protein...    42   0.002
AK222606-1|BAD96326.1|  466|Homo sapiens Ras-GTPase-activating p...    42   0.002
AK222574-1|BAD96294.1|  616|Homo sapiens cleavage stimulation fa...    42   0.002
AK130003-1|BAC85272.1|  307|Homo sapiens protein ( Homo sapiens ...    42   0.002
AK001286-1|BAA91601.1|  183|Homo sapiens protein ( Homo sapiens ...    42   0.002
AJ007988-1|CAC20566.1|  486|Homo sapiens deadenylation factor CU...    42   0.002
AF449427-1|AAL57514.1|  262|Homo sapiens SRrp40 protein.               42   0.002
AF419332-1|AAL16666.1|  261|Homo sapiens TLS-associated protein ...    42   0.002
AF419331-1|AAL16665.1|  183|Homo sapiens TLS-associated protein ...    42   0.002
AF267534-1|AAF78956.1|  483|Homo sapiens CUG-binding protein A i...    42   0.002
AF267533-1|AAF78955.1|  486|Homo sapiens CUG-binding protein LYL...    42   0.002
AF248648-1|AAF86230.1|  486|Homo sapiens RNA-binding protein BRU...    42   0.002
AF248483-1|AAF91332.1|  413|Homo sapiens deleted in azoospermia ...    42   0.002
AF067730-1|AAC26727.1|  262|Homo sapiens TLS-associated protein ...    42   0.002
AF047448-1|AAC70918.1|  183|Homo sapiens TLS-associated protein ...    42   0.002
AF023259-1|AAC63910.1|  411|Homo sapiens RNA-binding protein pro...    42   0.002
AB210019-1|BAE06101.1|  544|Homo sapiens CUGBP1 variant protein ...    42   0.002
AB062361-1|BAB56132.1|  217|Homo sapiens ZCRB1 protein protein.        42   0.002
Z95327-3|CAI42680.1|  577|Homo sapiens cleavage stimulation fact...    41   0.003
Z83819-6|CAB06072.2|  577|Homo sapiens cleavage stimulation fact...    41   0.003
Z48501-1|CAA88401.1|  522|Homo sapiens polyadenylate binding pro...    41   0.003
U96074-1|AAC78728.1|  320|Homo sapiens translation initiation fa...    41   0.003
U75686-1|AAB97309.1|  644|Homo sapiens polyadenylate binding pro...    41   0.003
U68104-1|AAD08718.1|  636|Homo sapiens poly(A)-binding protein p...    41   0.003
U33818-1|AAC50350.1|  644|Homo sapiens inducible poly(A)-binding...    41   0.003
M85085-1|AAA35724.1|  577|Homo sapiens cleavage stimulation fact...    41   0.003
D12799-1|BAA02244.1|  193|Homo sapiens polyadenylate binding pro...    41   0.003
DQ120640-1|ABB92425.1|  630|Homo sapiens PABP3 protein.                41   0.003
BT009778-1|AAP88780.1|  577|Homo sapiens cleavage stimulation fa...    41   0.003
BC094755-1|AAH94755.1|  660|Homo sapiens PABPC4 protein protein.       41   0.003
BC071591-1|AAH71591.1|  660|Homo sapiens PABPC4 protein protein.       41   0.003
BC065540-1|AAH65540.1|  631|Homo sapiens PABPC4 protein protein.       41   0.003
BC047522-1|AAH47522.1|  402|Homo sapiens BRUNOL5 protein protein.      41   0.003
BC045608-1|AAH45608.1|  631|Homo sapiens poly(A) binding protein...    41   0.003
BC041863-1|AAH41863.1|  636|Homo sapiens poly(A) binding protein...    41   0.003
BC033135-1|AAH33135.1|  559|Homo sapiens Similar to cleavage sti...    41   0.003
BC030574-1|AAH30574.1|  471|Homo sapiens U2 small nuclear RNA au...    41   0.003
BC027617-1|AAH27617.1|  631|Homo sapiens poly(A) binding protein...    41   0.003
BC023520-1|AAH23520.1|  636|Homo sapiens poly(A) binding protein...    41   0.003
BC017712-1|AAH17712.1|  577|Homo sapiens cleavage stimulation fa...    41   0.003
BC015958-1|AAH15958.1|  636|Homo sapiens PABPC1 protein protein.       41   0.003
BC008740-1|AAH08740.1|  471|Homo sapiens U2 small nuclear RNA au...    41   0.003
AL845289-3|CAI12300.1|  644|Homo sapiens poly(A) binding protein...    41   0.003
AL845289-2|CAI12298.1|  660|Homo sapiens poly(A) binding protein...    41   0.003
AL845289-1|CAI12299.1|  615|Homo sapiens poly(A) binding protein...    41   0.003
AL365277-4|CAI16414.1|  644|Homo sapiens poly(A) binding protein...    41   0.003
AL365277-3|CAI16412.1|  660|Homo sapiens poly(A) binding protein...    41   0.003
AL365277-2|CAI16413.1|  615|Homo sapiens poly(A) binding protein...    41   0.003
AL359757-1|CAH70805.1|  631|Homo sapiens poly(A) binding protein...    41   0.003
AK074596-1|BAC11082.1|  484|Homo sapiens protein ( Homo sapiens ...    41   0.003
AF132026-1|AAG38953.1|  631|Homo sapiens testis-specific poly(A)...    41   0.003
AF051311-1|AAC15705.1|  449|Homo sapiens Ras-GAP SH3 binding pro...    41   0.003
BC118568-1|AAI18569.1|  252|Homo sapiens PABPC4 protein protein.       41   0.004
BC106908-1|AAI06909.1|  281|Homo sapiens PABPC4 protein protein.       41   0.004
BC021715-1|AAH21715.1|  261|Homo sapiens serine-arginine repress...    41   0.004
AL365277-15|CAI16425.1|  410|Homo sapiens poly(A) binding protei...    41   0.004
AK222917-1|BAD96637.1|  371|Homo sapiens PABPC4 protein variant ...    41   0.004
AF449428-1|AAL57515.1|  261|Homo sapiens SRrp35 protein.               41   0.004
X77494-1|CAA54628.1|  389|Homo sapiens MSSP-2 protein.                 40   0.006
X64652-1|CAA45923.1|  372|Homo sapiens 348 aa protein protein.         40   0.006
D28482-1|BAA05841.1|  403|Homo sapiens SCR2 protein.                   40   0.006
BX640912-1|CAE45953.1|  613|Homo sapiens hypothetical protein pr...    40   0.006
BX537372-1|CAD97614.1|  119|Homo sapiens hypothetical protein pr...    40   0.006
BC110389-1|AAI10390.1|  607|Homo sapiens HNRPR protein protein.        40   0.006
BC018951-1|AAH18951.1|  406|Homo sapiens RNA binding motif, sing...    40   0.006
BC014784-1|AAH14784.1|  526|Homo sapiens Unknown (protein for IM...    40   0.006
BC012993-1|AAH12993.1|  403|Homo sapiens RNA binding motif, sing...    40   0.006
BC012992-1|AAH12992.1|  403|Homo sapiens RNA binding motif, sing...    40   0.006
BC004167-1|AAH04167.2|  484|Homo sapiens bruno-like 4, RNA bindi...    40   0.006
BC001946-1|AAH01946.2|  484|Homo sapiens bruno-like 4, RNA bindi...    40   0.006
BC001449-1|AAH01449.1|  636|Homo sapiens HNRPR protein protein.        40   0.006
AL136097-15|CAI16208.1|  227|Homo sapiens nucleolar protein 8 pr...    40   0.006
AL136097-14|CAI16209.1|  205|Homo sapiens nucleolar protein 8 pr...    40   0.006
AL136097-13|CAC12712.1|  427|Homo sapiens nucleolar protein 8 pr...    40   0.006
AL109936-4|CAI19027.1|  636|Homo sapiens heterogeneous nuclear r...    40   0.006
AL109936-3|CAI19026.1|  633|Homo sapiens heterogeneous nuclear r...    40   0.006
AF000364-1|AAC39540.1|  633|Homo sapiens heterogeneous nuclear r...    40   0.006
AC104598-1|AAX93183.1|  188|Homo sapiens unknown protein.              40   0.006
AB105104-1|BAD12268.1| 1167|Homo sapiens nucleolar protein 8 pro...    40   0.006
X84157-1|CAA58962.1|  156|Homo sapiens subunit of the dimeric ca...    40   0.007
D82351-1|BAA11561.1|  373|Homo sapiens MSSP-1 protein.                 40   0.007
D59253-1|BAA09599.1|  156|Homo sapiens NCBP interacting protein ...    40   0.007
D28483-1|BAA05842.1|  407|Homo sapiens SCR3 protein.                   40   0.007
BT006842-1|AAP35488.1|  156|Homo sapiens nuclear cap binding pro...    40   0.007
BC072679-1|AAH72679.1|  407|Homo sapiens RNA binding motif, sing...    40   0.007
BC071575-1|AAH71575.1|   69|Homo sapiens FUSIP1 protein protein.       40   0.007
BC031682-1|AAH31682.1|  450|Homo sapiens RBM42 protein protein.        40   0.007
BC027863-1|AAH27863.1|  407|Homo sapiens RNA binding motif, sing...    40   0.007
BC004204-1|AAH04204.1|  480|Homo sapiens hypothetical protein MG...    40   0.007
BC002868-1|AAH02868.1|  451|Homo sapiens MGC10433 protein protein.     40   0.007
BC001255-1|AAH01255.1|  156|Homo sapiens nuclear cap binding pro...    40   0.007
AY644767-1|AAV85455.1|  156|Homo sapiens cell proliferation-indu...    40   0.007
AC002115-1|AAB57629.1|  339|Homo sapiens F25451_2 protein.             40   0.007
Y00345-1|CAA68428.1|  633|Homo sapiens protein ( Human mRNA for ...    40   0.010
DQ351905-1|ABC73063.1|  595|Homo sapiens heterogeneous nuclear r...    40   0.010
BX537536-1|CAD97776.1|  492|Homo sapiens hypothetical protein pr...    40   0.010
BC107684-1|AAI07685.1|  387|Homo sapiens PPIL4 protein protein.        40   0.010
BC064134-1|AAH64134.1|  434|Homo sapiens PPIL4 protein protein.        40   0.010
BC020986-1|AAH20986.1|  492|Homo sapiens peptidylprolyl isomeras...    40   0.010
AL357619-2|CAI16471.1|  492|Homo sapiens peptidylprolyl isomeras...    40   0.010
AL078581-5|CAI19508.1|  492|Homo sapiens peptidylprolyl isomeras...    40   0.010
BC108278-1|AAI08279.1|  466|Homo sapiens GTPase activating prote...    39   0.013
BC104758-1|AAI04759.1|  465|Homo sapiens trinucleotide repeat co...    39   0.013
BC068008-1|AAH68008.1|  407|Homo sapiens TNRC4 protein protein.        39   0.013
BC052491-1|AAH52491.1|  464|Homo sapiens trinucleotide repeat co...    39   0.013
BC004145-1|AAH04145.2|  291|Homo sapiens TNRC4 protein protein.        39   0.013
AY165003-1|AAN73884.1|  465|Homo sapiens CUG-BP and ETR-3 like f...    39   0.013
AL589765-5|CAI17168.1|  465|Homo sapiens trinucleotide repeat co...    39   0.013
AL589765-4|CAI17167.1|  415|Homo sapiens trinucleotide repeat co...    39   0.013
AL589765-3|CAI17166.1|  465|Homo sapiens trinucleotide repeat co...    39   0.013
AL109839-2|CAI95632.1|  330|Homo sapiens chromosome 20 open read...    39   0.013
AL008725-5|CAI95663.1|  330|Homo sapiens chromosome 20 open read...    39   0.013
AF329264-1|AAK07474.1|  462|Homo sapiens CUG-BP and ETR-3 like f...    39   0.013
AB209264-1|BAD92501.1|  441|Homo sapiens trinucleotide repeat co...    39   0.013
U69546-1|AAB09040.1|  490|Homo sapiens RNA-binding protein BRUNO...    39   0.017
BC063113-1|AAH63113.1|  382|Homo sapiens poly(A) binding protein...    39   0.017
BC036391-1|AAH36391.1|  521|Homo sapiens CUGBP2 protein protein.       39   0.017
AY675556-1|AAV91783.1|  474|Homo sapiens myocyte enhancer factor...    39   0.017
AL662874-3|CAI41476.1|  218|Homo sapiens poly(A) binding protein...    39   0.017
AL662874-2|CAI41475.1|  382|Homo sapiens poly(A) binding protein...    39   0.017
AL157704-2|CAH70230.1|  490|Homo sapiens CUG triplet repeat, RNA...    39   0.017
AL157704-1|CAH70231.1|  498|Homo sapiens CUG triplet repeat, RNA...    39   0.017
AL136320-2|CAI20169.1|  490|Homo sapiens CUG triplet repeat, RNA...    39   0.017
AL136320-1|CAI20168.1|  498|Homo sapiens CUG triplet repeat, RNA...    39   0.017
AL122118-1|CAB59276.1|  367|Homo sapiens hypothetical protein pr...    39   0.017
AK001049-1|BAA91479.1|  427|Homo sapiens protein ( Homo sapiens ...    39   0.017
AJ278963-1|CAC42826.1|  382|Homo sapiens Poly(A)-binding protein...    39   0.017
AF432906-1|AAL27627.1|  488|Homo sapiens neuroblastoma apoptosis...    39   0.017
AF295068-3|AAK72223.1|  484|Homo sapiens neuroplastoma apoptosis...    39   0.017
AF295068-2|AAK92699.1|  490|Homo sapiens neuroplastoma apoptosis...    39   0.017
AF295068-1|AAK72224.1|  509|Homo sapiens neuroplastoma apoptosis...    39   0.017
AF090694-1|AAD13761.1|  509|Homo sapiens apoptosis-related RNA b...    39   0.017
AF090693-1|AAD13760.1|  508|Homo sapiens apoptosis-related RNA b...    39   0.017

>U02019-1|AAC50056.1|  286|Homo sapiens p37 AUF1 protein.
          Length = 286

 Score =  107 bits (256), Expect = 4e-23
 Identities = 45/81 (55%), Positives = 60/81 (74%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+F+GGLSW+TT K+L+D+F  +GE+    +K DP TGRSRGF F++FK  ES+DKVM  
Sbjct: 77  KMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQ 136

Query: 190 GEHTINNKKVDPKKAKARHGK 252
            EH +N K +DPK+AKA   K
Sbjct: 137 KEHKLNGKVIDPKRAKAMKTK 157



 Score = 74.5 bits (175), Expect = 3e-13
 Identities = 32/79 (40%), Positives = 51/79 (64%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +K+FVGGLS +T ++++R++FG +GE+ESI +  D  T + RGF FI FK  E + K+M 
Sbjct: 161 KKIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIME 220

Query: 187 AGEHTINNKKVDPKKAKAR 243
              H +   K + K A ++
Sbjct: 221 KKYHNVGLSKCEIKVAMSK 239



 Score = 71.3 bits (167), Expect = 3e-12
 Identities = 29/76 (38%), Positives = 48/76 (63%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGLS +  +++IR +F  FG +  +E+P D   N+R+GFCFITF+ E+ V  +++   
Sbjct: 164 FVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKY 223

Query: 435 RTIGGKEVDVKRATPK 482
             +G  + ++K A  K
Sbjct: 224 HNVGLSKCEIKVAMSK 239



 Score = 55.6 bits (128), Expect = 1e-07
 Identities = 21/73 (28%), Positives = 45/73 (61%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGLS + +  +++++FS+FG +++  +  D    + +GF F+ F+  + V+ ++   +
Sbjct: 79  FIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKE 138

Query: 435 RTIGGKEVDVKRA 473
             + GK +D KRA
Sbjct: 139 HKLNGKVIDPKRA 151


>M94630-1|AAA35781.1|  328|Homo sapiens DNA-binding protein protein.
          Length = 328

 Score =  107 bits (256), Expect = 4e-23
 Identities = 45/81 (55%), Positives = 60/81 (74%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+F+GGLSW+TT K+L+D+F  +GE+    +K DP TGRSRGF F++FK  ES+DKVM  
Sbjct: 77  KMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQ 136

Query: 190 GEHTINNKKVDPKKAKARHGK 252
            EH +N K +DPK+AKA   K
Sbjct: 137 KEHKLNGKVIDPKRAKAMKTK 157



 Score = 72.1 bits (169), Expect = 1e-12
 Identities = 31/79 (39%), Positives = 50/79 (63%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +K+FVGGLS +T ++++R++FG +GE+ESI +  D  T + RG  FI FK  E + K+M 
Sbjct: 161 KKIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGLCFITFKEEEPVKKIME 220

Query: 187 AGEHTINNKKVDPKKAKAR 243
              H +   K + K A ++
Sbjct: 221 KKYHNVGLSKCEIKVAMSK 239



 Score = 68.9 bits (161), Expect = 1e-11
 Identities = 28/76 (36%), Positives = 47/76 (61%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGLS +  +++IR +F  FG +  +E+P D   N+R+G CFITF+ E+ V  +++   
Sbjct: 164 FVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGLCFITFKEEEPVKKIMEKKY 223

Query: 435 RTIGGKEVDVKRATPK 482
             +G  + ++K A  K
Sbjct: 224 HNVGLSKCEIKVAMSK 239



 Score = 59.7 bits (138), Expect = 9e-09
 Identities = 26/100 (26%), Positives = 55/100 (55%)
 Frame = +3

Query: 174 QGHGCW*THHQQQESRPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDK 353
           +GH      H +  +  +E     W+ F+GGLS + +  +++++FS+FG +++  +  D 
Sbjct: 56  EGHSNSSPRHSEAATAQRE----EWKMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDP 111

Query: 354 TKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRA 473
              + +GF F+ F+  + V+ ++   +  + GK +D KRA
Sbjct: 112 ITGRSRGFGFVLFKESESVDKVMDQKEHKLNGKVIDPKRA 151


>D55674-1|BAA09525.1|  355|Homo sapiens heterogeneous nuclear
           ribonucleoprotein D (hnRNP D) protein.
          Length = 355

 Score =  107 bits (256), Expect = 4e-23
 Identities = 45/81 (55%), Positives = 60/81 (74%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+F+GGLSW+TT K+L+D+F  +GE+    +K DP TGRSRGF F++FK  ES+DKVM  
Sbjct: 98  KMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQ 157

Query: 190 GEHTINNKKVDPKKAKARHGK 252
            EH +N K +DPK+AKA   K
Sbjct: 158 KEHKLNGKVIDPKRAKAMKTK 178



 Score = 74.5 bits (175), Expect = 3e-13
 Identities = 32/79 (40%), Positives = 51/79 (64%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +K+FVGGLS +T ++++R++FG +GE+ESI +  D  T + RGF FI FK  E + K+M 
Sbjct: 182 KKIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIME 241

Query: 187 AGEHTINNKKVDPKKAKAR 243
              H +   K + K A ++
Sbjct: 242 KKYHNVGLSKCEIKVAMSK 260



 Score = 71.3 bits (167), Expect = 3e-12
 Identities = 29/76 (38%), Positives = 48/76 (63%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGLS +  +++IR +F  FG +  +E+P D   N+R+GFCFITF+ E+ V  +++   
Sbjct: 185 FVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKY 244

Query: 435 RTIGGKEVDVKRATPK 482
             +G  + ++K A  K
Sbjct: 245 HNVGLSKCEIKVAMSK 260



 Score = 59.7 bits (138), Expect = 9e-09
 Identities = 26/100 (26%), Positives = 55/100 (55%)
 Frame = +3

Query: 174 QGHGCW*THHQQQESRPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDK 353
           +GH      H +  +  +E     W+ F+GGLS + +  +++++FS+FG +++  +  D 
Sbjct: 77  EGHSNSSPRHSEAATAQRE----EWKMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDP 132

Query: 354 TKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRA 473
              + +GF F+ F+  + V+ ++   +  + GK +D KRA
Sbjct: 133 ITGRSRGFGFVLFKESESVDKVMDQKEHKLNGKVIDPKRA 172


>D55673-1|BAA09524.1|  215|Homo sapiens heterogeneous nuclear
           ribonucleoprotein D (hnRNP D) protein.
          Length = 215

 Score =  107 bits (256), Expect = 4e-23
 Identities = 45/81 (55%), Positives = 60/81 (74%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+F+GGLSW+TT K+L+D+F  +GE+    +K DP TGRSRGF F++FK  ES+DKVM  
Sbjct: 7   KMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQ 66

Query: 190 GEHTINNKKVDPKKAKARHGK 252
            EH +N K +DPK+AKA   K
Sbjct: 67  KEHKLNGKVIDPKRAKAMKTK 87



 Score = 74.5 bits (175), Expect = 3e-13
 Identities = 32/79 (40%), Positives = 51/79 (64%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +K+FVGGLS +T ++++R++FG +GE+ESI +  D  T + RGF FI FK  E + K+M 
Sbjct: 91  KKIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIME 150

Query: 187 AGEHTINNKKVDPKKAKAR 243
              H +   K + K A ++
Sbjct: 151 KKYHNVGLSKCEIKVAMSK 169



 Score = 71.3 bits (167), Expect = 3e-12
 Identities = 29/76 (38%), Positives = 48/76 (63%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGLS +  +++IR +F  FG +  +E+P D   N+R+GFCFITF+ E+ V  +++   
Sbjct: 94  FVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKY 153

Query: 435 RTIGGKEVDVKRATPK 482
             +G  + ++K A  K
Sbjct: 154 HNVGLSKCEIKVAMSK 169



 Score = 59.3 bits (137), Expect = 1e-08
 Identities = 22/76 (28%), Positives = 47/76 (61%)
 Frame = +3

Query: 246 WEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLK 425
           W+ F+GGLS + +  +++++FS+FG +++  +  D    + +GF F+ F+  + V+ ++ 
Sbjct: 6   WKMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMD 65

Query: 426 TPKRTIGGKEVDVKRA 473
             +  + GK +D KRA
Sbjct: 66  QKEHKLNGKVIDPKRA 81


>D55672-1|BAA09523.1|  306|Homo sapiens heterogeneous nuclear
           ribonucleoprotein D (hnRNP D) protein.
          Length = 306

 Score =  107 bits (256), Expect = 4e-23
 Identities = 45/81 (55%), Positives = 60/81 (74%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+F+GGLSW+TT K+L+D+F  +GE+    +K DP TGRSRGF F++FK  ES+DKVM  
Sbjct: 98  KMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQ 157

Query: 190 GEHTINNKKVDPKKAKARHGK 252
            EH +N K +DPK+AKA   K
Sbjct: 158 KEHKLNGKVIDPKRAKAMKTK 178



 Score = 74.5 bits (175), Expect = 3e-13
 Identities = 32/79 (40%), Positives = 51/79 (64%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +K+FVGGLS +T ++++R++FG +GE+ESI +  D  T + RGF FI FK  E + K+M 
Sbjct: 182 KKIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIME 241

Query: 187 AGEHTINNKKVDPKKAKAR 243
              H +   K + K A ++
Sbjct: 242 KKYHNVGLSKCEIKVAMSK 260



 Score = 71.3 bits (167), Expect = 3e-12
 Identities = 29/76 (38%), Positives = 48/76 (63%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGLS +  +++IR +F  FG +  +E+P D   N+R+GFCFITF+ E+ V  +++   
Sbjct: 185 FVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKY 244

Query: 435 RTIGGKEVDVKRATPK 482
             +G  + ++K A  K
Sbjct: 245 HNVGLSKCEIKVAMSK 260



 Score = 59.7 bits (138), Expect = 9e-09
 Identities = 26/100 (26%), Positives = 55/100 (55%)
 Frame = +3

Query: 174 QGHGCW*THHQQQESRPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDK 353
           +GH      H +  +  +E     W+ F+GGLS + +  +++++FS+FG +++  +  D 
Sbjct: 77  EGHSNSSPRHSEAATAQRE----EWKMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDP 132

Query: 354 TKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRA 473
              + +GF F+ F+  + V+ ++   +  + GK +D KRA
Sbjct: 133 ITGRSRGFGFVLFKESESVDKVMDQKEHKLNGKVIDPKRA 172


>D55671-1|BAA09522.1|  267|Homo sapiens heterogeneous nuclear
           ribonucleoprotein D (hnRNP D) protein.
          Length = 267

 Score =  107 bits (256), Expect = 4e-23
 Identities = 45/81 (55%), Positives = 60/81 (74%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+F+GGLSW+TT K+L+D+F  +GE+    +K DP TGRSRGF F++FK  ES+DKVM  
Sbjct: 10  KMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQ 69

Query: 190 GEHTINNKKVDPKKAKARHGK 252
            EH +N K +DPK+AKA   K
Sbjct: 70  KEHKLNGKVIDPKRAKAMKTK 90



 Score = 74.5 bits (175), Expect = 3e-13
 Identities = 32/79 (40%), Positives = 51/79 (64%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +K+FVGGLS +T ++++R++FG +GE+ESI +  D  T + RGF FI FK  E + K+M 
Sbjct: 94  KKIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIME 153

Query: 187 AGEHTINNKKVDPKKAKAR 243
              H +   K + K A ++
Sbjct: 154 KKYHNVGLSKCEIKVAMSK 172



 Score = 71.3 bits (167), Expect = 3e-12
 Identities = 29/76 (38%), Positives = 48/76 (63%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGLS +  +++IR +F  FG +  +E+P D   N+R+GFCFITF+ E+ V  +++   
Sbjct: 97  FVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKY 156

Query: 435 RTIGGKEVDVKRATPK 482
             +G  + ++K A  K
Sbjct: 157 HNVGLSKCEIKVAMSK 172



 Score = 55.6 bits (128), Expect = 1e-07
 Identities = 21/73 (28%), Positives = 45/73 (61%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGLS + +  +++++FS+FG +++  +  D    + +GF F+ F+  + V+ ++   +
Sbjct: 12  FIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKE 71

Query: 435 RTIGGKEVDVKRA 473
             + GK +D KRA
Sbjct: 72  HKLNGKVIDPKRA 84


>BC026015-1|AAH26015.1|  306|Homo sapiens heterogeneous nuclear
           ribonucleoprotein D (AU-rich element RNA binding protein
            protein.
          Length = 306

 Score =  107 bits (256), Expect = 4e-23
 Identities = 45/81 (55%), Positives = 60/81 (74%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+F+GGLSW+TT K+L+D+F  +GE+    +K DP TGRSRGF F++FK  ES+DKVM  
Sbjct: 98  KMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQ 157

Query: 190 GEHTINNKKVDPKKAKARHGK 252
            EH +N K +DPK+AKA   K
Sbjct: 158 KEHKLNGKVIDPKRAKAMKTK 178



 Score = 74.5 bits (175), Expect = 3e-13
 Identities = 32/79 (40%), Positives = 51/79 (64%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +K+FVGGLS +T ++++R++FG +GE+ESI +  D  T + RGF FI FK  E + K+M 
Sbjct: 182 KKIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIME 241

Query: 187 AGEHTINNKKVDPKKAKAR 243
              H +   K + K A ++
Sbjct: 242 KKYHNVGLSKCEIKVAMSK 260



 Score = 71.3 bits (167), Expect = 3e-12
 Identities = 29/76 (38%), Positives = 48/76 (63%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGLS +  +++IR +F  FG +  +E+P D   N+R+GFCFITF+ E+ V  +++   
Sbjct: 185 FVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKY 244

Query: 435 RTIGGKEVDVKRATPK 482
             +G  + ++K A  K
Sbjct: 245 HNVGLSKCEIKVAMSK 260



 Score = 59.7 bits (138), Expect = 9e-09
 Identities = 26/100 (26%), Positives = 55/100 (55%)
 Frame = +3

Query: 174 QGHGCW*THHQQQESRPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDK 353
           +GH      H +  +  +E     W+ F+GGLS + +  +++++FS+FG +++  +  D 
Sbjct: 77  EGHSNSSPRHSEAATAQRE----EWKMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDP 132

Query: 354 TKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRA 473
              + +GF F+ F+  + V+ ++   +  + GK +D KRA
Sbjct: 133 ITGRSRGFGFVLFKESESVDKVMDQKEHKLNGKVIDPKRA 172


>BC023977-1|AAH23977.1|  306|Homo sapiens heterogeneous nuclear
           ribonucleoprotein D (AU-rich element RNA binding protein
            protein.
          Length = 306

 Score =  107 bits (256), Expect = 4e-23
 Identities = 45/81 (55%), Positives = 60/81 (74%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+F+GGLSW+TT K+L+D+F  +GE+    +K DP TGRSRGF F++FK  ES+DKVM  
Sbjct: 98  KMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQ 157

Query: 190 GEHTINNKKVDPKKAKARHGK 252
            EH +N K +DPK+AKA   K
Sbjct: 158 KEHKLNGKVIDPKRAKAMKTK 178



 Score = 74.5 bits (175), Expect = 3e-13
 Identities = 32/79 (40%), Positives = 51/79 (64%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +K+FVGGLS +T ++++R++FG +GE+ESI +  D  T + RGF FI FK  E + K+M 
Sbjct: 182 KKIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIME 241

Query: 187 AGEHTINNKKVDPKKAKAR 243
              H +   K + K A ++
Sbjct: 242 KKYHNVGLSKCEIKVAMSK 260



 Score = 71.3 bits (167), Expect = 3e-12
 Identities = 29/76 (38%), Positives = 48/76 (63%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGLS +  +++IR +F  FG +  +E+P D   N+R+GFCFITF+ E+ V  +++   
Sbjct: 185 FVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKY 244

Query: 435 RTIGGKEVDVKRATPK 482
             +G  + ++K A  K
Sbjct: 245 HNVGLSKCEIKVAMSK 260



 Score = 59.7 bits (138), Expect = 9e-09
 Identities = 26/100 (26%), Positives = 55/100 (55%)
 Frame = +3

Query: 174 QGHGCW*THHQQQESRPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDK 353
           +GH      H +  +  +E     W+ F+GGLS + +  +++++FS+FG +++  +  D 
Sbjct: 77  EGHSNSSPRHSEAATAQRE----EWKMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDP 132

Query: 354 TKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRA 473
              + +GF F+ F+  + V+ ++   +  + GK +D KRA
Sbjct: 133 ITGRSRGFGFVLFKESESVDKVMDQKEHKLNGKVIDPKRA 172


>BC002401-1|AAH02401.1|  355|Homo sapiens heterogeneous nuclear
           ribonucleoprotein D (AU-rich element RNA binding protein
            protein.
          Length = 355

 Score =  107 bits (256), Expect = 4e-23
 Identities = 45/81 (55%), Positives = 60/81 (74%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+F+GGLSW+TT K+L+D+F  +GE+    +K DP TGRSRGF F++FK  ES+DKVM  
Sbjct: 98  KMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQ 157

Query: 190 GEHTINNKKVDPKKAKARHGK 252
            EH +N K +DPK+AKA   K
Sbjct: 158 KEHKLNGKVIDPKRAKAMKTK 178



 Score = 74.5 bits (175), Expect = 3e-13
 Identities = 32/79 (40%), Positives = 51/79 (64%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +K+FVGGLS +T ++++R++FG +GE+ESI +  D  T + RGF FI FK  E + K+M 
Sbjct: 182 KKIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIME 241

Query: 187 AGEHTINNKKVDPKKAKAR 243
              H +   K + K A ++
Sbjct: 242 KKYHNVGLSKCEIKVAMSK 260



 Score = 71.3 bits (167), Expect = 3e-12
 Identities = 29/76 (38%), Positives = 48/76 (63%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGLS +  +++IR +F  FG +  +E+P D   N+R+GFCFITF+ E+ V  +++   
Sbjct: 185 FVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKY 244

Query: 435 RTIGGKEVDVKRATPK 482
             +G  + ++K A  K
Sbjct: 245 HNVGLSKCEIKVAMSK 260



 Score = 59.7 bits (138), Expect = 9e-09
 Identities = 26/100 (26%), Positives = 55/100 (55%)
 Frame = +3

Query: 174 QGHGCW*THHQQQESRPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDK 353
           +GH      H +  +  +E     W+ F+GGLS + +  +++++FS+FG +++  +  D 
Sbjct: 77  EGHSNSSPRHSEAATAQRE----EWKMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDP 132

Query: 354 TKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRA 473
              + +GF F+ F+  + V+ ++   +  + GK +D KRA
Sbjct: 133 ITGRSRGFGFVLFKESESVDKVMDQKEHKLNGKVIDPKRA 172


>AF039575-1|AAB96683.1|  298|Homo sapiens heterogeneous nuclear
           ribonucleoprotein D0B protein.
          Length = 298

 Score =  107 bits (256), Expect = 4e-23
 Identities = 45/81 (55%), Positives = 60/81 (74%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+F+GGLSW+TT K+L+D+F  +GE+    +K DP TGRSRGF F++FK  ES+DKVM  
Sbjct: 90  KMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQ 149

Query: 190 GEHTINNKKVDPKKAKARHGK 252
            EH +N K +DPK+AKA   K
Sbjct: 150 KEHKLNGKVIDPKRAKAMKTK 170



 Score = 74.5 bits (175), Expect = 3e-13
 Identities = 32/79 (40%), Positives = 51/79 (64%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +K+FVGGLS +T ++++R++FG +GE+ESI +  D  T + RGF FI FK  E + K+M 
Sbjct: 174 KKIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIME 233

Query: 187 AGEHTINNKKVDPKKAKAR 243
              H +   K + K A ++
Sbjct: 234 KKYHNVGLSKCEIKVAMSK 252



 Score = 71.3 bits (167), Expect = 3e-12
 Identities = 29/76 (38%), Positives = 48/76 (63%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGLS +  +++IR +F  FG +  +E+P D   N+R+GFCFITF+ E+ V  +++   
Sbjct: 177 FVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKY 236

Query: 435 RTIGGKEVDVKRATPK 482
             +G  + ++K A  K
Sbjct: 237 HNVGLSKCEIKVAMSK 252



 Score = 59.7 bits (138), Expect = 9e-09
 Identities = 26/100 (26%), Positives = 55/100 (55%)
 Frame = +3

Query: 174 QGHGCW*THHQQQESRPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDK 353
           +GH      H +  +  +E     W+ F+GGLS + +  +++++FS+FG +++  +  D 
Sbjct: 69  EGHSNSSPRHSEAATAQRE----EWKMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDP 124

Query: 354 TKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRA 473
              + +GF F+ F+  + V+ ++   +  + GK +D KRA
Sbjct: 125 ITGRSRGFGFVLFKESESVDKVMDQKEHKLNGKVIDPKRA 164


>AF026126-3|AAC23476.1|  336|Homo sapiens heterogeneous nuclear
           ribonucleoprotein D protein.
          Length = 336

 Score =  107 bits (256), Expect = 4e-23
 Identities = 45/81 (55%), Positives = 60/81 (74%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+F+GGLSW+TT K+L+D+F  +GE+    +K DP TGRSRGF F++FK  ES+DKVM  
Sbjct: 79  KMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQ 138

Query: 190 GEHTINNKKVDPKKAKARHGK 252
            EH +N K +DPK+AKA   K
Sbjct: 139 KEHKLNGKVIDPKRAKAMKTK 159



 Score = 74.5 bits (175), Expect = 3e-13
 Identities = 32/79 (40%), Positives = 51/79 (64%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +K+FVGGLS +T ++++R++FG +GE+ESI +  D  T + RGF FI FK  E + K+M 
Sbjct: 163 KKIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIME 222

Query: 187 AGEHTINNKKVDPKKAKAR 243
              H +   K + K A ++
Sbjct: 223 KKYHNVGLSKCEIKVAMSK 241



 Score = 71.3 bits (167), Expect = 3e-12
 Identities = 29/76 (38%), Positives = 48/76 (63%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGLS +  +++IR +F  FG +  +E+P D   N+R+GFCFITF+ E+ V  +++   
Sbjct: 166 FVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKY 225

Query: 435 RTIGGKEVDVKRATPK 482
             +G  + ++K A  K
Sbjct: 226 HNVGLSKCEIKVAMSK 241



 Score = 55.6 bits (128), Expect = 1e-07
 Identities = 21/73 (28%), Positives = 45/73 (61%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGLS + +  +++++FS+FG +++  +  D    + +GF F+ F+  + V+ ++   +
Sbjct: 81  FIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKE 140

Query: 435 RTIGGKEVDVKRA 473
             + GK +D KRA
Sbjct: 141 HKLNGKVIDPKRA 153


>AF026126-2|AAC23475.1|  306|Homo sapiens heterogeneous nuclear
           ribonucleoprotein D protein.
          Length = 306

 Score =  107 bits (256), Expect = 4e-23
 Identities = 45/81 (55%), Positives = 60/81 (74%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+F+GGLSW+TT K+L+D+F  +GE+    +K DP TGRSRGF F++FK  ES+DKVM  
Sbjct: 98  KMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQ 157

Query: 190 GEHTINNKKVDPKKAKARHGK 252
            EH +N K +DPK+AKA   K
Sbjct: 158 KEHKLNGKVIDPKRAKAMKTK 178



 Score = 74.5 bits (175), Expect = 3e-13
 Identities = 32/79 (40%), Positives = 51/79 (64%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +K+FVGGLS +T ++++R++FG +GE+ESI +  D  T + RGF FI FK  E + K+M 
Sbjct: 182 KKIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIME 241

Query: 187 AGEHTINNKKVDPKKAKAR 243
              H +   K + K A ++
Sbjct: 242 KKYHNVGLSKCEIKVAMSK 260



 Score = 71.3 bits (167), Expect = 3e-12
 Identities = 29/76 (38%), Positives = 48/76 (63%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGLS +  +++IR +F  FG +  +E+P D   N+R+GFCFITF+ E+ V  +++   
Sbjct: 185 FVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKY 244

Query: 435 RTIGGKEVDVKRATPK 482
             +G  + ++K A  K
Sbjct: 245 HNVGLSKCEIKVAMSK 260



 Score = 59.7 bits (138), Expect = 9e-09
 Identities = 26/100 (26%), Positives = 55/100 (55%)
 Frame = +3

Query: 174 QGHGCW*THHQQQESRPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDK 353
           +GH      H +  +  +E     W+ F+GGLS + +  +++++FS+FG +++  +  D 
Sbjct: 77  EGHSNSSPRHSEAATAQRE----EWKMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDP 132

Query: 354 TKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRA 473
              + +GF F+ F+  + V+ ++   +  + GK +D KRA
Sbjct: 133 ITGRSRGFGFVLFKESESVDKVMDQKEHKLNGKVIDPKRA 172


>AF026126-1|AAC23474.1|  355|Homo sapiens heterogeneous nuclear
           ribonucleoprotein D protein.
          Length = 355

 Score =  107 bits (256), Expect = 4e-23
 Identities = 45/81 (55%), Positives = 60/81 (74%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+F+GGLSW+TT K+L+D+F  +GE+    +K DP TGRSRGF F++FK  ES+DKVM  
Sbjct: 98  KMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQ 157

Query: 190 GEHTINNKKVDPKKAKARHGK 252
            EH +N K +DPK+AKA   K
Sbjct: 158 KEHKLNGKVIDPKRAKAMKTK 178



 Score = 74.5 bits (175), Expect = 3e-13
 Identities = 32/79 (40%), Positives = 51/79 (64%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +K+FVGGLS +T ++++R++FG +GE+ESI +  D  T + RGF FI FK  E + K+M 
Sbjct: 182 KKIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIME 241

Query: 187 AGEHTINNKKVDPKKAKAR 243
              H +   K + K A ++
Sbjct: 242 KKYHNVGLSKCEIKVAMSK 260



 Score = 71.3 bits (167), Expect = 3e-12
 Identities = 29/76 (38%), Positives = 48/76 (63%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGLS +  +++IR +F  FG +  +E+P D   N+R+GFCFITF+ E+ V  +++   
Sbjct: 185 FVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKY 244

Query: 435 RTIGGKEVDVKRATPK 482
             +G  + ++K A  K
Sbjct: 245 HNVGLSKCEIKVAMSK 260



 Score = 59.7 bits (138), Expect = 9e-09
 Identities = 26/100 (26%), Positives = 55/100 (55%)
 Frame = +3

Query: 174 QGHGCW*THHQQQESRPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDK 353
           +GH      H +  +  +E     W+ F+GGLS + +  +++++FS+FG +++  +  D 
Sbjct: 77  EGHSNSSPRHSEAATAQRE----EWKMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDP 132

Query: 354 TKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRA 473
              + +GF F+ F+  + V+ ++   +  + GK +D KRA
Sbjct: 133 ITGRSRGFGFVLFKESESVDKVMDQKEHKLNGKVIDPKRA 172


>AC124016-1|AAY40913.1|  355|Homo sapiens unknown protein.
          Length = 355

 Score =  107 bits (256), Expect = 4e-23
 Identities = 45/81 (55%), Positives = 60/81 (74%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+F+GGLSW+TT K+L+D+F  +GE+    +K DP TGRSRGF F++FK  ES+DKVM  
Sbjct: 98  KMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQ 157

Query: 190 GEHTINNKKVDPKKAKARHGK 252
            EH +N K +DPK+AKA   K
Sbjct: 158 KEHKLNGKVIDPKRAKAMKTK 178



 Score = 74.5 bits (175), Expect = 3e-13
 Identities = 32/79 (40%), Positives = 51/79 (64%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +K+FVGGLS +T ++++R++FG +GE+ESI +  D  T + RGF FI FK  E + K+M 
Sbjct: 182 KKIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIME 241

Query: 187 AGEHTINNKKVDPKKAKAR 243
              H +   K + K A ++
Sbjct: 242 KKYHNVGLSKCEIKVAMSK 260



 Score = 71.3 bits (167), Expect = 3e-12
 Identities = 29/76 (38%), Positives = 48/76 (63%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGLS +  +++IR +F  FG +  +E+P D   N+R+GFCFITF+ E+ V  +++   
Sbjct: 185 FVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKY 244

Query: 435 RTIGGKEVDVKRATPK 482
             +G  + ++K A  K
Sbjct: 245 HNVGLSKCEIKVAMSK 260



 Score = 59.7 bits (138), Expect = 9e-09
 Identities = 26/100 (26%), Positives = 55/100 (55%)
 Frame = +3

Query: 174 QGHGCW*THHQQQESRPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDK 353
           +GH      H +  +  +E     W+ F+GGLS + +  +++++FS+FG +++  +  D 
Sbjct: 77  EGHSNSSPRHSEAATAQRE----EWKMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDP 132

Query: 354 TKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRA 473
              + +GF F+ F+  + V+ ++   +  + GK +D KRA
Sbjct: 133 ITGRSRGFGFVLFKESESVDKVMDQKEHKLNGKVIDPKRA 172


>D89092-1|BAA24361.1|  301|Homo sapiens hnRNP JKTBP protein.
          Length = 301

 Score =  100 bits (240), Expect = 4e-21
 Identities = 41/81 (50%), Positives = 59/81 (72%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+F+GGLSW+T+ K+L ++   +GE+    +KTDP TGRSRGF F++FK   S+DKV+  
Sbjct: 30  KMFIGGLSWDTSKKDLTEYLSRFGEVVDCTIKTDPVTGRSRGFGFVLFKDAASVDKVLEL 89

Query: 190 GEHTINNKKVDPKKAKARHGK 252
            EH ++ K +DPK+AKA  GK
Sbjct: 90  KEHKLDGKLIDPKRAKALKGK 110



 Score = 77.4 bits (182), Expect = 4e-14
 Identities = 33/76 (43%), Positives = 50/76 (65%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGLS + S+++I+ +F  FG I  +E+P D   N+R+GFCFIT+  E+ V  LL++  
Sbjct: 117 FVGGLSPDTSEEQIKEYFGAFGEIENIELPMDTKTNERRGFCFITYTDEEPVKKLLESRY 176

Query: 435 RTIGGKEVDVKRATPK 482
             IG  + ++K A PK
Sbjct: 177 HQIGSGKCEIKVAQPK 192



 Score = 70.1 bits (164), Expect = 6e-12
 Identities = 30/79 (37%), Positives = 53/79 (67%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +K+FVGGLS +T++++++++FGA+GEIE+I +  D  T   RGF FI +   E + K++ 
Sbjct: 114 KKVFVGGLSPDTSEEQIKEYFGAFGEIENIELPMDTKTNERRGFCFITYTDEEPVKKLLE 173

Query: 187 AGEHTINNKKVDPKKAKAR 243
           +  H I + K + K A+ +
Sbjct: 174 SRYHQIGSGKCEIKVAQPK 192



 Score = 50.8 bits (116), Expect = 4e-06
 Identities = 22/73 (30%), Positives = 41/73 (56%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGLS + S  ++  + S FG +++  +  D    + +GF F+ F+    V+ +L+  +
Sbjct: 32  FIGGLSWDTSKKDLTEYLSRFGEVVDCTIKTDPVTGRSRGFGFVLFKDAASVDKVLELKE 91

Query: 435 RTIGGKEVDVKRA 473
             + GK +D KRA
Sbjct: 92  HKLDGKLIDPKRA 104


>CR407623-1|CAG28551.1|  420|Homo sapiens HNRPDL protein.
          Length = 420

 Score =  100 bits (240), Expect = 4e-21
 Identities = 41/81 (50%), Positives = 59/81 (72%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+F+GGLSW+T+ K+L ++   +GE+    +KTDP TGRSRGF F++FK   S+DKV+  
Sbjct: 149 KMFIGGLSWDTSKKDLTEYLSRFGEVVDCTIKTDPVTGRSRGFGFVLFKDAASVDKVLEL 208

Query: 190 GEHTINNKKVDPKKAKARHGK 252
            EH ++ K +DPK+AKA  GK
Sbjct: 209 KEHKLDGKLIDPKRAKALKGK 229



 Score = 77.4 bits (182), Expect = 4e-14
 Identities = 33/76 (43%), Positives = 50/76 (65%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGLS + S+++I+ +F  FG I  +E+P D   N+R+GFCFIT+  E+ V  LL++  
Sbjct: 236 FVGGLSPDTSEEQIKEYFGAFGEIENIELPMDTKTNERRGFCFITYTDEEPVKKLLESRY 295

Query: 435 RTIGGKEVDVKRATPK 482
             IG  + ++K A PK
Sbjct: 296 HQIGSGKCEIKVAQPK 311



 Score = 70.1 bits (164), Expect = 6e-12
 Identities = 30/79 (37%), Positives = 53/79 (67%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +K+FVGGLS +T++++++++FGA+GEIE+I +  D  T   RGF FI +   E + K++ 
Sbjct: 233 KKVFVGGLSPDTSEEQIKEYFGAFGEIENIELPMDTKTNERRGFCFITYTDEEPVKKLLE 292

Query: 187 AGEHTINNKKVDPKKAKAR 243
           +  H I + K + K A+ +
Sbjct: 293 SRYHQIGSGKCEIKVAQPK 311



 Score = 50.8 bits (116), Expect = 4e-06
 Identities = 22/73 (30%), Positives = 41/73 (56%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGLS + S  ++  + S FG +++  +  D    + +GF F+ F+    V+ +L+  +
Sbjct: 151 FIGGLSWDTSKKDLTEYLSRFGEVVDCTIKTDPVTGRSRGFGFVLFKDAASVDKVLELKE 210

Query: 435 RTIGGKEVDVKRA 473
             + GK +D KRA
Sbjct: 211 HKLDGKLIDPKRA 223


>BC071944-1|AAH71944.1|  420|Homo sapiens heterogeneous nuclear
           ribonucleoprotein D-like protein.
          Length = 420

 Score =  100 bits (240), Expect = 4e-21
 Identities = 41/81 (50%), Positives = 59/81 (72%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+F+GGLSW+T+ K+L ++   +GE+    +KTDP TGRSRGF F++FK   S+DKV+  
Sbjct: 149 KMFIGGLSWDTSKKDLTEYLSRFGEVVDCTIKTDPVTGRSRGFGFVLFKDAASVDKVLEL 208

Query: 190 GEHTINNKKVDPKKAKARHGK 252
            EH ++ K +DPK+AKA  GK
Sbjct: 209 KEHKLDGKLIDPKRAKALKGK 229



 Score = 77.4 bits (182), Expect = 4e-14
 Identities = 33/76 (43%), Positives = 50/76 (65%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGLS + S+++I+ +F  FG I  +E+P D   N+R+GFCFIT+  E+ V  LL++  
Sbjct: 236 FVGGLSPDTSEEQIKEYFGAFGEIENIELPMDTKTNERRGFCFITYTDEEPVKKLLESRY 295

Query: 435 RTIGGKEVDVKRATPK 482
             IG  + ++K A PK
Sbjct: 296 HQIGSGKCEIKVAQPK 311



 Score = 70.1 bits (164), Expect = 6e-12
 Identities = 30/79 (37%), Positives = 53/79 (67%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +K+FVGGLS +T++++++++FGA+GEIE+I +  D  T   RGF FI +   E + K++ 
Sbjct: 233 KKVFVGGLSPDTSEEQIKEYFGAFGEIENIELPMDTKTNERRGFCFITYTDEEPVKKLLE 292

Query: 187 AGEHTINNKKVDPKKAKAR 243
           +  H I + K + K A+ +
Sbjct: 293 SRYHQIGSGKCEIKVAQPK 311



 Score = 50.8 bits (116), Expect = 4e-06
 Identities = 22/73 (30%), Positives = 41/73 (56%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGLS + S  ++  + S FG +++  +  D    + +GF F+ F+    V+ +L+  +
Sbjct: 151 FIGGLSWDTSKKDLTEYLSRFGEVVDCTIKTDPVTGRSRGFGFVLFKDAASVDKVLELKE 210

Query: 435 RTIGGKEVDVKRA 473
             + GK +D KRA
Sbjct: 211 HKLDGKLIDPKRA 223


>BC011714-1|AAH11714.1|  420|Homo sapiens heterogeneous nuclear
           ribonucleoprotein D-like protein.
          Length = 420

 Score =  100 bits (240), Expect = 4e-21
 Identities = 41/81 (50%), Positives = 59/81 (72%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+F+GGLSW+T+ K+L ++   +GE+    +KTDP TGRSRGF F++FK   S+DKV+  
Sbjct: 149 KMFIGGLSWDTSKKDLTEYLSRFGEVVDCTIKTDPVTGRSRGFGFVLFKDAASVDKVLEL 208

Query: 190 GEHTINNKKVDPKKAKARHGK 252
            EH ++ K +DPK+AKA  GK
Sbjct: 209 KEHKLDGKLIDPKRAKALKGK 229



 Score = 77.4 bits (182), Expect = 4e-14
 Identities = 33/76 (43%), Positives = 50/76 (65%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGLS + S+++I+ +F  FG I  +E+P D   N+R+GFCFIT+  E+ V  LL++  
Sbjct: 236 FVGGLSPDTSEEQIKEYFGAFGEIENIELPMDTKTNERRGFCFITYTDEEPVKKLLESRY 295

Query: 435 RTIGGKEVDVKRATPK 482
             IG  + ++K A PK
Sbjct: 296 HQIGSGKCEIKVAQPK 311



 Score = 70.1 bits (164), Expect = 6e-12
 Identities = 30/79 (37%), Positives = 53/79 (67%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +K+FVGGLS +T++++++++FGA+GEIE+I +  D  T   RGF FI +   E + K++ 
Sbjct: 233 KKVFVGGLSPDTSEEQIKEYFGAFGEIENIELPMDTKTNERRGFCFITYTDEEPVKKLLE 292

Query: 187 AGEHTINNKKVDPKKAKAR 243
           +  H I + K + K A+ +
Sbjct: 293 SRYHQIGSGKCEIKVAQPK 311



 Score = 50.8 bits (116), Expect = 4e-06
 Identities = 22/73 (30%), Positives = 41/73 (56%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGLS + S  ++  + S FG +++  +  D    + +GF F+ F+    V+ +L+  +
Sbjct: 151 FIGGLSWDTSKKDLTEYLSRFGEVVDCTIKTDPVTGRSRGFGFVLFKDAASVDKVLELKE 210

Query: 435 RTIGGKEVDVKRA 473
             + GK +D KRA
Sbjct: 211 HKLDGKLIDPKRA 223


>BC007392-1|AAH07392.2|  415|Homo sapiens HNRPDL protein protein.
          Length = 415

 Score =  100 bits (240), Expect = 4e-21
 Identities = 41/81 (50%), Positives = 59/81 (72%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+F+GGLSW+T+ K+L ++   +GE+    +KTDP TGRSRGF F++FK   S+DKV+  
Sbjct: 144 KMFIGGLSWDTSKKDLTEYLSRFGEVVDCTIKTDPVTGRSRGFGFVLFKDAASVDKVLEL 203

Query: 190 GEHTINNKKVDPKKAKARHGK 252
            EH ++ K +DPK+AKA  GK
Sbjct: 204 KEHKLDGKLIDPKRAKALKGK 224



 Score = 77.4 bits (182), Expect = 4e-14
 Identities = 33/76 (43%), Positives = 50/76 (65%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGLS + S+++I+ +F  FG I  +E+P D   N+R+GFCFIT+  E+ V  LL++  
Sbjct: 231 FVGGLSPDTSEEQIKEYFGAFGEIENIELPMDTKTNERRGFCFITYTDEEPVKKLLESRY 290

Query: 435 RTIGGKEVDVKRATPK 482
             IG  + ++K A PK
Sbjct: 291 HQIGSGKCEIKVAQPK 306



 Score = 70.1 bits (164), Expect = 6e-12
 Identities = 30/79 (37%), Positives = 53/79 (67%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +K+FVGGLS +T++++++++FGA+GEIE+I +  D  T   RGF FI +   E + K++ 
Sbjct: 228 KKVFVGGLSPDTSEEQIKEYFGAFGEIENIELPMDTKTNERRGFCFITYTDEEPVKKLLE 287

Query: 187 AGEHTINNKKVDPKKAKAR 243
           +  H I + K + K A+ +
Sbjct: 288 SRYHQIGSGKCEIKVAQPK 306



 Score = 50.8 bits (116), Expect = 4e-06
 Identities = 22/73 (30%), Positives = 41/73 (56%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGLS + S  ++  + S FG +++  +  D    + +GF F+ F+    V+ +L+  +
Sbjct: 146 FIGGLSWDTSKKDLTEYLSRFGEVVDCTIKTDPVTGRSRGFGFVLFKDAASVDKVLELKE 205

Query: 435 RTIGGKEVDVKRA 473
             + GK +D KRA
Sbjct: 206 HKLDGKLIDPKRA 218


>AY453824-1|AAR17782.1|  298|Homo sapiens CArG binding factor
           protein.
          Length = 298

 Score =  100 bits (240), Expect = 4e-21
 Identities = 41/81 (50%), Positives = 59/81 (72%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+F+GGLSW+T+ K+L ++   +GE+    +KTDP TGRSRGF F++FK   S+DKV+  
Sbjct: 27  KMFIGGLSWDTSKKDLTEYLSRFGEVVDCTIKTDPVTGRSRGFGFVLFKDAASVDKVLEL 86

Query: 190 GEHTINNKKVDPKKAKARHGK 252
            EH ++ K +DPK+AKA  GK
Sbjct: 87  KEHKLDGKLIDPKRAKALKGK 107



 Score = 77.4 bits (182), Expect = 4e-14
 Identities = 33/76 (43%), Positives = 50/76 (65%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGLS + S+++I+ +F  FG I  +E+P D   N+R+GFCFIT+  E+ V  LL++  
Sbjct: 114 FVGGLSPDTSEEQIKEYFGAFGEIENIELPMDTKTNERRGFCFITYTDEEPVKKLLESRY 173

Query: 435 RTIGGKEVDVKRATPK 482
             IG  + ++K A PK
Sbjct: 174 HQIGSGKCEIKVAQPK 189



 Score = 70.1 bits (164), Expect = 6e-12
 Identities = 30/79 (37%), Positives = 53/79 (67%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +K+FVGGLS +T++++++++FGA+GEIE+I +  D  T   RGF FI +   E + K++ 
Sbjct: 111 KKVFVGGLSPDTSEEQIKEYFGAFGEIENIELPMDTKTNERRGFCFITYTDEEPVKKLLE 170

Query: 187 AGEHTINNKKVDPKKAKAR 243
           +  H I + K + K A+ +
Sbjct: 171 SRYHQIGSGKCEIKVAQPK 189



 Score = 50.8 bits (116), Expect = 4e-06
 Identities = 22/73 (30%), Positives = 41/73 (56%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGLS + S  ++  + S FG +++  +  D    + +GF F+ F+    V+ +L+  +
Sbjct: 29  FIGGLSWDTSKKDLTEYLSRFGEVVDCTIKTDPVTGRSRGFGFVLFKDAASVDKVLELKE 88

Query: 435 RTIGGKEVDVKRA 473
             + GK +D KRA
Sbjct: 89  HKLDGKLIDPKRA 101


>AC124016-2|AAY40914.1|  420|Homo sapiens unknown protein.
          Length = 420

 Score =  100 bits (240), Expect = 4e-21
 Identities = 41/81 (50%), Positives = 59/81 (72%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+F+GGLSW+T+ K+L ++   +GE+    +KTDP TGRSRGF F++FK   S+DKV+  
Sbjct: 149 KMFIGGLSWDTSKKDLTEYLSRFGEVVDCTIKTDPVTGRSRGFGFVLFKDAASVDKVLEL 208

Query: 190 GEHTINNKKVDPKKAKARHGK 252
            EH ++ K +DPK+AKA  GK
Sbjct: 209 KEHKLDGKLIDPKRAKALKGK 229



 Score = 77.4 bits (182), Expect = 4e-14
 Identities = 33/76 (43%), Positives = 50/76 (65%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGLS + S+++I+ +F  FG I  +E+P D   N+R+GFCFIT+  E+ V  LL++  
Sbjct: 236 FVGGLSPDTSEEQIKEYFGAFGEIENIELPMDTKTNERRGFCFITYTDEEPVKKLLESRY 295

Query: 435 RTIGGKEVDVKRATPK 482
             IG  + ++K A PK
Sbjct: 296 HQIGSGKCEIKVAQPK 311



 Score = 70.1 bits (164), Expect = 6e-12
 Identities = 30/79 (37%), Positives = 53/79 (67%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +K+FVGGLS +T++++++++FGA+GEIE+I +  D  T   RGF FI +   E + K++ 
Sbjct: 233 KKVFVGGLSPDTSEEQIKEYFGAFGEIENIELPMDTKTNERRGFCFITYTDEEPVKKLLE 292

Query: 187 AGEHTINNKKVDPKKAKAR 243
           +  H I + K + K A+ +
Sbjct: 293 SRYHQIGSGKCEIKVAQPK 311



 Score = 50.8 bits (116), Expect = 4e-06
 Identities = 22/73 (30%), Positives = 41/73 (56%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGLS + S  ++  + S FG +++  +  D    + +GF F+ F+    V+ +L+  +
Sbjct: 151 FIGGLSWDTSKKDLTEYLSRFGEVVDCTIKTDPVTGRSRGFGFVLFKDAASVDKVLELKE 210

Query: 435 RTIGGKEVDVKRA 473
             + GK +D KRA
Sbjct: 211 HKLDGKLIDPKRA 223


>AB066484-1|BAB62188.1|  244|Homo sapiens JKTBP1delta6 protein.
          Length = 244

 Score =  100 bits (240), Expect = 4e-21
 Identities = 41/81 (50%), Positives = 59/81 (72%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+F+GGLSW+T+ K+L ++   +GE+    +KTDP TGRSRGF F++FK   S+DKV+  
Sbjct: 30  KMFIGGLSWDTSKKDLTEYLSRFGEVVDCTIKTDPVTGRSRGFGFVLFKDAASVDKVLEL 89

Query: 190 GEHTINNKKVDPKKAKARHGK 252
            EH ++ K +DPK+AKA  GK
Sbjct: 90  KEHKLDGKLIDPKRAKALKGK 110



 Score = 77.4 bits (182), Expect = 4e-14
 Identities = 33/76 (43%), Positives = 50/76 (65%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGLS + S+++I+ +F  FG I  +E+P D   N+R+GFCFIT+  E+ V  LL++  
Sbjct: 117 FVGGLSPDTSEEQIKEYFGAFGEIENIELPMDTKTNERRGFCFITYTDEEPVKKLLESRY 176

Query: 435 RTIGGKEVDVKRATPK 482
             IG  + ++K A PK
Sbjct: 177 HQIGSGKCEIKVAQPK 192



 Score = 70.1 bits (164), Expect = 6e-12
 Identities = 30/79 (37%), Positives = 53/79 (67%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +K+FVGGLS +T++++++++FGA+GEIE+I +  D  T   RGF FI +   E + K++ 
Sbjct: 114 KKVFVGGLSPDTSEEQIKEYFGAFGEIENIELPMDTKTNERRGFCFITYTDEEPVKKLLE 173

Query: 187 AGEHTINNKKVDPKKAKAR 243
           +  H I + K + K A+ +
Sbjct: 174 SRYHQIGSGKCEIKVAQPK 192



 Score = 50.8 bits (116), Expect = 4e-06
 Identities = 22/73 (30%), Positives = 41/73 (56%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGLS + S  ++  + S FG +++  +  D    + +GF F+ F+    V+ +L+  +
Sbjct: 32  FIGGLSWDTSKKDLTEYLSRFGEVVDCTIKTDPVTGRSRGFGFVLFKDAASVDKVLELKE 91

Query: 435 RTIGGKEVDVKRA 473
             + GK +D KRA
Sbjct: 92  HKLDGKLIDPKRA 104


>AB017019-1|BAA75241.1|  420|Homo sapiens JKTBP2 protein.
          Length = 420

 Score =  100 bits (240), Expect = 4e-21
 Identities = 41/81 (50%), Positives = 59/81 (72%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+F+GGLSW+T+ K+L ++   +GE+    +KTDP TGRSRGF F++FK   S+DKV+  
Sbjct: 149 KMFIGGLSWDTSKKDLTEYLSRFGEVVDCTIKTDPVTGRSRGFGFVLFKDAASVDKVLEL 208

Query: 190 GEHTINNKKVDPKKAKARHGK 252
            EH ++ K +DPK+AKA  GK
Sbjct: 209 KEHKLDGKLIDPKRAKALKGK 229



 Score = 77.4 bits (182), Expect = 4e-14
 Identities = 33/76 (43%), Positives = 50/76 (65%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGLS + S+++I+ +F  FG I  +E+P D   N+R+GFCFIT+  E+ V  LL++  
Sbjct: 236 FVGGLSPDTSEEQIKEYFGAFGEIENIELPMDTKTNERRGFCFITYTDEEPVKKLLESRY 295

Query: 435 RTIGGKEVDVKRATPK 482
             IG  + ++K A PK
Sbjct: 296 HQIGSGKCEIKVAQPK 311



 Score = 70.1 bits (164), Expect = 6e-12
 Identities = 30/79 (37%), Positives = 53/79 (67%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +K+FVGGLS +T++++++++FGA+GEIE+I +  D  T   RGF FI +   E + K++ 
Sbjct: 233 KKVFVGGLSPDTSEEQIKEYFGAFGEIENIELPMDTKTNERRGFCFITYTDEEPVKKLLE 292

Query: 187 AGEHTINNKKVDPKKAKAR 243
           +  H I + K + K A+ +
Sbjct: 293 SRYHQIGSGKCEIKVAQPK 311



 Score = 50.8 bits (116), Expect = 4e-06
 Identities = 22/73 (30%), Positives = 41/73 (56%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGLS + S  ++  + S FG +++  +  D    + +GF F+ F+    V+ +L+  +
Sbjct: 151 FIGGLSWDTSKKDLTEYLSRFGEVVDCTIKTDPVTGRSRGFGFVLFKDAASVDKVLELKE 210

Query: 435 RTIGGKEVDVKRA 473
             + GK +D KRA
Sbjct: 211 HKLDGKLIDPKRA 223


>AB017018-2|BAA75240.1|  301|Homo sapiens JKTBP1 protein.
          Length = 301

 Score =  100 bits (240), Expect = 4e-21
 Identities = 41/81 (50%), Positives = 59/81 (72%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+F+GGLSW+T+ K+L ++   +GE+    +KTDP TGRSRGF F++FK   S+DKV+  
Sbjct: 30  KMFIGGLSWDTSKKDLTEYLSRFGEVVDCTIKTDPVTGRSRGFGFVLFKDAASVDKVLEL 89

Query: 190 GEHTINNKKVDPKKAKARHGK 252
            EH ++ K +DPK+AKA  GK
Sbjct: 90  KEHKLDGKLIDPKRAKALKGK 110



 Score = 77.4 bits (182), Expect = 4e-14
 Identities = 33/76 (43%), Positives = 50/76 (65%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGLS + S+++I+ +F  FG I  +E+P D   N+R+GFCFIT+  E+ V  LL++  
Sbjct: 117 FVGGLSPDTSEEQIKEYFGAFGEIENIELPMDTKTNERRGFCFITYTDEEPVKKLLESRY 176

Query: 435 RTIGGKEVDVKRATPK 482
             IG  + ++K A PK
Sbjct: 177 HQIGSGKCEIKVAQPK 192



 Score = 70.1 bits (164), Expect = 6e-12
 Identities = 30/79 (37%), Positives = 53/79 (67%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +K+FVGGLS +T++++++++FGA+GEIE+I +  D  T   RGF FI +   E + K++ 
Sbjct: 114 KKVFVGGLSPDTSEEQIKEYFGAFGEIENIELPMDTKTNERRGFCFITYTDEEPVKKLLE 173

Query: 187 AGEHTINNKKVDPKKAKAR 243
           +  H I + K + K A+ +
Sbjct: 174 SRYHQIGSGKCEIKVAQPK 192



 Score = 50.8 bits (116), Expect = 4e-06
 Identities = 22/73 (30%), Positives = 41/73 (56%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGLS + S  ++  + S FG +++  +  D    + +GF F+ F+    V+ +L+  +
Sbjct: 32  FIGGLSWDTSKKDLTEYLSRFGEVVDCTIKTDPVTGRSRGFGFVLFKDAASVDKVLELKE 91

Query: 435 RTIGGKEVDVKRA 473
             + GK +D KRA
Sbjct: 92  HKLDGKLIDPKRA 104


>AB017018-1|BAA75239.1|  420|Homo sapiens JKTBP2 protein.
          Length = 420

 Score =  100 bits (240), Expect = 4e-21
 Identities = 41/81 (50%), Positives = 59/81 (72%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+F+GGLSW+T+ K+L ++   +GE+    +KTDP TGRSRGF F++FK   S+DKV+  
Sbjct: 149 KMFIGGLSWDTSKKDLTEYLSRFGEVVDCTIKTDPVTGRSRGFGFVLFKDAASVDKVLEL 208

Query: 190 GEHTINNKKVDPKKAKARHGK 252
            EH ++ K +DPK+AKA  GK
Sbjct: 209 KEHKLDGKLIDPKRAKALKGK 229



 Score = 77.4 bits (182), Expect = 4e-14
 Identities = 33/76 (43%), Positives = 50/76 (65%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGLS + S+++I+ +F  FG I  +E+P D   N+R+GFCFIT+  E+ V  LL++  
Sbjct: 236 FVGGLSPDTSEEQIKEYFGAFGEIENIELPMDTKTNERRGFCFITYTDEEPVKKLLESRY 295

Query: 435 RTIGGKEVDVKRATPK 482
             IG  + ++K A PK
Sbjct: 296 HQIGSGKCEIKVAQPK 311



 Score = 70.1 bits (164), Expect = 6e-12
 Identities = 30/79 (37%), Positives = 53/79 (67%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +K+FVGGLS +T++++++++FGA+GEIE+I +  D  T   RGF FI +   E + K++ 
Sbjct: 233 KKVFVGGLSPDTSEEQIKEYFGAFGEIENIELPMDTKTNERRGFCFITYTDEEPVKKLLE 292

Query: 187 AGEHTINNKKVDPKKAKAR 243
           +  H I + K + K A+ +
Sbjct: 293 SRYHQIGSGKCEIKVAQPK 311



 Score = 50.8 bits (116), Expect = 4e-06
 Identities = 22/73 (30%), Positives = 41/73 (56%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGLS + S  ++  + S FG +++  +  D    + +GF F+ F+    V+ +L+  +
Sbjct: 151 FIGGLSWDTSKKDLTEYLSRFGEVVDCTIKTDPVTGRSRGFGFVLFKDAASVDKVLELKE 210

Query: 435 RTIGGKEVDVKRA 473
             + GK +D KRA
Sbjct: 211 HKLDGKLIDPKRA 223


>U76713-1|AAC50956.1|  331|Homo sapiens ABBP-1 protein.
          Length = 331

 Score = 99.5 bits (237), Expect = 9e-21
 Identities = 41/77 (53%), Positives = 58/77 (75%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+FVGGLSW+T+ K+L+D+F  +GE+    +K DPNTGRSRGF FI+FK   S++KV+  
Sbjct: 69  KMFVGGLSWDTSKKDLKDYFTKFGEVVDCTIKMDPNTGRSRGFGFILFKDAASVEKVLDQ 128

Query: 190 GEHTINNKKVDPKKAKA 240
            EH ++ + +DPKKA A
Sbjct: 129 KEHRLDGRVIDPKKAMA 145



 Score = 73.3 bits (172), Expect = 6e-13
 Identities = 33/80 (41%), Positives = 54/80 (67%), Gaps = 1/80 (1%)
 Frame = +1

Query: 7   EKLFVGGLSWET-TDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 183
           +K+FVGGL+ E+ T++++R++FG +GEIE+I +  DP   + RGF FI FK  E + KV+
Sbjct: 152 KKIFVGGLNPESPTEEKIREYFGEFGEIEAIELPMDPKLNKRRGFVFITFKEEEPVKKVL 211

Query: 184 AAGEHTINNKKVDPKKAKAR 243
               HT++  K + K A+ +
Sbjct: 212 EKKFHTVSGSKCEIKVAQPK 231



 Score = 72.1 bits (169), Expect = 1e-12
 Identities = 33/77 (42%), Positives = 51/77 (66%), Gaps = 1/77 (1%)
 Frame = +3

Query: 255 FVGGLSSEI-SDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTP 431
           FVGGL+ E  ++++IR +F EFG I  +E+P D   N+R+GF FITF+ E+ V  +L+  
Sbjct: 155 FVGGLNPESPTEEKIREYFGEFGEIEAIELPMDPKLNKRRGFVFITFKEEEPVKKVLEKK 214

Query: 432 KRTIGGKEVDVKRATPK 482
             T+ G + ++K A PK
Sbjct: 215 FHTVSGSKCEIKVAQPK 231



 Score = 52.8 bits (121), Expect = 1e-06
 Identities = 23/80 (28%), Positives = 44/80 (55%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGLS + S  +++++F++FG +++  +  D    + +GF FI F+    V  +L   +
Sbjct: 71  FVGGLSWDTSKKDLKDYFTKFGEVVDCTIKMDPNTGRSRGFGFILFKDAASVEKVLDQKE 130

Query: 435 RTIGGKEVDVKRATPKPDGP 494
             + G+ +D K+A      P
Sbjct: 131 HRLDGRVIDPKKAMAMKKDP 150


>M65028-1|AAA36575.1|  284|Homo sapiens hnRNP type A/B protein
           protein.
          Length = 284

 Score = 99.5 bits (237), Expect = 9e-21
 Identities = 41/77 (53%), Positives = 58/77 (75%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+FVGGLSW+T+ K+L+D+F  +GE+    +K DPNTGRSRGF FI+FK   S++KV+  
Sbjct: 69  KMFVGGLSWDTSKKDLKDYFTKFGEVVDCTIKMDPNTGRSRGFGFILFKDAASVEKVLDQ 128

Query: 190 GEHTINNKKVDPKKAKA 240
            EH ++ + +DPKKA A
Sbjct: 129 KEHRLDGRVIDPKKAMA 145



 Score = 73.3 bits (172), Expect = 6e-13
 Identities = 33/80 (41%), Positives = 54/80 (67%), Gaps = 1/80 (1%)
 Frame = +1

Query: 7   EKLFVGGLSWET-TDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 183
           +K+FVGGL+ E+ T++++R++FG +GEIE+I +  DP   + RGF FI FK  E + KV+
Sbjct: 152 KKIFVGGLNPESPTEEKIREYFGEFGEIEAIELPMDPKLNKRRGFVFITFKEEEPVKKVL 211

Query: 184 AAGEHTINNKKVDPKKAKAR 243
               HT++  K + K A+ +
Sbjct: 212 EKKFHTVSGSKCEIKVAQPK 231



 Score = 72.1 bits (169), Expect = 1e-12
 Identities = 33/77 (42%), Positives = 51/77 (66%), Gaps = 1/77 (1%)
 Frame = +3

Query: 255 FVGGLSSEI-SDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTP 431
           FVGGL+ E  ++++IR +F EFG I  +E+P D   N+R+GF FITF+ E+ V  +L+  
Sbjct: 155 FVGGLNPESPTEEKIREYFGEFGEIEAIELPMDPKLNKRRGFVFITFKEEEPVKKVLEKK 214

Query: 432 KRTIGGKEVDVKRATPK 482
             T+ G + ++K A PK
Sbjct: 215 FHTVSGSKCEIKVAQPK 231



 Score = 52.8 bits (121), Expect = 1e-06
 Identities = 23/80 (28%), Positives = 44/80 (55%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGLS + S  +++++F++FG +++  +  D    + +GF FI F+    V  +L   +
Sbjct: 71  FVGGLSWDTSKKDLKDYFTKFGEVVDCTIKMDPNTGRSRGFGFILFKDAASVEKVLDQKE 130

Query: 435 RTIGGKEVDVKRATPKPDGP 494
             + G+ +D K+A      P
Sbjct: 131 HRLDGRVIDPKKAMAMKKDP 150


>BC036708-1|AAH36708.1|  332|Homo sapiens heterogeneous nuclear
           ribonucleoprotein A/B protein.
          Length = 332

 Score = 99.5 bits (237), Expect = 9e-21
 Identities = 41/77 (53%), Positives = 58/77 (75%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+FVGGLSW+T+ K+L+D+F  +GE+    +K DPNTGRSRGF FI+FK   S++KV+  
Sbjct: 71  KMFVGGLSWDTSKKDLKDYFTKFGEVVDCTIKMDPNTGRSRGFGFILFKDAASVEKVLDQ 130

Query: 190 GEHTINNKKVDPKKAKA 240
            EH ++ + +DPKKA A
Sbjct: 131 KEHRLDGRVIDPKKAMA 147



 Score = 77.4 bits (182), Expect = 4e-14
 Identities = 33/79 (41%), Positives = 53/79 (67%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +K+FVGGL+ E T++++R++FG +GEIE+I +  DP   + RGF FI FK  E + KV+ 
Sbjct: 154 KKIFVGGLNPEATEEKIREYFGEFGEIEAIELPMDPKLNKRRGFVFITFKEEEPVKKVLE 213

Query: 187 AGEHTINNKKVDPKKAKAR 243
              HT++  K + K A+ +
Sbjct: 214 KKFHTVSGSKCEIKVAQPK 232



 Score = 77.0 bits (181), Expect = 5e-14
 Identities = 33/76 (43%), Positives = 51/76 (67%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGL+ E ++++IR +F EFG I  +E+P D   N+R+GF FITF+ E+ V  +L+   
Sbjct: 157 FVGGLNPEATEEKIREYFGEFGEIEAIELPMDPKLNKRRGFVFITFKEEEPVKKVLEKKF 216

Query: 435 RTIGGKEVDVKRATPK 482
            T+ G + ++K A PK
Sbjct: 217 HTVSGSKCEIKVAQPK 232



 Score = 52.8 bits (121), Expect = 1e-06
 Identities = 23/80 (28%), Positives = 44/80 (55%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGLS + S  +++++F++FG +++  +  D    + +GF FI F+    V  +L   +
Sbjct: 73  FVGGLSWDTSKKDLKDYFTKFGEVVDCTIKMDPNTGRSRGFGFILFKDAASVEKVLDQKE 132

Query: 435 RTIGGKEVDVKRATPKPDGP 494
             + G+ +D K+A      P
Sbjct: 133 HRLDGRVIDPKKAMAMKKDP 152


>BC009359-1|AAH09359.1|  285|Homo sapiens heterogeneous nuclear
           ribonucleoprotein A/B protein.
          Length = 285

 Score = 99.5 bits (237), Expect = 9e-21
 Identities = 41/77 (53%), Positives = 58/77 (75%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+FVGGLSW+T+ K+L+D+F  +GE+    +K DPNTGRSRGF FI+FK   S++KV+  
Sbjct: 71  KMFVGGLSWDTSKKDLKDYFTKFGEVVDCTIKMDPNTGRSRGFGFILFKDAASVEKVLDQ 130

Query: 190 GEHTINNKKVDPKKAKA 240
            EH ++ + +DPKKA A
Sbjct: 131 KEHRLDGRVIDPKKAMA 147



 Score = 77.4 bits (182), Expect = 4e-14
 Identities = 33/79 (41%), Positives = 53/79 (67%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +K+FVGGL+ E T++++R++FG +GEIE+I +  DP   + RGF FI FK  E + KV+ 
Sbjct: 154 KKIFVGGLNPEATEEKIREYFGEFGEIEAIELPMDPKLNKRRGFVFITFKEEEPVKKVLE 213

Query: 187 AGEHTINNKKVDPKKAKAR 243
              HT++  K + K A+ +
Sbjct: 214 KKFHTVSGSKCEIKVAQPK 232



 Score = 77.0 bits (181), Expect = 5e-14
 Identities = 33/76 (43%), Positives = 51/76 (67%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGL+ E ++++IR +F EFG I  +E+P D   N+R+GF FITF+ E+ V  +L+   
Sbjct: 157 FVGGLNPEATEEKIREYFGEFGEIEAIELPMDPKLNKRRGFVFITFKEEEPVKKVLEKKF 216

Query: 435 RTIGGKEVDVKRATPK 482
            T+ G + ++K A PK
Sbjct: 217 HTVSGSKCEIKVAQPK 232



 Score = 52.8 bits (121), Expect = 1e-06
 Identities = 23/80 (28%), Positives = 44/80 (55%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGLS + S  +++++F++FG +++  +  D    + +GF FI F+    V  +L   +
Sbjct: 73  FVGGLSWDTSKKDLKDYFTKFGEVVDCTIKMDPNTGRSRGFGFILFKDAASVEKVLDQKE 132

Query: 435 RTIGGKEVDVKRATPKPDGP 494
             + G+ +D K+A      P
Sbjct: 133 HRLDGRVIDPKKAMAMKKDP 152


>BC004561-1|AAH04561.1|  285|Homo sapiens heterogeneous nuclear
           ribonucleoprotein A/B protein.
          Length = 285

 Score = 99.5 bits (237), Expect = 9e-21
 Identities = 41/77 (53%), Positives = 58/77 (75%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+FVGGLSW+T+ K+L+D+F  +GE+    +K DPNTGRSRGF FI+FK   S++KV+  
Sbjct: 71  KMFVGGLSWDTSKKDLKDYFTKFGEVVDCTIKMDPNTGRSRGFGFILFKDAASVEKVLDQ 130

Query: 190 GEHTINNKKVDPKKAKA 240
            EH ++ + +DPKKA A
Sbjct: 131 KEHRLDGRVIDPKKAMA 147



 Score = 77.4 bits (182), Expect = 4e-14
 Identities = 33/79 (41%), Positives = 53/79 (67%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +K+FVGGL+ E T++++R++FG +GEIE+I +  DP   + RGF FI FK  E + KV+ 
Sbjct: 154 KKIFVGGLNPEATEEKIREYFGEFGEIEAIELPMDPKLNKRRGFVFITFKEEEPVKKVLE 213

Query: 187 AGEHTINNKKVDPKKAKAR 243
              HT++  K + K A+ +
Sbjct: 214 KKFHTVSGSKCEIKVAQPK 232



 Score = 77.0 bits (181), Expect = 5e-14
 Identities = 33/76 (43%), Positives = 51/76 (67%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGL+ E ++++IR +F EFG I  +E+P D   N+R+GF FITF+ E+ V  +L+   
Sbjct: 157 FVGGLNPEATEEKIREYFGEFGEIEAIELPMDPKLNKRRGFVFITFKEEEPVKKVLEKKF 216

Query: 435 RTIGGKEVDVKRATPK 482
            T+ G + ++K A PK
Sbjct: 217 HTVSGSKCEIKVAQPK 232



 Score = 52.8 bits (121), Expect = 1e-06
 Identities = 23/80 (28%), Positives = 44/80 (55%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGLS + S  +++++F++FG +++  +  D    + +GF FI F+    V  +L   +
Sbjct: 73  FVGGLSWDTSKKDLKDYFTKFGEVVDCTIKMDPNTGRSRGFGFILFKDAASVEKVLDQKE 132

Query: 435 RTIGGKEVDVKRATPKPDGP 494
             + G+ +D K+A      P
Sbjct: 133 HRLDGRVIDPKKAMAMKKDP 152


>BC002625-1|AAH02625.1|  285|Homo sapiens heterogeneous nuclear
           ribonucleoprotein A/B protein.
          Length = 285

 Score = 99.5 bits (237), Expect = 9e-21
 Identities = 41/77 (53%), Positives = 58/77 (75%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+FVGGLSW+T+ K+L+D+F  +GE+    +K DPNTGRSRGF FI+FK   S++KV+  
Sbjct: 71  KMFVGGLSWDTSKKDLKDYFTKFGEVVDCTIKMDPNTGRSRGFGFILFKDAASVEKVLDQ 130

Query: 190 GEHTINNKKVDPKKAKA 240
            EH ++ + +DPKKA A
Sbjct: 131 KEHRLDGRVIDPKKAMA 147



 Score = 77.4 bits (182), Expect = 4e-14
 Identities = 33/79 (41%), Positives = 53/79 (67%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +K+FVGGL+ E T++++R++FG +GEIE+I +  DP   + RGF FI FK  E + KV+ 
Sbjct: 154 KKIFVGGLNPEATEEKIREYFGEFGEIEAIELPMDPKLNKRRGFVFITFKEEEPVKKVLE 213

Query: 187 AGEHTINNKKVDPKKAKAR 243
              HT++  K + K A+ +
Sbjct: 214 KKFHTVSGSKCEIKVAQPK 232



 Score = 77.0 bits (181), Expect = 5e-14
 Identities = 33/76 (43%), Positives = 51/76 (67%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGL+ E ++++IR +F EFG I  +E+P D   N+R+GF FITF+ E+ V  +L+   
Sbjct: 157 FVGGLNPEATEEKIREYFGEFGEIEAIELPMDPKLNKRRGFVFITFKEEEPVKKVLEKKF 216

Query: 435 RTIGGKEVDVKRATPK 482
            T+ G + ++K A PK
Sbjct: 217 HTVSGSKCEIKVAQPK 232



 Score = 52.8 bits (121), Expect = 1e-06
 Identities = 23/80 (28%), Positives = 44/80 (55%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGLS + S  +++++F++FG +++  +  D    + +GF FI F+    V  +L   +
Sbjct: 73  FVGGLSWDTSKKDLKDYFTKFGEVVDCTIKMDPNTGRSRGFGFILFKDAASVEKVLDQKE 132

Query: 435 RTIGGKEVDVKRATPKPDGP 494
             + G+ +D K+A      P
Sbjct: 133 HRLDGRVIDPKKAMAMKKDP 152


>BC001616-1|AAH01616.1|  285|Homo sapiens heterogeneous nuclear
           ribonucleoprotein A/B protein.
          Length = 285

 Score = 99.5 bits (237), Expect = 9e-21
 Identities = 41/77 (53%), Positives = 58/77 (75%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+FVGGLSW+T+ K+L+D+F  +GE+    +K DPNTGRSRGF FI+FK   S++KV+  
Sbjct: 71  KMFVGGLSWDTSKKDLKDYFTKFGEVVDCTIKMDPNTGRSRGFGFILFKDAASVEKVLDQ 130

Query: 190 GEHTINNKKVDPKKAKA 240
            EH ++ + +DPKKA A
Sbjct: 131 KEHRLDGRVIDPKKAMA 147



 Score = 77.4 bits (182), Expect = 4e-14
 Identities = 33/79 (41%), Positives = 53/79 (67%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +K+FVGGL+ E T++++R++FG +GEIE+I +  DP   + RGF FI FK  E + KV+ 
Sbjct: 154 KKIFVGGLNPEATEEKIREYFGEFGEIEAIELPMDPKLNKRRGFVFITFKEEEPVKKVLE 213

Query: 187 AGEHTINNKKVDPKKAKAR 243
              HT++  K + K A+ +
Sbjct: 214 KKFHTVSGSKCEIKVAQPK 232



 Score = 77.0 bits (181), Expect = 5e-14
 Identities = 33/76 (43%), Positives = 51/76 (67%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGL+ E ++++IR +F EFG I  +E+P D   N+R+GF FITF+ E+ V  +L+   
Sbjct: 157 FVGGLNPEATEEKIREYFGEFGEIEAIELPMDPKLNKRRGFVFITFKEEEPVKKVLEKKF 216

Query: 435 RTIGGKEVDVKRATPK 482
            T+ G + ++K A PK
Sbjct: 217 HTVSGSKCEIKVAQPK 232



 Score = 52.8 bits (121), Expect = 1e-06
 Identities = 23/80 (28%), Positives = 44/80 (55%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGLS + S  +++++F++FG +++  +  D    + +GF FI F+    V  +L   +
Sbjct: 73  FVGGLSWDTSKKDLKDYFTKFGEVVDCTIKMDPNTGRSRGFGFILFKDAASVEKVLDQKE 132

Query: 435 RTIGGKEVDVKRATPKPDGP 494
             + G+ +D K+A      P
Sbjct: 133 HRLDGRVIDPKKAMAMKKDP 152


>AK223425-1|BAD97145.1|  332|Homo sapiens heterogeneous nuclear
           ribonucleoprotein AB isoform a variant protein.
          Length = 332

 Score = 99.5 bits (237), Expect = 9e-21
 Identities = 41/77 (53%), Positives = 58/77 (75%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+FVGGLSW+T+ K+L+D+F  +GE+    +K DPNTGRSRGF FI+FK   S++KV+  
Sbjct: 71  KMFVGGLSWDTSKKDLKDYFTKFGEVVDCTIKMDPNTGRSRGFGFILFKDAASVEKVLDQ 130

Query: 190 GEHTINNKKVDPKKAKA 240
            EH ++ + +DPKKA A
Sbjct: 131 KEHRLDGRVIDPKKAMA 147



 Score = 77.4 bits (182), Expect = 4e-14
 Identities = 33/79 (41%), Positives = 53/79 (67%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +K+FVGGL+ E T++++R++FG +GEIE+I +  DP   + RGF FI FK  E + KV+ 
Sbjct: 154 KKIFVGGLNPEATEEKIREYFGEFGEIEAIELPMDPKLNKRRGFVFITFKEEEPVKKVLE 213

Query: 187 AGEHTINNKKVDPKKAKAR 243
              HT++  K + K A+ +
Sbjct: 214 KKFHTVSGSKCEIKVAQPK 232



 Score = 77.0 bits (181), Expect = 5e-14
 Identities = 33/76 (43%), Positives = 51/76 (67%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGL+ E ++++IR +F EFG I  +E+P D   N+R+GF FITF+ E+ V  +L+   
Sbjct: 157 FVGGLNPEATEEKIREYFGEFGEIEAIELPMDPKLNKRRGFVFITFKEEEPVKKVLEKKF 216

Query: 435 RTIGGKEVDVKRATPK 482
            T+ G + ++K A PK
Sbjct: 217 HTVSGSKCEIKVAQPK 232



 Score = 52.8 bits (121), Expect = 1e-06
 Identities = 23/80 (28%), Positives = 44/80 (55%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGLS + S  +++++F++FG +++  +  D    + +GF FI F+    V  +L   +
Sbjct: 73  FVGGLSWDTSKKDLKDYFTKFGEVVDCTIKMDPNTGRSRGFGFILFKDAASVEKVLDQKE 132

Query: 435 RTIGGKEVDVKRATPKPDGP 494
             + G+ +D K+A      P
Sbjct: 133 HRLDGRVIDPKKAMAMKKDP 152


>AK097657-1|BAC05134.1|  332|Homo sapiens protein ( Homo sapiens
           cDNA FLJ40338 fis, clone TESTI2032067, highly similar to
           Rattus norvegicus mRNA for type A/B hnRNP protein p40.
           ).
          Length = 332

 Score = 99.5 bits (237), Expect = 9e-21
 Identities = 41/77 (53%), Positives = 58/77 (75%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+FVGGLSW+T+ K+L+D+F  +GE+    +K DPNTGRSRGF FI+FK   S++KV+  
Sbjct: 71  KMFVGGLSWDTSKKDLKDYFTKFGEVVDCTIKMDPNTGRSRGFGFILFKDAASVEKVLDQ 130

Query: 190 GEHTINNKKVDPKKAKA 240
            EH ++ + +DPKKA A
Sbjct: 131 KEHRLDGRVIDPKKAMA 147



 Score = 77.4 bits (182), Expect = 4e-14
 Identities = 33/79 (41%), Positives = 53/79 (67%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +K+FVGGL+ E T++++R++FG +GEIE+I +  DP   + RGF FI FK  E + KV+ 
Sbjct: 154 KKIFVGGLNPEATEEKIREYFGEFGEIEAIELPMDPKLNKRRGFVFITFKEEEPVKKVLE 213

Query: 187 AGEHTINNKKVDPKKAKAR 243
              HT++  K + K A+ +
Sbjct: 214 KKFHTVSGSKCEIKVAQPK 232



 Score = 77.0 bits (181), Expect = 5e-14
 Identities = 33/76 (43%), Positives = 51/76 (67%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGL+ E ++++IR +F EFG I  +E+P D   N+R+GF FITF+ E+ V  +L+   
Sbjct: 157 FVGGLNPEATEEKIREYFGEFGEIEAIELPMDPKLNKRRGFVFITFKEEEPVKKVLEKKF 216

Query: 435 RTIGGKEVDVKRATPK 482
            T+ G + ++K A PK
Sbjct: 217 HTVSGSKCEIKVAQPK 232



 Score = 52.8 bits (121), Expect = 1e-06
 Identities = 23/80 (28%), Positives = 44/80 (55%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGLS + S  +++++F++FG +++  +  D    + +GF FI F+    V  +L   +
Sbjct: 73  FVGGLSWDTSKKDLKDYFTKFGEVVDCTIKMDPNTGRSRGFGFILFKDAASVEKVLDQKE 132

Query: 435 RTIGGKEVDVKRATPKPDGP 494
             + G+ +D K+A      P
Sbjct: 133 HRLDGRVIDPKKAMAMKKDP 152


>D89678-1|BAA22860.1|  271|Homo sapiens A+U-rich element RNA binding
           factor protein.
          Length = 271

 Score = 98.7 bits (235), Expect = 2e-20
 Identities = 40/80 (50%), Positives = 58/80 (72%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           +F+GGLSW+T+ K+L ++   +GE+    +KTDP TGRSRGF F++FK   S+DKV+   
Sbjct: 1   MFIGGLSWDTSKKDLTEYLSRFGEVVDCTIKTDPVTGRSRGFGFVLFKDAASVDKVLELK 60

Query: 193 EHTINNKKVDPKKAKARHGK 252
           EH ++ K +DPK+AKA  GK
Sbjct: 61  EHKLDGKLIDPKRAKALKGK 80



 Score = 77.4 bits (182), Expect = 4e-14
 Identities = 33/76 (43%), Positives = 50/76 (65%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGLS + S+++I+ +F  FG I  +E+P D   N+R+GFCFIT+  E+ V  LL++  
Sbjct: 87  FVGGLSPDTSEEQIKEYFGAFGEIENIELPMDTKTNERRGFCFITYTDEEPVKKLLESRY 146

Query: 435 RTIGGKEVDVKRATPK 482
             IG  + ++K A PK
Sbjct: 147 HQIGSGKCEIKVAQPK 162



 Score = 70.1 bits (164), Expect = 6e-12
 Identities = 30/79 (37%), Positives = 53/79 (67%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +K+FVGGLS +T++++++++FGA+GEIE+I +  D  T   RGF FI +   E + K++ 
Sbjct: 84  KKVFVGGLSPDTSEEQIKEYFGAFGEIENIELPMDTKTNERRGFCFITYTDEEPVKKLLE 143

Query: 187 AGEHTINNKKVDPKKAKAR 243
           +  H I + K + K A+ +
Sbjct: 144 SRYHQIGSGKCEIKVAQPK 162



 Score = 50.8 bits (116), Expect = 4e-06
 Identities = 22/73 (30%), Positives = 41/73 (56%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGLS + S  ++  + S FG +++  +  D    + +GF F+ F+    V+ +L+  +
Sbjct: 2   FIGGLSWDTSKKDLTEYLSRFGEVVDCTIKTDPVTGRSRGFGFVLFKDAASVDKVLELKE 61

Query: 435 RTIGGKEVDVKRA 473
             + GK +D KRA
Sbjct: 62  HKLDGKLIDPKRA 74


>BC001526-1|AAH01526.1|  328|Homo sapiens musashi homolog 2
           (Drosophila) protein.
          Length = 328

 Score = 89.8 bits (213), Expect = 7e-18
 Identities = 38/81 (46%), Positives = 52/81 (64%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+F+GGLSW+T+   LRD+F  +GEI    V  DP T RSRGF F+ F  P S+DKV+  
Sbjct: 22  KMFIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFADPASVDKVLGQ 81

Query: 190 GEHTINNKKVDPKKAKARHGK 252
             H +++K +DPK A  R  +
Sbjct: 82  PHHELDSKTIDPKVAFPRRAQ 102



 Score = 68.9 bits (161), Expect = 1e-11
 Identities = 30/76 (39%), Positives = 48/76 (63%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGLS+    ++++ +F +FG + +  + FDKT N+ +GF F+TFE+E VV  + +   
Sbjct: 113 FVGGLSANTVVEDVKQYFEQFGKVEDAMLMFDKTTNRHRGFGFVTFENEDVVEKVCEIHF 172

Query: 435 RTIGGKEVDVKRATPK 482
             I  K V+ K+A PK
Sbjct: 173 HEINNKMVECKKAQPK 188



 Score = 68.5 bits (160), Expect = 2e-11
 Identities = 31/81 (38%), Positives = 50/81 (61%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           R +K+FVGGLS  T  ++++ +F  +G++E   +  D  T R RGF F+ F+  + ++KV
Sbjct: 108 RTKKIFVGGLSANTVVEDVKQYFEQFGKVEDAMLMFDKTTNRHRGFGFVTFENEDVVEKV 167

Query: 181 MAAGEHTINNKKVDPKKAKAR 243
                H INNK V+ KKA+ +
Sbjct: 168 CEIHFHEINNKMVECKKAQPK 188



 Score = 60.9 bits (141), Expect = 4e-09
 Identities = 30/80 (37%), Positives = 45/80 (56%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGLS + S D +R++FS+FG I E  +  D T  + +GF F+TF     V+ +L  P 
Sbjct: 24  FIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFADPASVDKVLGQPH 83

Query: 435 RTIGGKEVDVKRATPKPDGP 494
             +  K +D K A P+   P
Sbjct: 84  HELDSKTIDPKVAFPRRAQP 103


>AK093888-1|BAC04244.1|  251|Homo sapiens protein ( Homo sapiens
           cDNA FLJ36569 fis, clone TRACH2010824, highly similar to
           Ribonucleoprotein. ).
          Length = 251

 Score = 89.8 bits (213), Expect = 7e-18
 Identities = 38/81 (46%), Positives = 52/81 (64%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+F+GGLSW+T+   LRD+F  +GEI    V  DP T RSRGF F+ F  P S+DKV+  
Sbjct: 18  KMFIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFADPASVDKVLGQ 77

Query: 190 GEHTINNKKVDPKKAKARHGK 252
             H +++K +DPK A  R  +
Sbjct: 78  PHHELDSKTIDPKVAFPRRAQ 98



 Score = 68.9 bits (161), Expect = 1e-11
 Identities = 30/76 (39%), Positives = 48/76 (63%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGLS+    ++++ +F +FG + +  + FDKT N+ +GF F+TFE+E VV  + +   
Sbjct: 109 FVGGLSANTVVEDVKQYFEQFGKVEDAMLMFDKTTNRHRGFGFVTFENEDVVEKVCEIHF 168

Query: 435 RTIGGKEVDVKRATPK 482
             I  K V+ K+A PK
Sbjct: 169 HEINNKMVECKKAQPK 184



 Score = 68.5 bits (160), Expect = 2e-11
 Identities = 31/81 (38%), Positives = 50/81 (61%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           R +K+FVGGLS  T  ++++ +F  +G++E   +  D  T R RGF F+ F+  + ++KV
Sbjct: 104 RTKKIFVGGLSANTVVEDVKQYFEQFGKVEDAMLMFDKTTNRHRGFGFVTFENEDVVEKV 163

Query: 181 MAAGEHTINNKKVDPKKAKAR 243
                H INNK V+ KKA+ +
Sbjct: 164 CEIHFHEINNKMVECKKAQPK 184



 Score = 60.9 bits (141), Expect = 4e-09
 Identities = 30/80 (37%), Positives = 45/80 (56%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGLS + S D +R++FS+FG I E  +  D T  + +GF F+TF     V+ +L  P 
Sbjct: 20  FIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFADPASVDKVLGQPH 79

Query: 435 RTIGGKEVDVKRATPKPDGP 494
             +  K +D K A P+   P
Sbjct: 80  HELDSKTIDPKVAFPRRAQP 99


>AC003982-3|AAB95636.1|  362|Homo sapiens WUGSC:H_166H1.2 protein.
          Length = 362

 Score = 88.6 bits (210), Expect = 2e-17
 Identities = 37/81 (45%), Positives = 54/81 (66%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+F+GGLSW+TT + LR++FG +GE++   V  DP T RSRGF F+ F     +DKV+A 
Sbjct: 21  KMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRDPLTKRSRGFGFVTFMDQAGVDKVLAQ 80

Query: 190 GEHTINNKKVDPKKAKARHGK 252
             H +++K +DPK A  R  +
Sbjct: 81  SRHELDSKTIDPKVAFPRRAQ 101



 Score = 70.5 bits (165), Expect = 5e-12
 Identities = 31/81 (38%), Positives = 52/81 (64%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           R +K+FVGGLS  TT ++++ +F  +G+++   +  D  T R RGF F+ F++ + ++KV
Sbjct: 107 RTKKIFVGGLSVNTTVEDVKQYFEQFGKVDDAMLMFDKTTNRHRGFGFVTFESEDIVEKV 166

Query: 181 MAAGEHTINNKKVDPKKAKAR 243
                H INNK V+ KKA+ +
Sbjct: 167 CEIHFHEINNKMVECKKAQPK 187



 Score = 69.3 bits (162), Expect = 1e-11
 Identities = 30/76 (39%), Positives = 48/76 (63%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGLS   + ++++ +F +FG + +  + FDKT N+ +GF F+TFESE +V  + +   
Sbjct: 112 FVGGLSVNTTVEDVKQYFEQFGKVDDAMLMFDKTTNRHRGFGFVTFESEDIVEKVCEIHF 171

Query: 435 RTIGGKEVDVKRATPK 482
             I  K V+ K+A PK
Sbjct: 172 HEINNKMVECKKAQPK 187



 Score = 51.6 bits (118), Expect = 2e-06
 Identities = 24/80 (30%), Positives = 43/80 (53%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGLS + + + +R +F +FG + E  +  D    + +GF F+TF  +  V+ +L   +
Sbjct: 23  FIGGLSWQTTQEGLREYFGQFGEVKECLVMRDPLTKRSRGFGFVTFMDQAGVDKVLAQSR 82

Query: 435 RTIGGKEVDVKRATPKPDGP 494
             +  K +D K A P+   P
Sbjct: 83  HELDSKTIDPKVAFPRRAQP 102


>AB012851-1|BAA33962.1|  362|Homo sapiens Musashi protein.
          Length = 362

 Score = 88.6 bits (210), Expect = 2e-17
 Identities = 37/81 (45%), Positives = 54/81 (66%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+F+GGLSW+TT + LR++FG +GE++   V  DP T RSRGF F+ F     +DKV+A 
Sbjct: 21  KMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRDPLTKRSRGFGFVTFMDQAGVDKVLAQ 80

Query: 190 GEHTINNKKVDPKKAKARHGK 252
             H +++K +DPK A  R  +
Sbjct: 81  SRHELDSKTIDPKVAFPRRAQ 101



 Score = 70.5 bits (165), Expect = 5e-12
 Identities = 31/81 (38%), Positives = 52/81 (64%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           R +K+FVGGLS  TT ++++ +F  +G+++   +  D  T R RGF F+ F++ + ++KV
Sbjct: 107 RTKKIFVGGLSVNTTVEDVKQYFEQFGKVDDAMLMFDKTTNRHRGFGFVTFESEDIVEKV 166

Query: 181 MAAGEHTINNKKVDPKKAKAR 243
                H INNK V+ KKA+ +
Sbjct: 167 CEIHFHEINNKMVECKKAQPK 187



 Score = 69.3 bits (162), Expect = 1e-11
 Identities = 30/76 (39%), Positives = 48/76 (63%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGLS   + ++++ +F +FG + +  + FDKT N+ +GF F+TFESE +V  + +   
Sbjct: 112 FVGGLSVNTTVEDVKQYFEQFGKVDDAMLMFDKTTNRHRGFGFVTFESEDIVEKVCEIHF 171

Query: 435 RTIGGKEVDVKRATPK 482
             I  K V+ K+A PK
Sbjct: 172 HEINNKMVECKKAQPK 187



 Score = 51.6 bits (118), Expect = 2e-06
 Identities = 24/80 (30%), Positives = 43/80 (53%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGLS + + + +R +F +FG + E  +  D    + +GF F+TF  +  V+ +L   +
Sbjct: 23  FIGGLSWQTTQEGLREYFGQFGEVKECLVMRDPLTKRSRGFGFVTFMDQAGVDKVLAQSR 82

Query: 435 RTIGGKEVDVKRATPKPDGP 494
             +  K +D K A P+   P
Sbjct: 83  HELDSKTIDPKVAFPRRAQP 102


>X79536-1|CAA56072.1|  320|Homo sapiens hnRNPcore protein A1
           protein.
          Length = 320

 Score = 84.6 bits (200), Expect = 3e-16
 Identities = 37/78 (47%), Positives = 51/78 (65%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLF+GGLS+ETTD+ LR HF  +G +    V  DPNT RSRGF F+ +   E +D  M A
Sbjct: 15  KLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNA 74

Query: 190 GEHTINNKKVDPKKAKAR 243
             H ++ + V+PK+A +R
Sbjct: 75  RPHKVDGRVVEPKRAVSR 92



 Score = 77.4 bits (182), Expect = 4e-14
 Identities = 32/79 (40%), Positives = 52/79 (65%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +K+FVGG+  +T +  LRD+F  YG+IE I + TD  +G+ RGFAF+ F   +S+DK++ 
Sbjct: 105 KKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVI 164

Query: 187 AGEHTINNKKVDPKKAKAR 243
              HT+N    + +KA ++
Sbjct: 165 QKYHTVNGHNCEVRKALSK 183



 Score = 56.4 bits (130), Expect = 8e-08
 Identities = 21/78 (26%), Positives = 45/78 (57%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGG+  +  +  +R++F ++G I  +E+  D+   +++GF F+TF+    V+ ++    
Sbjct: 108 FVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKY 167

Query: 435 RTIGGKEVDVKRATPKPD 488
            T+ G   +V++A  K +
Sbjct: 168 HTVNGHNCEVRKALSKQE 185



 Score = 56.0 bits (129), Expect = 1e-07
 Identities = 26/84 (30%), Positives = 48/84 (57%), Gaps = 2/84 (2%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGLS E +D+ +R+ F ++GT+ +  +  D    + +GF F+T+ + + V+  +    
Sbjct: 17  FIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARP 76

Query: 435 RTIGGKEVDVKRATPKPDG--PGA 500
             + G+ V+ KRA  + D   PGA
Sbjct: 77  HKVDGRVVEPKRAVSREDSQRPGA 100


>X12671-1|CAA31191.1|  320|Homo sapiens hnrnp a1 protein protein.
          Length = 320

 Score = 84.6 bits (200), Expect = 3e-16
 Identities = 37/78 (47%), Positives = 51/78 (65%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLF+GGLS+ETTD+ LR HF  +G +    V  DPNT RSRGF F+ +   E +D  M A
Sbjct: 15  KLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNA 74

Query: 190 GEHTINNKKVDPKKAKAR 243
             H ++ + V+PK+A +R
Sbjct: 75  RPHKVDGRVVEPKRAVSR 92



 Score = 77.4 bits (182), Expect = 4e-14
 Identities = 32/79 (40%), Positives = 52/79 (65%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +K+FVGG+  +T +  LRD+F  YG+IE I + TD  +G+ RGFAF+ F   +S+DK++ 
Sbjct: 105 KKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVI 164

Query: 187 AGEHTINNKKVDPKKAKAR 243
              HT+N    + +KA ++
Sbjct: 165 QKYHTVNGHNCEVRKALSK 183



 Score = 56.4 bits (130), Expect = 8e-08
 Identities = 21/78 (26%), Positives = 45/78 (57%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGG+  +  +  +R++F ++G I  +E+  D+   +++GF F+TF+    V+ ++    
Sbjct: 108 FVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKY 167

Query: 435 RTIGGKEVDVKRATPKPD 488
            T+ G   +V++A  K +
Sbjct: 168 HTVNGHNCEVRKALSKQE 185



 Score = 56.0 bits (129), Expect = 1e-07
 Identities = 26/84 (30%), Positives = 48/84 (57%), Gaps = 2/84 (2%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGLS E +D+ +R+ F ++GT+ +  +  D    + +GF F+T+ + + V+  +    
Sbjct: 17  FIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARP 76

Query: 435 RTIGGKEVDVKRATPKPDG--PGA 500
             + G+ V+ KRA  + D   PGA
Sbjct: 77  HKVDGRVVEPKRAVSREDSQRPGA 100


>X06747-1|CAA29922.1|  320|Homo sapiens protein ( Human hnRNP core
           protein A1. ).
          Length = 320

 Score = 84.6 bits (200), Expect = 3e-16
 Identities = 37/78 (47%), Positives = 51/78 (65%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLF+GGLS+ETTD+ LR HF  +G +    V  DPNT RSRGF F+ +   E +D  M A
Sbjct: 15  KLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNA 74

Query: 190 GEHTINNKKVDPKKAKAR 243
             H ++ + V+PK+A +R
Sbjct: 75  RPHKVDGRVVEPKRAVSR 92



 Score = 74.5 bits (175), Expect = 3e-13
 Identities = 30/79 (37%), Positives = 52/79 (65%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +K+FVGG+  +T +  LRD+F  +G+IE I + TD  +G+ +GFAF+ F   +S+DK++ 
Sbjct: 105 KKIFVGGIKEDTEEHHLRDYFEQFGKIEVIEIMTDRGSGKKKGFAFVTFDDHDSVDKIVI 164

Query: 187 AGEHTINNKKVDPKKAKAR 243
              HT+N    + +KA ++
Sbjct: 165 QKYHTVNGHNCEVRKALSK 183



 Score = 58.8 bits (136), Expect = 1e-08
 Identities = 23/78 (29%), Positives = 45/78 (57%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGG+  +  +  +R++F +FG I  +E+  D+   ++KGF F+TF+    V+ ++    
Sbjct: 108 FVGGIKEDTEEHHLRDYFEQFGKIEVIEIMTDRGSGKKKGFAFVTFDDHDSVDKIVIQKY 167

Query: 435 RTIGGKEVDVKRATPKPD 488
            T+ G   +V++A  K +
Sbjct: 168 HTVNGHNCEVRKALSKQE 185



 Score = 56.0 bits (129), Expect = 1e-07
 Identities = 26/84 (30%), Positives = 48/84 (57%), Gaps = 2/84 (2%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGLS E +D+ +R+ F ++GT+ +  +  D    + +GF F+T+ + + V+  +    
Sbjct: 17  FIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARP 76

Query: 435 RTIGGKEVDVKRATPKPDG--PGA 500
             + G+ V+ KRA  + D   PGA
Sbjct: 77  HKVDGRVVEPKRAVSREDSQRPGA 100


>BC121133-1|AAI21134.1|  320|Homo sapiens heterogeneous nuclear
           ribonucleoprotein A1 protein.
          Length = 320

 Score = 84.6 bits (200), Expect = 3e-16
 Identities = 37/78 (47%), Positives = 51/78 (65%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLF+GGLS+ETTD+ LR HF  +G +    V  DPNT RSRGF F+ +   E +D  M A
Sbjct: 15  KLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNA 74

Query: 190 GEHTINNKKVDPKKAKAR 243
             H ++ + V+PK+A +R
Sbjct: 75  RPHKVDGRVVEPKRAVSR 92



 Score = 77.4 bits (182), Expect = 4e-14
 Identities = 32/79 (40%), Positives = 52/79 (65%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +K+FVGG+  +T +  LRD+F  YG+IE I + TD  +G+ RGFAF+ F   +S+DK++ 
Sbjct: 105 KKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVI 164

Query: 187 AGEHTINNKKVDPKKAKAR 243
              HT+N    + +KA ++
Sbjct: 165 QKYHTVNGHNCEVRKALSK 183



 Score = 56.4 bits (130), Expect = 8e-08
 Identities = 21/78 (26%), Positives = 45/78 (57%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGG+  +  +  +R++F ++G I  +E+  D+   +++GF F+TF+    V+ ++    
Sbjct: 108 FVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKY 167

Query: 435 RTIGGKEVDVKRATPKPD 488
            T+ G   +V++A  K +
Sbjct: 168 HTVNGHNCEVRKALSKQE 185



 Score = 56.0 bits (129), Expect = 1e-07
 Identities = 26/84 (30%), Positives = 48/84 (57%), Gaps = 2/84 (2%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGLS E +D+ +R+ F ++GT+ +  +  D    + +GF F+T+ + + V+  +    
Sbjct: 17  FIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARP 76

Query: 435 RTIGGKEVDVKRATPKPDG--PGA 500
             + G+ V+ KRA  + D   PGA
Sbjct: 77  HKVDGRVVEPKRAVSREDSQRPGA 100


>BC103707-1|AAI03708.1|  267|Homo sapiens HNRPA1 protein protein.
          Length = 267

 Score = 84.6 bits (200), Expect = 3e-16
 Identities = 37/78 (47%), Positives = 51/78 (65%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLF+GGLS+ETTD+ LR HF  +G +    V  DPNT RSRGF F+ +   E +D  M A
Sbjct: 15  KLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNA 74

Query: 190 GEHTINNKKVDPKKAKAR 243
             H ++ + V+PK+A +R
Sbjct: 75  RPHKVDGRVVEPKRAVSR 92



 Score = 77.4 bits (182), Expect = 4e-14
 Identities = 32/79 (40%), Positives = 52/79 (65%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +K+FVGG+  +T +  LRD+F  YG+IE I + TD  +G+ RGFAF+ F   +S+DK++ 
Sbjct: 105 KKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVI 164

Query: 187 AGEHTINNKKVDPKKAKAR 243
              HT+N    + +KA ++
Sbjct: 165 QKYHTVNGHNCEVRKALSK 183



 Score = 56.4 bits (130), Expect = 8e-08
 Identities = 21/78 (26%), Positives = 45/78 (57%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGG+  +  +  +R++F ++G I  +E+  D+   +++GF F+TF+    V+ ++    
Sbjct: 108 FVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKY 167

Query: 435 RTIGGKEVDVKRATPKPD 488
            T+ G   +V++A  K +
Sbjct: 168 HTVNGHNCEVRKALSKQE 185



 Score = 56.0 bits (129), Expect = 1e-07
 Identities = 26/84 (30%), Positives = 48/84 (57%), Gaps = 2/84 (2%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGLS E +D+ +R+ F ++GT+ +  +  D    + +GF F+T+ + + V+  +    
Sbjct: 17  FIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARP 76

Query: 435 RTIGGKEVDVKRATPKPDG--PGA 500
             + G+ V+ KRA  + D   PGA
Sbjct: 77  HKVDGRVVEPKRAVSREDSQRPGA 100


>BC074502-1|AAH74502.1|  320|Homo sapiens heterogeneous nuclear
           ribonucleoprotein A1 protein.
          Length = 320

 Score = 84.6 bits (200), Expect = 3e-16
 Identities = 37/78 (47%), Positives = 51/78 (65%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLF+GGLS+ETTD+ LR HF  +G +    V  DPNT RSRGF F+ +   E +D  M A
Sbjct: 15  KLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNA 74

Query: 190 GEHTINNKKVDPKKAKAR 243
             H ++ + V+PK+A +R
Sbjct: 75  RPHKVDGRVVEPKRAVSR 92



 Score = 77.4 bits (182), Expect = 4e-14
 Identities = 32/79 (40%), Positives = 52/79 (65%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +K+FVGG+  +T +  LRD+F  YG+IE I + TD  +G+ RGFAF+ F   +S+DK++ 
Sbjct: 105 KKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVI 164

Query: 187 AGEHTINNKKVDPKKAKAR 243
              HT+N    + +KA ++
Sbjct: 165 QKYHTVNGHNCEVRKALSK 183



 Score = 56.4 bits (130), Expect = 8e-08
 Identities = 21/78 (26%), Positives = 45/78 (57%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGG+  +  +  +R++F ++G I  +E+  D+   +++GF F+TF+    V+ ++    
Sbjct: 108 FVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKY 167

Query: 435 RTIGGKEVDVKRATPKPD 488
            T+ G   +V++A  K +
Sbjct: 168 HTVNGHNCEVRKALSKQE 185



 Score = 56.0 bits (129), Expect = 1e-07
 Identities = 26/84 (30%), Positives = 48/84 (57%), Gaps = 2/84 (2%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGLS E +D+ +R+ F ++GT+ +  +  D    + +GF F+T+ + + V+  +    
Sbjct: 17  FIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARP 76

Query: 435 RTIGGKEVDVKRATPKPDG--PGA 500
             + G+ V+ KRA  + D   PGA
Sbjct: 77  HKVDGRVVEPKRAVSREDSQRPGA 100


>BC073162-1|AAH73162.1|  320|Homo sapiens heterogeneous nuclear
           ribonucleoprotein A1 protein.
          Length = 320

 Score = 84.6 bits (200), Expect = 3e-16
 Identities = 37/78 (47%), Positives = 51/78 (65%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLF+GGLS+ETTD+ LR HF  +G +    V  DPNT RSRGF F+ +   E +D  M A
Sbjct: 15  KLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNA 74

Query: 190 GEHTINNKKVDPKKAKAR 243
             H ++ + V+PK+A +R
Sbjct: 75  RPHKVDGRVVEPKRAVSR 92



 Score = 77.4 bits (182), Expect = 4e-14
 Identities = 32/79 (40%), Positives = 52/79 (65%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +K+FVGG+  +T +  LRD+F  YG+IE I + TD  +G+ RGFAF+ F   +S+DK++ 
Sbjct: 105 KKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVI 164

Query: 187 AGEHTINNKKVDPKKAKAR 243
              HT+N    + +KA ++
Sbjct: 165 QKYHTVNGHNCEVRKALSK 183



 Score = 56.4 bits (130), Expect = 8e-08
 Identities = 21/78 (26%), Positives = 45/78 (57%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGG+  +  +  +R++F ++G I  +E+  D+   +++GF F+TF+    V+ ++    
Sbjct: 108 FVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKY 167

Query: 435 RTIGGKEVDVKRATPKPD 488
            T+ G   +V++A  K +
Sbjct: 168 HTVNGHNCEVRKALSKQE 185



 Score = 56.0 bits (129), Expect = 1e-07
 Identities = 26/84 (30%), Positives = 48/84 (57%), Gaps = 2/84 (2%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGLS E +D+ +R+ F ++GT+ +  +  D    + +GF F+T+ + + V+  +    
Sbjct: 17  FIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARP 76

Query: 435 RTIGGKEVDVKRATPKPDG--PGA 500
             + G+ V+ KRA  + D   PGA
Sbjct: 77  HKVDGRVVEPKRAVSREDSQRPGA 100


>BC071945-1|AAH71945.1|  320|Homo sapiens heterogeneous nuclear
           ribonucleoprotein A1 protein.
          Length = 320

 Score = 84.6 bits (200), Expect = 3e-16
 Identities = 37/78 (47%), Positives = 51/78 (65%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLF+GGLS+ETTD+ LR HF  +G +    V  DPNT RSRGF F+ +   E +D  M A
Sbjct: 15  KLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNA 74

Query: 190 GEHTINNKKVDPKKAKAR 243
             H ++ + V+PK+A +R
Sbjct: 75  RPHKVDGRVVEPKRAVSR 92



 Score = 75.8 bits (178), Expect = 1e-13
 Identities = 31/79 (39%), Positives = 52/79 (65%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +K+FVGG+  +T +  LRD+F  +G+IE I + TD  +G+ RGFAF+ F   +S+DK++ 
Sbjct: 105 KKIFVGGIKEDTEEHHLRDYFEQFGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVI 164

Query: 187 AGEHTINNKKVDPKKAKAR 243
              HT+N    + +KA ++
Sbjct: 165 QKYHTVNGHNCEVRKALSK 183



 Score = 57.6 bits (133), Expect = 3e-08
 Identities = 22/78 (28%), Positives = 45/78 (57%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGG+  +  +  +R++F +FG I  +E+  D+   +++GF F+TF+    V+ ++    
Sbjct: 108 FVGGIKEDTEEHHLRDYFEQFGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKY 167

Query: 435 RTIGGKEVDVKRATPKPD 488
            T+ G   +V++A  K +
Sbjct: 168 HTVNGHNCEVRKALSKQE 185



 Score = 56.0 bits (129), Expect = 1e-07
 Identities = 26/84 (30%), Positives = 48/84 (57%), Gaps = 2/84 (2%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGLS E +D+ +R+ F ++GT+ +  +  D    + +GF F+T+ + + V+  +    
Sbjct: 17  FIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARP 76

Query: 435 RTIGGKEVDVKRATPKPDG--PGA 500
             + G+ V+ KRA  + D   PGA
Sbjct: 77  HKVDGRVVEPKRAVSREDSQRPGA 100


>BC070315-1|AAH70315.1|  320|Homo sapiens HNRPA1 protein protein.
          Length = 320

 Score = 84.6 bits (200), Expect = 3e-16
 Identities = 37/78 (47%), Positives = 51/78 (65%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLF+GGLS+ETTD+ LR HF  +G +    V  DPNT RSRGF F+ +   E +D  M A
Sbjct: 15  KLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNA 74

Query: 190 GEHTINNKKVDPKKAKAR 243
             H ++ + V+PK+A +R
Sbjct: 75  RPHKVDGRVVEPKRAVSR 92



 Score = 77.4 bits (182), Expect = 4e-14
 Identities = 32/79 (40%), Positives = 52/79 (65%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +K+FVGG+  +T +  LRD+F  YG+IE I + TD  +G+ RGFAF+ F   +S+DK++ 
Sbjct: 105 KKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVI 164

Query: 187 AGEHTINNKKVDPKKAKAR 243
              HT+N    + +KA ++
Sbjct: 165 QKYHTVNGHNCEVRKALSK 183



 Score = 56.4 bits (130), Expect = 8e-08
 Identities = 21/78 (26%), Positives = 45/78 (57%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGG+  +  +  +R++F ++G I  +E+  D+   +++GF F+TF+    V+ ++    
Sbjct: 108 FVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKY 167

Query: 435 RTIGGKEVDVKRATPKPD 488
            T+ G   +V++A  K +
Sbjct: 168 HTVNGHNCEVRKALSKQE 185



 Score = 56.0 bits (129), Expect = 1e-07
 Identities = 26/84 (30%), Positives = 48/84 (57%), Gaps = 2/84 (2%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGLS E +D+ +R+ F ++GT+ +  +  D    + +GF F+T+ + + V+  +    
Sbjct: 17  FIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARP 76

Query: 435 RTIGGKEVDVKRATPKPDG--PGA 500
             + G+ V+ KRA  + D   PGA
Sbjct: 77  HKVDGRVVEPKRAVSREDSQRPGA 100


>BC052296-1|AAH52296.1|  320|Homo sapiens heterogeneous nuclear
           ribonucleoprotein A1 protein.
          Length = 320

 Score = 84.6 bits (200), Expect = 3e-16
 Identities = 37/78 (47%), Positives = 51/78 (65%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLF+GGLS+ETTD+ LR HF  +G +    V  DPNT RSRGF F+ +   E +D  M A
Sbjct: 15  KLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNA 74

Query: 190 GEHTINNKKVDPKKAKAR 243
             H ++ + V+PK+A +R
Sbjct: 75  RPHKVDGRVVEPKRAVSR 92



 Score = 77.4 bits (182), Expect = 4e-14
 Identities = 32/79 (40%), Positives = 52/79 (65%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +K+FVGG+  +T +  LRD+F  YG+IE I + TD  +G+ RGFAF+ F   +S+DK++ 
Sbjct: 105 KKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVI 164

Query: 187 AGEHTINNKKVDPKKAKAR 243
              HT+N    + +KA ++
Sbjct: 165 QKYHTVNGHNCEVRKALSK 183



 Score = 56.4 bits (130), Expect = 8e-08
 Identities = 21/78 (26%), Positives = 45/78 (57%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGG+  +  +  +R++F ++G I  +E+  D+   +++GF F+TF+    V+ ++    
Sbjct: 108 FVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKY 167

Query: 435 RTIGGKEVDVKRATPKPD 488
            T+ G   +V++A  K +
Sbjct: 168 HTVNGHNCEVRKALSKQE 185



 Score = 56.0 bits (129), Expect = 1e-07
 Identities = 26/84 (30%), Positives = 48/84 (57%), Gaps = 2/84 (2%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGLS E +D+ +R+ F ++GT+ +  +  D    + +GF F+T+ + + V+  +    
Sbjct: 17  FIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARP 76

Query: 435 RTIGGKEVDVKRATPKPDG--PGA 500
             + G+ V+ KRA  + D   PGA
Sbjct: 77  HKVDGRVVEPKRAVSREDSQRPGA 100


>BC033714-1|AAH33714.1|  320|Homo sapiens heterogeneous nuclear
           ribonucleoprotein A1 protein.
          Length = 320

 Score = 84.6 bits (200), Expect = 3e-16
 Identities = 37/78 (47%), Positives = 51/78 (65%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLF+GGLS+ETTD+ LR HF  +G +    V  DPNT RSRGF F+ +   E +D  M A
Sbjct: 15  KLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNA 74

Query: 190 GEHTINNKKVDPKKAKAR 243
             H ++ + V+PK+A +R
Sbjct: 75  RPHKVDGRVVEPKRAVSR 92



 Score = 77.4 bits (182), Expect = 4e-14
 Identities = 32/79 (40%), Positives = 52/79 (65%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +K+FVGG+  +T +  LRD+F  YG+IE I + TD  +G+ RGFAF+ F   +S+DK++ 
Sbjct: 105 KKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVI 164

Query: 187 AGEHTINNKKVDPKKAKAR 243
              HT+N    + +KA ++
Sbjct: 165 QKYHTVNGHNCEVRKALSK 183



 Score = 56.4 bits (130), Expect = 8e-08
 Identities = 21/78 (26%), Positives = 45/78 (57%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGG+  +  +  +R++F ++G I  +E+  D+   +++GF F+TF+    V+ ++    
Sbjct: 108 FVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKY 167

Query: 435 RTIGGKEVDVKRATPKPD 488
            T+ G   +V++A  K +
Sbjct: 168 HTVNGHNCEVRKALSKQE 185



 Score = 56.0 bits (129), Expect = 1e-07
 Identities = 26/84 (30%), Positives = 48/84 (57%), Gaps = 2/84 (2%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGLS E +D+ +R+ F ++GT+ +  +  D    + +GF F+T+ + + V+  +    
Sbjct: 17  FIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARP 76

Query: 435 RTIGGKEVDVKRATPKPDG--PGA 500
             + G+ V+ KRA  + D   PGA
Sbjct: 77  HKVDGRVVEPKRAVSREDSQRPGA 100


>BC012158-1|AAH12158.1|  320|Homo sapiens heterogeneous nuclear
           ribonucleoprotein A1 protein.
          Length = 320

 Score = 84.6 bits (200), Expect = 3e-16
 Identities = 37/78 (47%), Positives = 51/78 (65%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLF+GGLS+ETTD+ LR HF  +G +    V  DPNT RSRGF F+ +   E +D  M A
Sbjct: 15  KLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNA 74

Query: 190 GEHTINNKKVDPKKAKAR 243
             H ++ + V+PK+A +R
Sbjct: 75  RPHKVDGRVVEPKRAVSR 92



 Score = 77.4 bits (182), Expect = 4e-14
 Identities = 32/79 (40%), Positives = 52/79 (65%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +K+FVGG+  +T +  LRD+F  YG+IE I + TD  +G+ RGFAF+ F   +S+DK++ 
Sbjct: 105 KKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVI 164

Query: 187 AGEHTINNKKVDPKKAKAR 243
              HT+N    + +KA ++
Sbjct: 165 QKYHTVNGHNCEVRKALSK 183



 Score = 56.4 bits (130), Expect = 8e-08
 Identities = 21/78 (26%), Positives = 45/78 (57%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGG+  +  +  +R++F ++G I  +E+  D+   +++GF F+TF+    V+ ++    
Sbjct: 108 FVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKY 167

Query: 435 RTIGGKEVDVKRATPKPD 488
            T+ G   +V++A  K +
Sbjct: 168 HTVNGHNCEVRKALSKQE 185



 Score = 56.0 bits (129), Expect = 1e-07
 Identities = 26/84 (30%), Positives = 48/84 (57%), Gaps = 2/84 (2%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGLS E +D+ +R+ F ++GT+ +  +  D    + +GF F+T+ + + V+  +    
Sbjct: 17  FIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARP 76

Query: 435 RTIGGKEVDVKRATPKPDG--PGA 500
             + G+ V+ KRA  + D   PGA
Sbjct: 77  HKVDGRVVEPKRAVSREDSQRPGA 100


>BC009600-1|AAH09600.1|  320|Homo sapiens heterogeneous nuclear
           ribonucleoprotein A1 protein.
          Length = 320

 Score = 84.6 bits (200), Expect = 3e-16
 Identities = 37/78 (47%), Positives = 51/78 (65%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLF+GGLS+ETTD+ LR HF  +G +    V  DPNT RSRGF F+ +   E +D  M A
Sbjct: 15  KLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNA 74

Query: 190 GEHTINNKKVDPKKAKAR 243
             H ++ + V+PK+A +R
Sbjct: 75  RPHKVDGRVVEPKRAVSR 92



 Score = 77.4 bits (182), Expect = 4e-14
 Identities = 32/79 (40%), Positives = 52/79 (65%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +K+FVGG+  +T +  LRD+F  YG+IE I + TD  +G+ RGFAF+ F   +S+DK++ 
Sbjct: 105 KKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVI 164

Query: 187 AGEHTINNKKVDPKKAKAR 243
              HT+N    + +KA ++
Sbjct: 165 QKYHTVNGHNCEVRKALSK 183



 Score = 56.4 bits (130), Expect = 8e-08
 Identities = 21/78 (26%), Positives = 45/78 (57%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGG+  +  +  +R++F ++G I  +E+  D+   +++GF F+TF+    V+ ++    
Sbjct: 108 FVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKY 167

Query: 435 RTIGGKEVDVKRATPKPD 488
            T+ G   +V++A  K +
Sbjct: 168 HTVNGHNCEVRKALSKQE 185



 Score = 56.0 bits (129), Expect = 1e-07
 Identities = 26/84 (30%), Positives = 48/84 (57%), Gaps = 2/84 (2%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGLS E +D+ +R+ F ++GT+ +  +  D    + +GF F+T+ + + V+  +    
Sbjct: 17  FIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARP 76

Query: 435 RTIGGKEVDVKRATPKPDG--PGA 500
             + G+ V+ KRA  + D   PGA
Sbjct: 77  HKVDGRVVEPKRAVSREDSQRPGA 100


>BC002355-1|AAH02355.1|  320|Homo sapiens heterogeneous nuclear
           ribonucleoprotein A1 protein.
          Length = 320

 Score = 84.6 bits (200), Expect = 3e-16
 Identities = 37/78 (47%), Positives = 51/78 (65%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLF+GGLS+ETTD+ LR HF  +G +    V  DPNT RSRGF F+ +   E +D  M A
Sbjct: 15  KLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNA 74

Query: 190 GEHTINNKKVDPKKAKAR 243
             H ++ + V+PK+A +R
Sbjct: 75  RPHKVDGRVVEPKRAVSR 92



 Score = 77.4 bits (182), Expect = 4e-14
 Identities = 32/79 (40%), Positives = 52/79 (65%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +K+FVGG+  +T +  LRD+F  YG+IE I + TD  +G+ RGFAF+ F   +S+DK++ 
Sbjct: 105 KKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVI 164

Query: 187 AGEHTINNKKVDPKKAKAR 243
              HT+N    + +KA ++
Sbjct: 165 QKYHTVNGHNCEVRKALSK 183



 Score = 56.4 bits (130), Expect = 8e-08
 Identities = 21/78 (26%), Positives = 45/78 (57%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGG+  +  +  +R++F ++G I  +E+  D+   +++GF F+TF+    V+ ++    
Sbjct: 108 FVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKY 167

Query: 435 RTIGGKEVDVKRATPKPD 488
            T+ G   +V++A  K +
Sbjct: 168 HTVNGHNCEVRKALSKQE 185



 Score = 56.0 bits (129), Expect = 1e-07
 Identities = 26/84 (30%), Positives = 48/84 (57%), Gaps = 2/84 (2%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGLS E +D+ +R+ F ++GT+ +  +  D    + +GF F+T+ + + V+  +    
Sbjct: 17  FIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARP 76

Query: 435 RTIGGKEVDVKRATPKPDG--PGA 500
             + G+ V+ KRA  + D   PGA
Sbjct: 77  HKVDGRVVEPKRAVSREDSQRPGA 100


>BC113470-1|AAI13471.1|  378|Homo sapiens LOC653115 protein protein.
          Length = 378

 Score = 84.2 bits (199), Expect = 3e-16
 Identities = 36/82 (43%), Positives = 51/82 (62%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLF+GGLS+ETTD  LR+HF  +G +    V  DP T RSRGF F+ +   E +D  M A
Sbjct: 36  KLFIGGLSFETTDDSLREHFEKWGTLTDCVVMRDPQTKRSRGFGFVTYSCVEEVDAAMCA 95

Query: 190 GEHTINNKKVDPKKAKARHGKI 255
             H ++ + V+PK+A +R   +
Sbjct: 96  RPHKVDGRVVEPKRAVSREDSV 117



 Score = 77.0 bits (181), Expect = 5e-14
 Identities = 33/79 (41%), Positives = 52/79 (65%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +K+FVGG+  +T +  LRD+F  YG+IE+I V  D  +G+ RGFAF+ F   +++DK++ 
Sbjct: 126 KKIFVGGIKEDTEEYNLRDYFEKYGKIETIEVMEDRQSGKKRGFAFVTFDDHDTVDKIVV 185

Query: 187 AGEHTINNKKVDPKKAKAR 243
              HTIN    + KKA ++
Sbjct: 186 QKYHTINGHNCEVKKALSK 204



 Score = 58.4 bits (135), Expect = 2e-08
 Identities = 23/78 (29%), Positives = 45/78 (57%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGG+  +  +  +R++F ++G I  +E+  D+   +++GF F+TF+    V+ ++    
Sbjct: 129 FVGGIKEDTEEYNLRDYFEKYGKIETIEVMEDRQSGKKRGFAFVTFDDHDTVDKIVVQKY 188

Query: 435 RTIGGKEVDVKRATPKPD 488
            TI G   +VK+A  K +
Sbjct: 189 HTINGHNCEVKKALSKQE 206



 Score = 54.8 bits (126), Expect = 2e-07
 Identities = 27/84 (32%), Positives = 46/84 (54%), Gaps = 2/84 (2%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGLS E +DD +R  F ++GT+ +  +  D    + +GF F+T+   + V+  +    
Sbjct: 38  FIGGLSFETTDDSLREHFEKWGTLTDCVVMRDPQTKRSRGFGFVTYSCVEEVDAAMCARP 97

Query: 435 RTIGGKEVDVKRATPKPDG--PGA 500
             + G+ V+ KRA  + D   PGA
Sbjct: 98  HKVDGRVVEPKRAVSREDSVKPGA 121


>BC112027-1|AAI12028.1|  378|Homo sapiens heterogeneous nuclear
           ribonucleoprotein A3 protein.
          Length = 378

 Score = 84.2 bits (199), Expect = 3e-16
 Identities = 36/82 (43%), Positives = 51/82 (62%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLF+GGLS+ETTD  LR+HF  +G +    V  DP T RSRGF F+ +   E +D  M A
Sbjct: 36  KLFIGGLSFETTDDSLREHFEKWGTLTDCVVMRDPQTKRSRGFGFVTYSCVEEVDAAMCA 95

Query: 190 GEHTINNKKVDPKKAKARHGKI 255
             H ++ + V+PK+A +R   +
Sbjct: 96  RPHKVDGRVVEPKRAVSREDSV 117



 Score = 77.0 bits (181), Expect = 5e-14
 Identities = 33/79 (41%), Positives = 52/79 (65%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +K+FVGG+  +T +  LRD+F  YG+IE+I V  D  +G+ RGFAF+ F   +++DK++ 
Sbjct: 126 KKIFVGGIKEDTEEYNLRDYFEKYGKIETIEVMEDRQSGKKRGFAFVTFDDHDTVDKIVV 185

Query: 187 AGEHTINNKKVDPKKAKAR 243
              HTIN    + KKA ++
Sbjct: 186 QKYHTINGHNCEVKKALSK 204



 Score = 58.4 bits (135), Expect = 2e-08
 Identities = 23/78 (29%), Positives = 45/78 (57%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGG+  +  +  +R++F ++G I  +E+  D+   +++GF F+TF+    V+ ++    
Sbjct: 129 FVGGIKEDTEEYNLRDYFEKYGKIETIEVMEDRQSGKKRGFAFVTFDDHDTVDKIVVQKY 188

Query: 435 RTIGGKEVDVKRATPKPD 488
            TI G   +VK+A  K +
Sbjct: 189 HTINGHNCEVKKALSKQE 206



 Score = 54.8 bits (126), Expect = 2e-07
 Identities = 27/84 (32%), Positives = 46/84 (54%), Gaps = 2/84 (2%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGLS E +DD +R  F ++GT+ +  +  D    + +GF F+T+   + V+  +    
Sbjct: 38  FIGGLSFETTDDSLREHFEKWGTLTDCVVMRDPQTKRSRGFGFVTYSCVEEVDAAMCARP 97

Query: 435 RTIGGKEVDVKRATPKPDG--PGA 500
             + G+ V+ KRA  + D   PGA
Sbjct: 98  HKVDGRVVEPKRAVSREDSVKPGA 121


>AY363225-1|AAQ63629.1|  378|Homo sapiens heterogeneous nuclear
           ribonucleoprotein A3 protein.
          Length = 378

 Score = 84.2 bits (199), Expect = 3e-16
 Identities = 36/82 (43%), Positives = 51/82 (62%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLF+GGLS+ETTD  LR+HF  +G +    V  DP T RSRGF F+ +   E +D  M A
Sbjct: 36  KLFIGGLSFETTDDSLREHFEKWGTLTDCVVMRDPQTKRSRGFGFVTYSCVEEVDAAMCA 95

Query: 190 GEHTINNKKVDPKKAKARHGKI 255
             H ++ + V+PK+A +R   +
Sbjct: 96  RPHKVDGRVVEPKRAVSREDSV 117



 Score = 77.0 bits (181), Expect = 5e-14
 Identities = 33/79 (41%), Positives = 52/79 (65%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +K+FVGG+  +T +  LRD+F  YG+IE+I V  D  +G+ RGFAF+ F   +++DK++ 
Sbjct: 126 KKIFVGGIKEDTEEYNLRDYFEKYGKIETIEVMEDRQSGKKRGFAFVTFDDHDTVDKIVV 185

Query: 187 AGEHTINNKKVDPKKAKAR 243
              HTIN    + KKA ++
Sbjct: 186 QKYHTINGHNCEVKKALSK 204



 Score = 58.4 bits (135), Expect = 2e-08
 Identities = 23/78 (29%), Positives = 45/78 (57%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGG+  +  +  +R++F ++G I  +E+  D+   +++GF F+TF+    V+ ++    
Sbjct: 129 FVGGIKEDTEEYNLRDYFEKYGKIETIEVMEDRQSGKKRGFAFVTFDDHDTVDKIVVQKY 188

Query: 435 RTIGGKEVDVKRATPKPD 488
            TI G   +VK+A  K +
Sbjct: 189 HTINGHNCEVKKALSKQE 206



 Score = 54.8 bits (126), Expect = 2e-07
 Identities = 27/84 (32%), Positives = 46/84 (54%), Gaps = 2/84 (2%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGLS E +DD +R  F ++GT+ +  +  D    + +GF F+T+   + V+  +    
Sbjct: 38  FIGGLSFETTDDSLREHFEKWGTLTDCVVMRDPQTKRSRGFGFVTYSCVEEVDAAMCARP 97

Query: 435 RTIGGKEVDVKRATPKPDG--PGA 500
             + G+ V+ KRA  + D   PGA
Sbjct: 98  HKVDGRVVEPKRAVSREDSVKPGA 121


>AC079305-1|AAY14709.1|  378|Homo sapiens unknown protein.
          Length = 378

 Score = 84.2 bits (199), Expect = 3e-16
 Identities = 36/82 (43%), Positives = 51/82 (62%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLF+GGLS+ETTD  LR+HF  +G +    V  DP T RSRGF F+ +   E +D  M A
Sbjct: 36  KLFIGGLSFETTDDSLREHFEKWGTLTDCVVMRDPQTKRSRGFGFVTYSCVEEVDAAMCA 95

Query: 190 GEHTINNKKVDPKKAKARHGKI 255
             H ++ + V+PK+A +R   +
Sbjct: 96  RPHKVDGRVVEPKRAVSREDSV 117



 Score = 77.0 bits (181), Expect = 5e-14
 Identities = 33/79 (41%), Positives = 52/79 (65%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +K+FVGG+  +T +  LRD+F  YG+IE+I V  D  +G+ RGFAF+ F   +++DK++ 
Sbjct: 126 KKIFVGGIKEDTEEYNLRDYFEKYGKIETIEVMEDRQSGKKRGFAFVTFDDHDTVDKIVV 185

Query: 187 AGEHTINNKKVDPKKAKAR 243
              HTIN    + KKA ++
Sbjct: 186 QKYHTINGHNCEVKKALSK 204



 Score = 58.4 bits (135), Expect = 2e-08
 Identities = 23/78 (29%), Positives = 45/78 (57%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGG+  +  +  +R++F ++G I  +E+  D+   +++GF F+TF+    V+ ++    
Sbjct: 129 FVGGIKEDTEEYNLRDYFEKYGKIETIEVMEDRQSGKKRGFAFVTFDDHDTVDKIVVQKY 188

Query: 435 RTIGGKEVDVKRATPKPD 488
            TI G   +VK+A  K +
Sbjct: 189 HTINGHNCEVKKALSKQE 206



 Score = 54.8 bits (126), Expect = 2e-07
 Identities = 27/84 (32%), Positives = 46/84 (54%), Gaps = 2/84 (2%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGLS E +DD +R  F ++GT+ +  +  D    + +GF F+T+   + V+  +    
Sbjct: 38  FIGGLSFETTDDSLREHFEKWGTLTDCVVMRDPQTKRSRGFGFVTYSCVEEVDAAMCARP 97

Query: 435 RTIGGKEVDVKRATPKPDG--PGA 500
             + G+ V+ KRA  + D   PGA
Sbjct: 98  HKVDGRVVEPKRAVSREDSVKPGA 121


>BC108266-1|AAI08267.1|  320|Homo sapiens heterogeneous nuclear
           ribonucleoprotein A1-like protein.
          Length = 320

 Score = 83.0 bits (196), Expect = 8e-16
 Identities = 36/78 (46%), Positives = 50/78 (64%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLF+GGLS+ETTD+ LR HF  +G +    V  DPNT RSRGF F+ +   E +D  M  
Sbjct: 15  KLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNT 74

Query: 190 GEHTINNKKVDPKKAKAR 243
             H ++ + V+PK+A +R
Sbjct: 75  TPHKVDGRVVEPKRAVSR 92



 Score = 74.5 bits (175), Expect = 3e-13
 Identities = 31/76 (40%), Positives = 49/76 (64%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +K+FVGG+  +T +  LRD+F  YG+IE I + TD  +G+ RGFAF+ F   +S+DK++ 
Sbjct: 105 KKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVI 164

Query: 187 AGEHTINNKKVDPKKA 234
              HT+     + +KA
Sbjct: 165 QKYHTVKGHNCEVRKA 180



 Score = 58.8 bits (136), Expect = 1e-08
 Identities = 22/78 (28%), Positives = 46/78 (58%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGG+  +  +  +R++F ++G I  +E+  D+   +++GF F+TF+    V+ ++    
Sbjct: 108 FVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKY 167

Query: 435 RTIGGKEVDVKRATPKPD 488
            T+ G   +V++A PK +
Sbjct: 168 HTVKGHNCEVRKALPKQE 185



 Score = 58.4 bits (135), Expect = 2e-08
 Identities = 27/84 (32%), Positives = 49/84 (58%), Gaps = 2/84 (2%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGLS E +D+ +R+ F ++GT+ +  +  D    + +GF F+T+ + + V+  + T  
Sbjct: 17  FIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNTTP 76

Query: 435 RTIGGKEVDVKRATPKPDG--PGA 500
             + G+ V+ KRA  + D   PGA
Sbjct: 77  HKVDGRVVEPKRAVSREDSQRPGA 100


>AL137058-3|CAI16736.1|  320|Homo sapiens protein ( Human DNA
           sequence from clone RP11-78J21 on chromosome
           13q32.2-33.3 Contains 2 novel genes, a pseudogene
           similar to part of TPTE and  ).
          Length = 320

 Score = 83.0 bits (196), Expect = 8e-16
 Identities = 36/78 (46%), Positives = 50/78 (64%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLF+GGLS+ETTD+ LR HF  +G +    V  DPNT RSRGF F+ +   E +D  M  
Sbjct: 15  KLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNT 74

Query: 190 GEHTINNKKVDPKKAKAR 243
             H ++ + V+PK+A +R
Sbjct: 75  TPHKVDGRVVEPKRAVSR 92



 Score = 74.5 bits (175), Expect = 3e-13
 Identities = 31/76 (40%), Positives = 49/76 (64%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +K+FVGG+  +T +  LRD+F  YG+IE I + TD  +G+ RGFAF+ F   +S+DK++ 
Sbjct: 105 KKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVI 164

Query: 187 AGEHTINNKKVDPKKA 234
              HT+     + +KA
Sbjct: 165 QKYHTVKGHNCEVRKA 180



 Score = 58.8 bits (136), Expect = 1e-08
 Identities = 22/78 (28%), Positives = 46/78 (58%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGG+  +  +  +R++F ++G I  +E+  D+   +++GF F+TF+    V+ ++    
Sbjct: 108 FVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKY 167

Query: 435 RTIGGKEVDVKRATPKPD 488
            T+ G   +V++A PK +
Sbjct: 168 HTVKGHNCEVRKALPKQE 185



 Score = 58.4 bits (135), Expect = 2e-08
 Identities = 27/84 (32%), Positives = 49/84 (58%), Gaps = 2/84 (2%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGLS E +D+ +R+ F ++GT+ +  +  D    + +GF F+T+ + + V+  + T  
Sbjct: 17  FIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNTTP 76

Query: 435 RTIGGKEVDVKRATPKPDG--PGA 500
             + G+ V+ KRA  + D   PGA
Sbjct: 77  HKVDGRVVEPKRAVSREDSQRPGA 100


>BC012062-1|AAH12062.1|  407|Homo sapiens DAZ associated protein 1
           protein.
          Length = 407

 Score = 81.4 bits (192), Expect = 2e-15
 Identities = 34/78 (43%), Positives = 47/78 (60%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLFVGGL W TT + LR +F  YGE+    +  D  T +SRGF F+ FK P  +  V+A+
Sbjct: 11  KLFVGGLDWSTTQETLRSYFSQYGEVVDCVIMKDKTTNQSRGFGFVKFKDPNCVGTVLAS 70

Query: 190 GEHTINNKKVDPKKAKAR 243
             HT++ + +DPK    R
Sbjct: 71  RPHTLDGRNIDPKPCTPR 88



 Score = 72.5 bits (170), Expect = 1e-12
 Identities = 40/101 (39%), Positives = 58/101 (57%), Gaps = 8/101 (7%)
 Frame = +3

Query: 204 QQQESRPKEG*--------STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTK 359
           Q + +RPKEG         S + + FVGG+     + E+R +F +FG + EV M +D  K
Sbjct: 91  QPERTRPKEGWQKGPRSDNSKSNKIFVGGIPHNCGETELREYFKKFGVVTEVVMIYDAEK 150

Query: 360 NQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 482
            + +GF FITFE EQ V+  +      I GK+V+VKRA P+
Sbjct: 151 QRPRGFGFITFEDEQSVDQAVNMHFHDIMGKKVEVKRAEPR 191



 Score = 62.9 bits (146), Expect = 9e-10
 Identities = 26/76 (34%), Positives = 46/76 (60%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGL    + + +R++FS++G +++  +  DKT NQ +GF F+ F+    V  +L +  
Sbjct: 13  FVGGLDWSTTQETLRSYFSQYGEVVDCVIMKDKTTNQSRGFGFVKFKDPNCVGTVLASRP 72

Query: 435 RTIGGKEVDVKRATPK 482
            T+ G+ +D K  TP+
Sbjct: 73  HTLDGRNIDPKPCTPR 88



 Score = 61.3 bits (142), Expect = 3e-09
 Identities = 29/84 (34%), Positives = 47/84 (55%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           +  K+FVGG+     + ELR++F  +G +  + +  D    R RGF FI F+  +S+D+ 
Sbjct: 111 KSNKIFVGGIPHNCGETELREYFKKFGVVTEVVMIYDAEKQRPRGFGFITFEDEQSVDQA 170

Query: 181 MAAGEHTINNKKVDPKKAKARHGK 252
           +    H I  KKV+ K+A+ R  K
Sbjct: 171 VNMHFHDIMGKKVEVKRAEPRDSK 194


>AY678451-1|AAV97647.1|  454|Homo sapiens DAZAP1/MEF2D fusion
           protein protein.
          Length = 454

 Score = 81.4 bits (192), Expect = 2e-15
 Identities = 34/78 (43%), Positives = 47/78 (60%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLFVGGL W TT + LR +F  YGE+    +  D  T +SRGF F+ FK P  +  V+A+
Sbjct: 11  KLFVGGLDWSTTQETLRSYFSQYGEVVDCVIMKDKTTNQSRGFGFVKFKDPNCVGTVLAS 70

Query: 190 GEHTINNKKVDPKKAKAR 243
             HT++ + +DPK    R
Sbjct: 71  RPHTLDGRNIDPKPCTPR 88



 Score = 62.9 bits (146), Expect = 9e-10
 Identities = 26/76 (34%), Positives = 46/76 (60%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGL    + + +R++FS++G +++  +  DKT NQ +GF F+ F+    V  +L +  
Sbjct: 13  FVGGLDWSTTQETLRSYFSQYGEVVDCVIMKDKTTNQSRGFGFVKFKDPNCVGTVLASRP 72

Query: 435 RTIGGKEVDVKRATPK 482
            T+ G+ +D K  TP+
Sbjct: 73  HTLDGRNIDPKPCTPR 88



 Score = 40.7 bits (91), Expect = 0.004
 Identities = 22/70 (31%), Positives = 38/70 (54%), Gaps = 8/70 (11%)
 Frame = +3

Query: 204 QQQESRPKEG*--------STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTK 359
           Q + +RPKEG         S + + FVGG+     + E+R +F +FG + EV M +D  K
Sbjct: 91  QPERTRPKEGWQKGPRSDNSKSNKIFVGGIPHNCGETELREYFKKFGVVTEVVMIYDAEK 150

Query: 360 NQRKGFCFIT 389
            + +G  +++
Sbjct: 151 QRPRGNGYVS 160



 Score = 35.5 bits (78), Expect = 0.16
 Identities = 21/78 (26%), Positives = 40/78 (51%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           +  K+FVGG+     + ELR++F  +G +  + +  D    R RG  ++  +A   +  +
Sbjct: 111 KSNKIFVGGIPHNCGETELREYFKKFGVVTEVVMIYDAEKQRPRGNGYVSARASPGL--L 168

Query: 181 MAAGEHTINNKKVDPKKA 234
             A  +++N  KV P K+
Sbjct: 169 PVANGNSLN--KVIPAKS 184


>AF181719-1|AAF78364.1|  407|Homo sapiens DAZ associated protein 1
           protein.
          Length = 407

 Score = 81.4 bits (192), Expect = 2e-15
 Identities = 34/78 (43%), Positives = 47/78 (60%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLFVGGL W TT + LR +F  YGE+    +  D  T +SRGF F+ FK P  +  V+A+
Sbjct: 11  KLFVGGLDWSTTQETLRSYFSQYGEVVDCVIMKDKTTNQSRGFGFVKFKDPNCVGTVLAS 70

Query: 190 GEHTINNKKVDPKKAKAR 243
             HT++ + +DPK    R
Sbjct: 71  RPHTLDGRNIDPKPCTPR 88



 Score = 72.5 bits (170), Expect = 1e-12
 Identities = 40/101 (39%), Positives = 58/101 (57%), Gaps = 8/101 (7%)
 Frame = +3

Query: 204 QQQESRPKEG*--------STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTK 359
           Q + +RPKEG         S + + FVGG+     + E+R +F +FG + EV M +D  K
Sbjct: 91  QPERTRPKEGWQKGPRSDYSKSNKIFVGGIPHNCGETELREYFKKFGVVTEVVMIYDAEK 150

Query: 360 NQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 482
            + +GF FITFE EQ V+  +      I GK+V+VKRA P+
Sbjct: 151 QRPRGFGFITFEDEQSVDQAVNMHFHDIMGKKVEVKRAEPR 191



 Score = 62.9 bits (146), Expect = 9e-10
 Identities = 26/76 (34%), Positives = 46/76 (60%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGL    + + +R++FS++G +++  +  DKT NQ +GF F+ F+    V  +L +  
Sbjct: 13  FVGGLDWSTTQETLRSYFSQYGEVVDCVIMKDKTTNQSRGFGFVKFKDPNCVGTVLASRP 72

Query: 435 RTIGGKEVDVKRATPK 482
            T+ G+ +D K  TP+
Sbjct: 73  HTLDGRNIDPKPCTPR 88



 Score = 61.3 bits (142), Expect = 3e-09
 Identities = 29/84 (34%), Positives = 47/84 (55%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           +  K+FVGG+     + ELR++F  +G +  + +  D    R RGF FI F+  +S+D+ 
Sbjct: 111 KSNKIFVGGIPHNCGETELREYFKKFGVVTEVVMIYDAEKQRPRGFGFITFEDEQSVDQA 170

Query: 181 MAAGEHTINNKKVDPKKAKARHGK 252
           +    H I  KKV+ K+A+ R  K
Sbjct: 171 VNMHFHDIMGKKVEVKRAEPRDSK 194


>U09123-1|AAB60650.1|  341|Homo sapiens hnRNP protein A2 protein.
          Length = 341

 Score = 80.2 bits (189), Expect = 6e-15
 Identities = 35/78 (44%), Positives = 54/78 (69%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLF+GGLS+ETT++ LR+++  +G++    V  DP + RSRGF F+ F +   +D  MAA
Sbjct: 10  KLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAA 69

Query: 190 GEHTINNKKVDPKKAKAR 243
             H+I+ + V+PK+A AR
Sbjct: 70  RPHSIDGRVVEPKRAVAR 87



 Score = 75.8 bits (178), Expect = 1e-13
 Identities = 32/79 (40%), Positives = 51/79 (64%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +KLFVGG+  +T +  LRD+F  YG+I++I + TD  +G+ RGF F+ F   + +DK++ 
Sbjct: 100 KKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVL 159

Query: 187 AGEHTINNKKVDPKKAKAR 243
              HTIN    + +KA +R
Sbjct: 160 QKYHTINGHNAEVRKALSR 178



 Score = 56.4 bits (130), Expect = 8e-08
 Identities = 22/78 (28%), Positives = 45/78 (57%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGG+  +  +  +R++F E+G I  +E+  D+   +++GF F+TF+    V+ ++    
Sbjct: 103 FVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKY 162

Query: 435 RTIGGKEVDVKRATPKPD 488
            TI G   +V++A  + +
Sbjct: 163 HTINGHNAEVRKALSRQE 180



 Score = 55.6 bits (128), Expect = 1e-07
 Identities = 26/84 (30%), Positives = 48/84 (57%), Gaps = 2/84 (2%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGLS E +++ +RN++ ++G + +  +  D    + +GF F+TF S   V+  +    
Sbjct: 12  FIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARP 71

Query: 435 RTIGGKEVDVKRATPKPDG--PGA 500
            +I G+ V+ KRA  + +   PGA
Sbjct: 72  HSIDGRVVEPKRAVAREESGKPGA 95


>M29065-1|AAA36574.1|  341|Homo sapiens protein ( Human hnRNP A2
           protein mRNA. ).
          Length = 341

 Score = 80.2 bits (189), Expect = 6e-15
 Identities = 35/78 (44%), Positives = 54/78 (69%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLF+GGLS+ETT++ LR+++  +G++    V  DP + RSRGF F+ F +   +D  MAA
Sbjct: 10  KLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAA 69

Query: 190 GEHTINNKKVDPKKAKAR 243
             H+I+ + V+PK+A AR
Sbjct: 70  RPHSIDGRVVEPKRAVAR 87



 Score = 75.8 bits (178), Expect = 1e-13
 Identities = 32/79 (40%), Positives = 51/79 (64%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +KLFVGG+  +T +  LRD+F  YG+I++I + TD  +G+ RGF F+ F   + +DK++ 
Sbjct: 100 KKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVL 159

Query: 187 AGEHTINNKKVDPKKAKAR 243
              HTIN    + +KA +R
Sbjct: 160 QKYHTINGHNAEVRKALSR 178



 Score = 56.4 bits (130), Expect = 8e-08
 Identities = 22/78 (28%), Positives = 45/78 (57%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGG+  +  +  +R++F E+G I  +E+  D+   +++GF F+TF+    V+ ++    
Sbjct: 103 FVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKY 162

Query: 435 RTIGGKEVDVKRATPKPD 488
            TI G   +V++A  + +
Sbjct: 163 HTINGHNAEVRKALSRQE 180



 Score = 55.6 bits (128), Expect = 1e-07
 Identities = 26/84 (30%), Positives = 48/84 (57%), Gaps = 2/84 (2%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGLS E +++ +RN++ ++G + +  +  D    + +GF F+TF S   V+  +    
Sbjct: 12  FIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARP 71

Query: 435 RTIGGKEVDVKRATPKPDG--PGA 500
            +I G+ V+ KRA  + +   PGA
Sbjct: 72  HSIDGRVVEPKRAVAREESGKPGA 95


>M29064-1|AAA60271.1|  353|Homo sapiens SNRPB1 protein.
          Length = 353

 Score = 80.2 bits (189), Expect = 6e-15
 Identities = 35/78 (44%), Positives = 54/78 (69%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLF+GGLS+ETT++ LR+++  +G++    V  DP + RSRGF F+ F +   +D  MAA
Sbjct: 22  KLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAA 81

Query: 190 GEHTINNKKVDPKKAKAR 243
             H+I+ + V+PK+A AR
Sbjct: 82  RPHSIDGRVVEPKRAVAR 99



 Score = 75.8 bits (178), Expect = 1e-13
 Identities = 32/79 (40%), Positives = 51/79 (64%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +KLFVGG+  +T +  LRD+F  YG+I++I + TD  +G+ RGF F+ F   + +DK++ 
Sbjct: 112 KKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVL 171

Query: 187 AGEHTINNKKVDPKKAKAR 243
              HTIN    + +KA +R
Sbjct: 172 QKYHTINGHNAEVRKALSR 190



 Score = 56.4 bits (130), Expect = 8e-08
 Identities = 22/78 (28%), Positives = 45/78 (57%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGG+  +  +  +R++F E+G I  +E+  D+   +++GF F+TF+    V+ ++    
Sbjct: 115 FVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKY 174

Query: 435 RTIGGKEVDVKRATPKPD 488
            TI G   +V++A  + +
Sbjct: 175 HTINGHNAEVRKALSRQE 192



 Score = 55.6 bits (128), Expect = 1e-07
 Identities = 26/84 (30%), Positives = 48/84 (57%), Gaps = 2/84 (2%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGLS E +++ +RN++ ++G + +  +  D    + +GF F+TF S   V+  +    
Sbjct: 24  FIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARP 83

Query: 435 RTIGGKEVDVKRATPKPDG--PGA 500
            +I G+ V+ KRA  + +   PGA
Sbjct: 84  HSIDGRVVEPKRAVAREESGKPGA 107


>D28877-2|BAA06032.1|  341|Homo sapiens hnRNP A2 protein protein.
          Length = 341

 Score = 80.2 bits (189), Expect = 6e-15
 Identities = 35/78 (44%), Positives = 54/78 (69%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLF+GGLS+ETT++ LR+++  +G++    V  DP + RSRGF F+ F +   +D  MAA
Sbjct: 10  KLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAA 69

Query: 190 GEHTINNKKVDPKKAKAR 243
             H+I+ + V+PK+A AR
Sbjct: 70  RPHSIDGRVVEPKRAVAR 87



 Score = 75.8 bits (178), Expect = 1e-13
 Identities = 32/79 (40%), Positives = 51/79 (64%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +KLFVGG+  +T +  LRD+F  YG+I++I + TD  +G+ RGF F+ F   + +DK++ 
Sbjct: 100 KKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVL 159

Query: 187 AGEHTINNKKVDPKKAKAR 243
              HTIN    + +KA +R
Sbjct: 160 QKYHTINGHNAEVRKALSR 178



 Score = 56.4 bits (130), Expect = 8e-08
 Identities = 22/78 (28%), Positives = 45/78 (57%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGG+  +  +  +R++F E+G I  +E+  D+   +++GF F+TF+    V+ ++    
Sbjct: 103 FVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKY 162

Query: 435 RTIGGKEVDVKRATPKPD 488
            TI G   +V++A  + +
Sbjct: 163 HTINGHNAEVRKALSRQE 180



 Score = 55.6 bits (128), Expect = 1e-07
 Identities = 26/84 (30%), Positives = 48/84 (57%), Gaps = 2/84 (2%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGLS E +++ +RN++ ++G + +  +  D    + +GF F+TF S   V+  +    
Sbjct: 12  FIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARP 71

Query: 435 RTIGGKEVDVKRATPKPDG--PGA 500
            +I G+ V+ KRA  + +   PGA
Sbjct: 72  HSIDGRVVEPKRAVAREESGKPGA 95


>D28877-1|BAA06031.1|  353|Homo sapiens hnRNP B1 protein protein.
          Length = 353

 Score = 80.2 bits (189), Expect = 6e-15
 Identities = 35/78 (44%), Positives = 54/78 (69%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLF+GGLS+ETT++ LR+++  +G++    V  DP + RSRGF F+ F +   +D  MAA
Sbjct: 22  KLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAA 81

Query: 190 GEHTINNKKVDPKKAKAR 243
             H+I+ + V+PK+A AR
Sbjct: 82  RPHSIDGRVVEPKRAVAR 99



 Score = 75.8 bits (178), Expect = 1e-13
 Identities = 32/79 (40%), Positives = 51/79 (64%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +KLFVGG+  +T +  LRD+F  YG+I++I + TD  +G+ RGF F+ F   + +DK++ 
Sbjct: 112 KKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVL 171

Query: 187 AGEHTINNKKVDPKKAKAR 243
              HTIN    + +KA +R
Sbjct: 172 QKYHTINGHNAEVRKALSR 190



 Score = 56.4 bits (130), Expect = 8e-08
 Identities = 22/78 (28%), Positives = 45/78 (57%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGG+  +  +  +R++F E+G I  +E+  D+   +++GF F+TF+    V+ ++    
Sbjct: 115 FVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKY 174

Query: 435 RTIGGKEVDVKRATPKPD 488
            TI G   +V++A  + +
Sbjct: 175 HTINGHNAEVRKALSRQE 192



 Score = 55.6 bits (128), Expect = 1e-07
 Identities = 26/84 (30%), Positives = 48/84 (57%), Gaps = 2/84 (2%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGLS E +++ +RN++ ++G + +  +  D    + +GF F+TF S   V+  +    
Sbjct: 24  FIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARP 83

Query: 435 RTIGGKEVDVKRATPKPDG--PGA 500
            +I G+ V+ KRA  + +   PGA
Sbjct: 84  HSIDGRVVEPKRAVAREESGKPGA 107


>BC000506-1|AAH00506.3|  249|Homo sapiens HNRPA2B1 protein protein.
          Length = 249

 Score = 80.2 bits (189), Expect = 6e-15
 Identities = 35/78 (44%), Positives = 54/78 (69%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLF+GGLS+ETT++ LR+++  +G++    V  DP + RSRGF F+ F +   +D  MAA
Sbjct: 10  KLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAA 69

Query: 190 GEHTINNKKVDPKKAKAR 243
             H+I+ + V+PK+A AR
Sbjct: 70  RPHSIDGRVVEPKRAVAR 87



 Score = 75.8 bits (178), Expect = 1e-13
 Identities = 32/79 (40%), Positives = 51/79 (64%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +KLFVGG+  +T +  LRD+F  YG+I++I + TD  +G+ RGF F+ F   + +DK++ 
Sbjct: 100 KKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVL 159

Query: 187 AGEHTINNKKVDPKKAKAR 243
              HTIN    + +KA +R
Sbjct: 160 QKYHTINGHNAEVRKALSR 178



 Score = 56.4 bits (130), Expect = 8e-08
 Identities = 22/78 (28%), Positives = 45/78 (57%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGG+  +  +  +R++F E+G I  +E+  D+   +++GF F+TF+    V+ ++    
Sbjct: 103 FVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKY 162

Query: 435 RTIGGKEVDVKRATPKPD 488
            TI G   +V++A  + +
Sbjct: 163 HTINGHNAEVRKALSRQE 180



 Score = 55.6 bits (128), Expect = 1e-07
 Identities = 26/84 (30%), Positives = 48/84 (57%), Gaps = 2/84 (2%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGLS E +++ +RN++ ++G + +  +  D    + +GF F+TF S   V+  +    
Sbjct: 12  FIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARP 71

Query: 435 RTIGGKEVDVKRATPKPDG--PGA 500
            +I G+ V+ KRA  + +   PGA
Sbjct: 72  HSIDGRVVEPKRAVAREESGKPGA 95


>BC004945-1|AAH04945.1|  298|Homo sapiens Unknown (protein for
           IMAGE:3615335) protein.
          Length = 298

 Score = 77.4 bits (182), Expect = 4e-14
 Identities = 32/79 (40%), Positives = 52/79 (65%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +K+FVGG+  +T +  LRD+F  YG+IE I + TD  +G+ RGFAF+ F   +S+DK++ 
Sbjct: 83  KKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVI 142

Query: 187 AGEHTINNKKVDPKKAKAR 243
              HT+N    + +KA ++
Sbjct: 143 QKYHTVNGHNCEVRKALSK 161



 Score = 69.3 bits (162), Expect = 1e-11
 Identities = 30/70 (42%), Positives = 43/70 (61%)
 Frame = +1

Query: 34  WETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNK 213
           +ETTD+ LR HF  +G +    V  DPNT RSRGF F+ +   E +D  M A  H ++ +
Sbjct: 1   FETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGR 60

Query: 214 KVDPKKAKAR 243
            V+PK+A +R
Sbjct: 61  VVEPKRAVSR 70



 Score = 56.4 bits (130), Expect = 8e-08
 Identities = 21/78 (26%), Positives = 45/78 (57%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGG+  +  +  +R++F ++G I  +E+  D+   +++GF F+TF+    V+ ++    
Sbjct: 86  FVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKY 145

Query: 435 RTIGGKEVDVKRATPKPD 488
            T+ G   +V++A  K +
Sbjct: 146 HTVNGHNCEVRKALSKQE 163



 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 21/77 (27%), Positives = 42/77 (54%), Gaps = 2/77 (2%)
 Frame = +3

Query: 276 EISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKE 455
           E +D+ +R+ F ++GT+ +  +  D    + +GF F+T+ + + V+  +      + G+ 
Sbjct: 2   ETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRV 61

Query: 456 VDVKRATPKPDG--PGA 500
           V+ KRA  + D   PGA
Sbjct: 62  VEPKRAVSREDSQRPGA 78


>S63912-1|AAB27595.1|  269|Homo sapiens FBRNP protein.
          Length = 269

 Score = 76.6 bits (180), Expect = 7e-14
 Identities = 33/82 (40%), Positives = 49/82 (59%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLF+GGLS+ETTD  LR+HF  +G +    V  DP T RSRGF F+ +     +D  + A
Sbjct: 36  KLFIGGLSFETTDDSLREHFEKWGTLTDCLVMRDPQTKRSRGFGFVTYSCVTEVDAAIGA 95

Query: 190 GEHTINNKKVDPKKAKARHGKI 255
               ++ + V+PK+A +R   +
Sbjct: 96  RPFKVDGRVVEPKRAVSREDSV 117



 Score = 72.5 bits (170), Expect = 1e-12
 Identities = 32/79 (40%), Positives = 50/79 (63%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +K+FVG +  +T +  LRD+F  YG+IE+I V  D  +G+ RGFA + F   +++DK++ 
Sbjct: 126 KKIFVGSIKEDTEEYNLRDYFEKYGKIETIEVMEDRQSGKKRGFASVTFDDHDTVDKIVV 185

Query: 187 AGEHTINNKKVDPKKAKAR 243
              HTIN    + KKA A+
Sbjct: 186 QKYHTINGHNCEVKKALAK 204



 Score = 52.4 bits (120), Expect = 1e-06
 Identities = 27/84 (32%), Positives = 45/84 (53%), Gaps = 2/84 (2%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGLS E +DD +R  F ++GT+ +  +  D    + +GF F+T+     V+  +    
Sbjct: 38  FIGGLSFETTDDSLREHFEKWGTLTDCLVMRDPQTKRSRGFGFVTYSCVTEVDAAIGARP 97

Query: 435 RTIGGKEVDVKRATPKPDG--PGA 500
             + G+ V+ KRA  + D   PGA
Sbjct: 98  FKVDGRVVEPKRAVSREDSVKPGA 121



 Score = 52.4 bits (120), Expect = 1e-06
 Identities = 21/76 (27%), Positives = 42/76 (55%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVG +  +  +  +R++F ++G I  +E+  D+   +++GF  +TF+    V+ ++    
Sbjct: 129 FVGSIKEDTEEYNLRDYFEKYGKIETIEVMEDRQSGKKRGFASVTFDDHDTVDKIVVQKY 188

Query: 435 RTIGGKEVDVKRATPK 482
            TI G   +VK+A  K
Sbjct: 189 HTINGHNCEVKKALAK 204


>AK056850-1|BAB71295.1|  289|Homo sapiens protein ( Homo sapiens
           cDNA FLJ32288 fis, clone PROST2000325, highly similar to
           Homo sapiens DAZ associated protein 1 (DAZAP1) mRNA. ).
          Length = 289

 Score = 72.5 bits (170), Expect = 1e-12
 Identities = 40/101 (39%), Positives = 58/101 (57%), Gaps = 8/101 (7%)
 Frame = +3

Query: 204 QQQESRPKEG*--------STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTK 359
           Q + +RPKEG         S + + FVGG+     + E+R +F +FG + EV M +D  K
Sbjct: 2   QPERTRPKEGWQKGPRSDNSKSNKIFVGGIPHNCGETELREYFKKFGVVTEVVMIYDAEK 61

Query: 360 NQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 482
            + +GF FITFE EQ V+  +      I GK+V+VKRA P+
Sbjct: 62  QRPRGFGFITFEDEQSVDQAVNMHFHDIMGKKVEVKRAEPR 102



 Score = 61.3 bits (142), Expect = 3e-09
 Identities = 29/84 (34%), Positives = 47/84 (55%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           +  K+FVGG+     + ELR++F  +G +  + +  D    R RGF FI F+  +S+D+ 
Sbjct: 22  KSNKIFVGGIPHNCGETELREYFKKFGVVTEVVMIYDAEKQRPRGFGFITFEDEQSVDQA 81

Query: 181 MAAGEHTINNKKVDPKKAKARHGK 252
           +    H I  KKV+ K+A+ R  K
Sbjct: 82  VNMHFHDIMGKKVEVKRAEPRDSK 105


>AB073212-1|BAB70469.1|  179|Homo sapiens Musashi1 protein.
          Length = 179

 Score = 70.5 bits (165), Expect = 5e-12
 Identities = 31/81 (38%), Positives = 52/81 (64%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           R +K+FVGGLS  TT ++++ +F  +G+++   +  D  T R RGF F+ F++ + ++KV
Sbjct: 41  RTKKIFVGGLSVNTTVEDVKQYFEQFGKVDDAMLMFDKTTNRHRGFGFVTFESEDIVEKV 100

Query: 181 MAAGEHTINNKKVDPKKAKAR 243
                H INNK V+ KKA+ +
Sbjct: 101 CEIHFHEINNKMVECKKAQPK 121



 Score = 69.3 bits (162), Expect = 1e-11
 Identities = 30/76 (39%), Positives = 48/76 (63%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGLS   + ++++ +F +FG + +  + FDKT N+ +GF F+TFESE +V  + +   
Sbjct: 46  FVGGLSVNTTVEDVKQYFEQFGKVDDAMLMFDKTTNRHRGFGFVTFESEDIVEKVCEIHF 105

Query: 435 RTIGGKEVDVKRATPK 482
             I  K V+ K+A PK
Sbjct: 106 HEINNKMVECKKAQPK 121



 Score = 29.9 bits (64), Expect = 7.9
 Identities = 12/34 (35%), Positives = 19/34 (55%)
 Frame = +1

Query: 151 FKAPESIDKVMAAGEHTINNKKVDPKKAKARHGK 252
           F     +DKV+A   H +++K +DPK A  R  +
Sbjct: 2   FMDQAGVDKVLAQSRHELDSKTIDPKVAFPRRAQ 35


>AB072592-1|BAB69769.1|  181|Homo sapiens Musashi1 protein.
          Length = 181

 Score = 70.5 bits (165), Expect = 5e-12
 Identities = 31/81 (38%), Positives = 52/81 (64%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           R +K+FVGGLS  TT ++++ +F  +G+++   +  D  T R RGF F+ F++ + ++KV
Sbjct: 44  RTKKIFVGGLSVNTTVEDVKQYFEQFGKVDDAMLMFDKTTNRHRGFGFVTFESEDIVEKV 103

Query: 181 MAAGEHTINNKKVDPKKAKAR 243
                H INNK V+ KKA+ +
Sbjct: 104 CEIHFHEINNKMVECKKAQPK 124



 Score = 69.3 bits (162), Expect = 1e-11
 Identities = 30/76 (39%), Positives = 48/76 (63%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGLS   + ++++ +F +FG + +  + FDKT N+ +GF F+TFESE +V  + +   
Sbjct: 49  FVGGLSVNTTVEDVKQYFEQFGKVDDAMLMFDKTTNRHRGFGFVTFESEDIVEKVCEIHF 108

Query: 435 RTIGGKEVDVKRATPK 482
             I  K V+ K+A PK
Sbjct: 109 HEINNKMVECKKAQPK 124



 Score = 33.5 bits (73), Expect = 0.64
 Identities = 13/37 (35%), Positives = 21/37 (56%)
 Frame = +1

Query: 142 FIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARHGK 252
           F+ F     +DKV+A   H +++K +DPK A  R  +
Sbjct: 2   FVTFMDQAGVDKVLAQSRHELDSKTIDPKVAFPRRAQ 38


>AB072591-1|BAB69768.1|  181|Homo sapiens Musashi1 protein.
          Length = 181

 Score = 70.5 bits (165), Expect = 5e-12
 Identities = 31/81 (38%), Positives = 52/81 (64%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           R +K+FVGGLS  TT ++++ +F  +G+++   +  D  T R RGF F+ F++ + ++KV
Sbjct: 44  RTKKIFVGGLSVNTTVEDVKQYFEQFGKVDDAMLMFDKTTNRHRGFGFVTFESEDIVEKV 103

Query: 181 MAAGEHTINNKKVDPKKAKAR 243
                H INNK V+ KKA+ +
Sbjct: 104 CEIHFHEINNKMVECKKAQPK 124



 Score = 69.3 bits (162), Expect = 1e-11
 Identities = 30/76 (39%), Positives = 48/76 (63%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGLS   + ++++ +F +FG + +  + FDKT N+ +GF F+TFESE +V  + +   
Sbjct: 49  FVGGLSVNTTVEDVKQYFEQFGKVDDAMLMFDKTTNRHRGFGFVTFESEDIVEKVCEIHF 108

Query: 435 RTIGGKEVDVKRATPK 482
             I  K V+ K+A PK
Sbjct: 109 HEINNKMVECKKAQPK 124



 Score = 33.5 bits (73), Expect = 0.64
 Identities = 13/37 (35%), Positives = 21/37 (56%)
 Frame = +1

Query: 142 FIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARHGK 252
           F+ F     +DKV+A   H +++K +DPK A  R  +
Sbjct: 2   FVTFMDQAGVDKVLAQSRHELDSKTIDPKVAFPRRAQ 38


>AB072590-1|BAB69767.1|  180|Homo sapiens Musashi1 protein.
          Length = 180

 Score = 70.5 bits (165), Expect = 5e-12
 Identities = 31/81 (38%), Positives = 52/81 (64%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           R +K+FVGGLS  TT ++++ +F  +G+++   +  D  T R RGF F+ F++ + ++KV
Sbjct: 44  RTKKIFVGGLSVNTTVEDVKQYFEQFGKVDDAMLMFDKTTNRHRGFGFVTFESEDIVEKV 103

Query: 181 MAAGEHTINNKKVDPKKAKAR 243
                H INNK V+ KKA+ +
Sbjct: 104 CEIHFHEINNKMVECKKAQPK 124



 Score = 69.3 bits (162), Expect = 1e-11
 Identities = 30/76 (39%), Positives = 48/76 (63%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGLS   + ++++ +F +FG + +  + FDKT N+ +GF F+TFESE +V  + +   
Sbjct: 49  FVGGLSVNTTVEDVKQYFEQFGKVDDAMLMFDKTTNRHRGFGFVTFESEDIVEKVCEIHF 108

Query: 435 RTIGGKEVDVKRATPK 482
             I  K V+ K+A PK
Sbjct: 109 HEINNKMVECKKAQPK 124



 Score = 33.5 bits (73), Expect = 0.64
 Identities = 13/37 (35%), Positives = 21/37 (56%)
 Frame = +1

Query: 142 FIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARHGK 252
           F+ F     +DKV+A   H +++K +DPK A  R  +
Sbjct: 2   FVTFMDQAGVDKVLAQSRHELDSKTIDPKVAFPRRAQ 38


>AL354775-1|CAI12730.1|  276|Homo sapiens protein ( Human DNA
           sequence from clone RP11-223F20 on chromosome 13
           Contains a novel heterogeneous nuclear ribonucleoprotein
           family A protein and).
          Length = 276

 Score = 70.1 bits (164), Expect = 6e-12
 Identities = 32/79 (40%), Positives = 49/79 (62%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +K+FVGG+  +T +  LRD+F    +IE+I V  D  +G+ RGFAF+ F   + IDK++ 
Sbjct: 23  KKIFVGGIKEDTEEYNLRDYFEKCSKIETIEVMEDRQSGKKRGFAFVTFDDHDIIDKIVV 82

Query: 187 AGEHTINNKKVDPKKAKAR 243
              HTIN    + KKA ++
Sbjct: 83  QKYHTINGHNCEVKKALSK 101



 Score = 54.8 bits (126), Expect = 2e-07
 Identities = 21/78 (26%), Positives = 44/78 (56%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGG+  +  +  +R++F +   I  +E+  D+   +++GF F+TF+   +++ ++    
Sbjct: 26  FVGGIKEDTEEYNLRDYFEKCSKIETIEVMEDRQSGKKRGFAFVTFDDHDIIDKIVVQKY 85

Query: 435 RTIGGKEVDVKRATPKPD 488
            TI G   +VK+A  K +
Sbjct: 86  HTINGHNCEVKKALSKQE 103


>BC017560-1|AAH17560.1|  151|Homo sapiens MSI2 protein protein.
          Length = 151

 Score = 68.9 bits (161), Expect = 1e-11
 Identities = 30/76 (39%), Positives = 48/76 (63%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGLS+    ++++ +F +FG + +  + FDKT N+ +GF F+TFE+E VV  + +   
Sbjct: 9   FVGGLSANTVVEDVKQYFEQFGKVEDAMLMFDKTTNRHRGFGFVTFENEDVVEKVCEIHF 68

Query: 435 RTIGGKEVDVKRATPK 482
             I  K V+ K+A PK
Sbjct: 69  HEINNKMVECKKAQPK 84



 Score = 68.5 bits (160), Expect = 2e-11
 Identities = 31/81 (38%), Positives = 50/81 (61%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           R +K+FVGGLS  T  ++++ +F  +G++E   +  D  T R RGF F+ F+  + ++KV
Sbjct: 4   RTKKIFVGGLSANTVVEDVKQYFEQFGKVEDAMLMFDKTTNRHRGFGFVTFENEDVVEKV 63

Query: 181 MAAGEHTINNKKVDPKKAKAR 243
                H INNK V+ KKA+ +
Sbjct: 64  CEIHFHEINNKMVECKKAQPK 84


>U23803-1|AAA65094.1|  305|Homo sapiens heterogeneous
           ribonucleoprotein A0 protein.
          Length = 305

 Score = 67.3 bits (157), Expect = 4e-11
 Identities = 31/78 (39%), Positives = 46/78 (58%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLF+GGL+ +T++  LR HF A+G +    V  +P T RSR F F+ +   E  D  MAA
Sbjct: 8   KLFIGGLNVQTSESGLRGHFEAFGTLTDCVVVVNPQTKRSRCFGFVTYSNVEEADAAMAA 67

Query: 190 GEHTINNKKVDPKKAKAR 243
             H ++   V+ K+A +R
Sbjct: 68  SPHAVDGNTVELKRAVSR 85



 Score = 63.7 bits (148), Expect = 5e-10
 Identities = 27/76 (35%), Positives = 43/76 (56%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +KLFVGGL  +  + +L +HF  +G +E   +  D  +G+ RGF F+ F+  ++ DK   
Sbjct: 98  KKLFVGGLKGDVAEGDLIEHFSQFGTVEKAEIIADKQSGKKRGFGFVYFQNHDAADKAAV 157

Query: 187 AGEHTINNKKVDPKKA 234
              H I   +V+ KKA
Sbjct: 158 VKFHPIQGHRVEVKKA 173



 Score = 60.5 bits (140), Expect = 5e-09
 Identities = 26/78 (33%), Positives = 45/78 (57%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGL  ++++ ++   FS+FGT+ + E+  DK   +++GF F+ F++    +       
Sbjct: 101 FVGGLKGDVAEGDLIEHFSQFGTVEKAEIIADKQSGKKRGFGFVYFQNHDAADKAAVVKF 160

Query: 435 RTIGGKEVDVKRATPKPD 488
             I G  V+VK+A PK D
Sbjct: 161 HPIQGHRVEVKKAVPKED 178



 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 22/84 (26%), Positives = 43/84 (51%), Gaps = 2/84 (2%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGL+ + S+  +R  F  FGT+ +  +  +    + + F F+T+ + +  +  +    
Sbjct: 10  FIGGLNVQTSESGLRGHFEAFGTLTDCVVVVNPQTKRSRCFGFVTYSNVEEADAAMAASP 69

Query: 435 RTIGGKEVDVKRATPKPDG--PGA 500
             + G  V++KRA  + D   PGA
Sbjct: 70  HAVDGNTVELKRAVSREDSARPGA 93


>CR456986-1|CAG33267.1|  305|Homo sapiens HNRPA0 protein.
          Length = 305

 Score = 67.3 bits (157), Expect = 4e-11
 Identities = 31/78 (39%), Positives = 46/78 (58%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLF+GGL+ +T++  LR HF A+G +    V  +P T RSR F F+ +   E  D  MAA
Sbjct: 8   KLFIGGLNVQTSESGLRGHFEAFGTLTDCVVVVNPQTKRSRCFGFVTYSNVEEADAAMAA 67

Query: 190 GEHTINNKKVDPKKAKAR 243
             H ++   V+ K+A +R
Sbjct: 68  SPHAVDGNTVELKRAVSR 85



 Score = 63.7 bits (148), Expect = 5e-10
 Identities = 27/76 (35%), Positives = 43/76 (56%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +KLFVGGL  +  + +L +HF  +G +E   +  D  +G+ RGF F+ F+  ++ DK   
Sbjct: 98  KKLFVGGLKGDVAEGDLIEHFSQFGTVEKAEIIADKQSGKKRGFGFVYFQNHDAADKAAV 157

Query: 187 AGEHTINNKKVDPKKA 234
              H I   +V+ KKA
Sbjct: 158 VKFHPIQGHRVEVKKA 173



 Score = 60.5 bits (140), Expect = 5e-09
 Identities = 26/78 (33%), Positives = 45/78 (57%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGL  ++++ ++   FS+FGT+ + E+  DK   +++GF F+ F++    +       
Sbjct: 101 FVGGLKGDVAEGDLIEHFSQFGTVEKAEIIADKQSGKKRGFGFVYFQNHDAADKAAVVKF 160

Query: 435 RTIGGKEVDVKRATPKPD 488
             I G  V+VK+A PK D
Sbjct: 161 HPIQGHRVEVKKAVPKED 178



 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 22/84 (26%), Positives = 43/84 (51%), Gaps = 2/84 (2%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGL+ + S+  +R  F  FGT+ +  +  +    + + F F+T+ + +  +  +    
Sbjct: 10  FIGGLNVQTSESGLRGHFEAFGTLTDCVVVVNPQTKRSRCFGFVTYSNVEEADAAMAASP 69

Query: 435 RTIGGKEVDVKRATPKPDG--PGA 500
             + G  V++KRA  + D   PGA
Sbjct: 70  HAVDGNTVELKRAVSREDSARPGA 93


>BC030249-1|AAH30249.1|  305|Homo sapiens heterogeneous nuclear
           ribonucleoprotein A0 protein.
          Length = 305

 Score = 67.3 bits (157), Expect = 4e-11
 Identities = 31/78 (39%), Positives = 46/78 (58%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLF+GGL+ +T++  LR HF A+G +    V  +P T RSR F F+ +   E  D  MAA
Sbjct: 8   KLFIGGLNVQTSESGLRGHFEAFGTLTDCVVVVNPQTKRSRCFGFVTYSNVEEADAAMAA 67

Query: 190 GEHTINNKKVDPKKAKAR 243
             H ++   V+ K+A +R
Sbjct: 68  SPHAVDGNTVELKRAVSR 85



 Score = 63.7 bits (148), Expect = 5e-10
 Identities = 27/76 (35%), Positives = 43/76 (56%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +KLFVGGL  +  + +L +HF  +G +E   +  D  +G+ RGF F+ F+  ++ DK   
Sbjct: 98  KKLFVGGLKGDVAEGDLIEHFSQFGTVEKAEIIADKQSGKKRGFGFVYFQNHDAADKAAV 157

Query: 187 AGEHTINNKKVDPKKA 234
              H I   +V+ KKA
Sbjct: 158 VKFHPIQGHRVEVKKA 173



 Score = 60.5 bits (140), Expect = 5e-09
 Identities = 26/78 (33%), Positives = 45/78 (57%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGL  ++++ ++   FS+FGT+ + E+  DK   +++GF F+ F++    +       
Sbjct: 101 FVGGLKGDVAEGDLIEHFSQFGTVEKAEIIADKQSGKKRGFGFVYFQNHDAADKAAVVKF 160

Query: 435 RTIGGKEVDVKRATPKPD 488
             I G  V+VK+A PK D
Sbjct: 161 HPIQGHRVEVKKAVPKED 178



 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 22/84 (26%), Positives = 43/84 (51%), Gaps = 2/84 (2%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGL+ + S+  +R  F  FGT+ +  +  +    + + F F+T+ + +  +  +    
Sbjct: 10  FIGGLNVQTSESGLRGHFEAFGTLTDCVVVVNPQTKRSRCFGFVTYSNVEEADAAMAASP 69

Query: 435 RTIGGKEVDVKRATPKPDG--PGA 500
             + G  V++KRA  + D   PGA
Sbjct: 70  HAVDGNTVELKRAVSREDSARPGA 93


>BC028976-1|AAH28976.1|  305|Homo sapiens heterogeneous nuclear
           ribonucleoprotein A0 protein.
          Length = 305

 Score = 67.3 bits (157), Expect = 4e-11
 Identities = 31/78 (39%), Positives = 46/78 (58%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLF+GGL+ +T++  LR HF A+G +    V  +P T RSR F F+ +   E  D  MAA
Sbjct: 8   KLFIGGLNVQTSESGLRGHFEAFGTLTDCVVVVNPQTKRSRCFGFVTYSNVEEADAAMAA 67

Query: 190 GEHTINNKKVDPKKAKAR 243
             H ++   V+ K+A +R
Sbjct: 68  SPHAVDGNTVELKRAVSR 85



 Score = 63.7 bits (148), Expect = 5e-10
 Identities = 27/76 (35%), Positives = 43/76 (56%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +KLFVGGL  +  + +L +HF  +G +E   +  D  +G+ RGF F+ F+  ++ DK   
Sbjct: 98  KKLFVGGLKGDVAEGDLIEHFSQFGTVEKAEIIADKQSGKKRGFGFVYFQNHDAADKAAV 157

Query: 187 AGEHTINNKKVDPKKA 234
              H I   +V+ KKA
Sbjct: 158 VKFHPIQGHRVEVKKA 173



 Score = 60.5 bits (140), Expect = 5e-09
 Identities = 26/78 (33%), Positives = 45/78 (57%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGL  ++++ ++   FS+FGT+ + E+  DK   +++GF F+ F++    +       
Sbjct: 101 FVGGLKGDVAEGDLIEHFSQFGTVEKAEIIADKQSGKKRGFGFVYFQNHDAADKAAVVKF 160

Query: 435 RTIGGKEVDVKRATPKPD 488
             I G  V+VK+A PK D
Sbjct: 161 HPIQGHRVEVKKAVPKED 178



 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 22/84 (26%), Positives = 43/84 (51%), Gaps = 2/84 (2%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGL+ + S+  +R  F  FGT+ +  +  +    + + F F+T+ + +  +  +    
Sbjct: 10  FIGGLNVQTSESGLRGHFEAFGTLTDCVVVVNPQTKRSRCFGFVTYSNVEEADAAMAASP 69

Query: 435 RTIGGKEVDVKRATPKPDG--PGA 500
             + G  V++KRA  + D   PGA
Sbjct: 70  HAVDGNTVELKRAVSREDSARPGA 93


>BC019271-1|AAH19271.1|  305|Homo sapiens heterogeneous nuclear
           ribonucleoprotein A0 protein.
          Length = 305

 Score = 67.3 bits (157), Expect = 4e-11
 Identities = 31/78 (39%), Positives = 46/78 (58%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLF+GGL+ +T++  LR HF A+G +    V  +P T RSR F F+ +   E  D  MAA
Sbjct: 8   KLFIGGLNVQTSESGLRGHFEAFGTLTDCVVVVNPQTKRSRCFGFVTYSNVEEADAAMAA 67

Query: 190 GEHTINNKKVDPKKAKAR 243
             H ++   V+ K+A +R
Sbjct: 68  SPHAVDGNTVELKRAVSR 85



 Score = 63.7 bits (148), Expect = 5e-10
 Identities = 27/76 (35%), Positives = 43/76 (56%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +KLFVGGL  +  + +L +HF  +G +E   +  D  +G+ RGF F+ F+  ++ DK   
Sbjct: 98  KKLFVGGLKGDVAEGDLIEHFSQFGTVEKAEIIADKQSGKKRGFGFVYFQNHDAADKAAV 157

Query: 187 AGEHTINNKKVDPKKA 234
              H I   +V+ KKA
Sbjct: 158 VKFHPIQGHRVEVKKA 173



 Score = 60.5 bits (140), Expect = 5e-09
 Identities = 26/78 (33%), Positives = 45/78 (57%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGL  ++++ ++   FS+FGT+ + E+  DK   +++GF F+ F++    +       
Sbjct: 101 FVGGLKGDVAEGDLIEHFSQFGTVEKAEIIADKQSGKKRGFGFVYFQNHDAADKAAVVKF 160

Query: 435 RTIGGKEVDVKRATPKPD 488
             I G  V+VK+A PK D
Sbjct: 161 HPIQGHRVEVKKAVPKED 178



 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 22/84 (26%), Positives = 43/84 (51%), Gaps = 2/84 (2%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGL+ + S+  +R  F  FGT+ +  +  +    + + F F+T+ + +  +  +    
Sbjct: 10  FIGGLNVQTSESGLRGHFEAFGTLTDCVVVVNPQTKRSRCFGFVTYSNVEEADAAMAASP 69

Query: 435 RTIGGKEVDVKRATPKPDG--PGA 500
             + G  V++KRA  + D   PGA
Sbjct: 70  HAVDGNTVELKRAVSREDSARPGA 93


>BC018949-1|AAH18949.1|  305|Homo sapiens heterogeneous nuclear
           ribonucleoprotein A0 protein.
          Length = 305

 Score = 67.3 bits (157), Expect = 4e-11
 Identities = 31/78 (39%), Positives = 46/78 (58%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLF+GGL+ +T++  LR HF A+G +    V  +P T RSR F F+ +   E  D  MAA
Sbjct: 8   KLFIGGLNVQTSESGLRGHFEAFGTLTDCVVVVNPQTKRSRCFGFVTYSNVEEADAAMAA 67

Query: 190 GEHTINNKKVDPKKAKAR 243
             H ++   V+ K+A +R
Sbjct: 68  SPHAVDGNTVELKRAVSR 85



 Score = 63.7 bits (148), Expect = 5e-10
 Identities = 27/76 (35%), Positives = 43/76 (56%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +KLFVGGL  +  + +L +HF  +G +E   +  D  +G+ RGF F+ F+  ++ DK   
Sbjct: 98  KKLFVGGLKGDVAEGDLIEHFSQFGTVEKAEIIADKQSGKKRGFGFVYFQNHDAADKAAV 157

Query: 187 AGEHTINNKKVDPKKA 234
              H I   +V+ KKA
Sbjct: 158 VKFHPIQGHRVEVKKA 173



 Score = 60.5 bits (140), Expect = 5e-09
 Identities = 26/78 (33%), Positives = 45/78 (57%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGL  ++++ ++   FS+FGT+ + E+  DK   +++GF F+ F++    +       
Sbjct: 101 FVGGLKGDVAEGDLIEHFSQFGTVEKAEIIADKQSGKKRGFGFVYFQNHDAADKAAVVKF 160

Query: 435 RTIGGKEVDVKRATPKPD 488
             I G  V+VK+A PK D
Sbjct: 161 HPIQGHRVEVKKAVPKED 178



 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 22/84 (26%), Positives = 43/84 (51%), Gaps = 2/84 (2%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGL+ + S+  +R  F  FGT+ +  +  +    + + F F+T+ + +  +  +    
Sbjct: 10  FIGGLNVQTSESGLRGHFEAFGTLTDCVVVVNPQTKRSRCFGFVTYSNVEEADAAMAASP 69

Query: 435 RTIGGKEVDVKRATPKPDG--PGA 500
             + G  V++KRA  + D   PGA
Sbjct: 70  HAVDGNTVELKRAVSREDSARPGA 93


>BC012980-1|AAH12980.1|  305|Homo sapiens heterogeneous nuclear
           ribonucleoprotein A0 protein.
          Length = 305

 Score = 67.3 bits (157), Expect = 4e-11
 Identities = 31/78 (39%), Positives = 46/78 (58%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLF+GGL+ +T++  LR HF A+G +    V  +P T RSR F F+ +   E  D  MAA
Sbjct: 8   KLFIGGLNVQTSESGLRGHFEAFGTLTDCVVVVNPQTKRSRCFGFVTYSNVEEADAAMAA 67

Query: 190 GEHTINNKKVDPKKAKAR 243
             H ++   V+ K+A +R
Sbjct: 68  SPHAVDGNTVELKRAVSR 85



 Score = 63.7 bits (148), Expect = 5e-10
 Identities = 27/76 (35%), Positives = 43/76 (56%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +KLFVGGL  +  + +L +HF  +G +E   +  D  +G+ RGF F+ F+  ++ DK   
Sbjct: 98  KKLFVGGLKGDVAEGDLIEHFSQFGTVEKAEIIADKQSGKKRGFGFVYFQNHDAADKAAV 157

Query: 187 AGEHTINNKKVDPKKA 234
              H I   +V+ KKA
Sbjct: 158 VKFHPIQGHRVEVKKA 173



 Score = 60.5 bits (140), Expect = 5e-09
 Identities = 26/78 (33%), Positives = 45/78 (57%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGL  ++++ ++   FS+FGT+ + E+  DK   +++GF F+ F++    +       
Sbjct: 101 FVGGLKGDVAEGDLIEHFSQFGTVEKAEIIADKQSGKKRGFGFVYFQNHDAADKAAVVKF 160

Query: 435 RTIGGKEVDVKRATPKPD 488
             I G  V+VK+A PK D
Sbjct: 161 HPIQGHRVEVKKAVPKED 178



 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 22/84 (26%), Positives = 43/84 (51%), Gaps = 2/84 (2%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGL+ + S+  +R  F  FGT+ +  +  +    + + F F+T+ + +  +  +    
Sbjct: 10  FIGGLNVQTSESGLRGHFEAFGTLTDCVVVVNPQTKRSRCFGFVTYSNVEEADAAMAASP 69

Query: 435 RTIGGKEVDVKRATPKPDG--PGA 500
             + G  V++KRA  + D   PGA
Sbjct: 70  HAVDGNTVELKRAVSREDSARPGA 93


>BC011972-1|AAH11972.1|  305|Homo sapiens heterogeneous nuclear
           ribonucleoprotein A0 protein.
          Length = 305

 Score = 67.3 bits (157), Expect = 4e-11
 Identities = 31/78 (39%), Positives = 46/78 (58%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLF+GGL+ +T++  LR HF A+G +    V  +P T RSR F F+ +   E  D  MAA
Sbjct: 8   KLFIGGLNVQTSESGLRGHFEAFGTLTDCVVVVNPQTKRSRCFGFVTYSNVEEADAAMAA 67

Query: 190 GEHTINNKKVDPKKAKAR 243
             H ++   V+ K+A +R
Sbjct: 68  SPHAVDGNTVELKRAVSR 85



 Score = 63.7 bits (148), Expect = 5e-10
 Identities = 27/76 (35%), Positives = 43/76 (56%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +KLFVGGL  +  + +L +HF  +G +E   +  D  +G+ RGF F+ F+  ++ DK   
Sbjct: 98  KKLFVGGLKGDVAEGDLIEHFSQFGTVEKAEIIADKQSGKKRGFGFVYFQNHDAADKAAV 157

Query: 187 AGEHTINNKKVDPKKA 234
              H I   +V+ KKA
Sbjct: 158 VKFHPIQGHRVEVKKA 173



 Score = 60.5 bits (140), Expect = 5e-09
 Identities = 26/78 (33%), Positives = 45/78 (57%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGL  ++++ ++   FS+FGT+ + E+  DK   +++GF F+ F++    +       
Sbjct: 101 FVGGLKGDVAEGDLIEHFSQFGTVEKAEIIADKQSGKKRGFGFVYFQNHDAADKAAVVKF 160

Query: 435 RTIGGKEVDVKRATPKPD 488
             I G  V+VK+A PK D
Sbjct: 161 HPIQGHRVEVKKAVPKED 178



 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 22/84 (26%), Positives = 43/84 (51%), Gaps = 2/84 (2%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGL+ + S+  +R  F  FGT+ +  +  +    + + F F+T+ + +  +  +    
Sbjct: 10  FIGGLNVQTSESGLRGHFEAFGTLTDCVVVVNPQTKRSRCFGFVTYSNVEEADAAMAASP 69

Query: 435 RTIGGKEVDVKRATPKPDG--PGA 500
             + G  V++KRA  + D   PGA
Sbjct: 70  HAVDGNTVELKRAVSREDSARPGA 93


>BC009284-1|AAH09284.1|  305|Homo sapiens heterogeneous nuclear
           ribonucleoprotein A0 protein.
          Length = 305

 Score = 67.3 bits (157), Expect = 4e-11
 Identities = 31/78 (39%), Positives = 46/78 (58%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLF+GGL+ +T++  LR HF A+G +    V  +P T RSR F F+ +   E  D  MAA
Sbjct: 8   KLFIGGLNVQTSESGLRGHFEAFGTLTDCVVVVNPQTKRSRCFGFVTYSNVEEADAAMAA 67

Query: 190 GEHTINNKKVDPKKAKAR 243
             H ++   V+ K+A +R
Sbjct: 68  SPHAVDGNTVELKRAVSR 85



 Score = 63.7 bits (148), Expect = 5e-10
 Identities = 27/76 (35%), Positives = 43/76 (56%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +KLFVGGL  +  + +L +HF  +G +E   +  D  +G+ RGF F+ F+  ++ DK   
Sbjct: 98  KKLFVGGLKGDVAEGDLIEHFSQFGTVEKAEIIADKQSGKKRGFGFVYFQNHDAADKAAV 157

Query: 187 AGEHTINNKKVDPKKA 234
              H I   +V+ KKA
Sbjct: 158 VKFHPIQGHRVEVKKA 173



 Score = 60.5 bits (140), Expect = 5e-09
 Identities = 26/78 (33%), Positives = 45/78 (57%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGL  ++++ ++   FS+FGT+ + E+  DK   +++GF F+ F++    +       
Sbjct: 101 FVGGLKGDVAEGDLIEHFSQFGTVEKAEIIADKQSGKKRGFGFVYFQNHDAADKAAVVKF 160

Query: 435 RTIGGKEVDVKRATPKPD 488
             I G  V+VK+A PK D
Sbjct: 161 HPIQGHRVEVKKAVPKED 178



 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 22/84 (26%), Positives = 43/84 (51%), Gaps = 2/84 (2%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGL+ + S+  +R  F  FGT+ +  +  +    + + F F+T+ + +  +  +    
Sbjct: 10  FIGGLNVQTSESGLRGHFEAFGTLTDCVVVVNPQTKRSRCFGFVTYSNVEEADAAMAASP 69

Query: 435 RTIGGKEVDVKRATPKPDG--PGA 500
             + G  V++KRA  + D   PGA
Sbjct: 70  HAVDGNTVELKRAVSREDSARPGA 93


>BC007271-1|AAH07271.1|  305|Homo sapiens heterogeneous nuclear
           ribonucleoprotein A0 protein.
          Length = 305

 Score = 67.3 bits (157), Expect = 4e-11
 Identities = 31/78 (39%), Positives = 46/78 (58%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLF+GGL+ +T++  LR HF A+G +    V  +P T RSR F F+ +   E  D  MAA
Sbjct: 8   KLFIGGLNVQTSESGLRGHFEAFGTLTDCVVVVNPQTKRSRCFGFVTYSNVEEADAAMAA 67

Query: 190 GEHTINNKKVDPKKAKAR 243
             H ++   V+ K+A +R
Sbjct: 68  SPHAVDGNTVELKRAVSR 85



 Score = 63.7 bits (148), Expect = 5e-10
 Identities = 27/76 (35%), Positives = 43/76 (56%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +KLFVGGL  +  + +L +HF  +G +E   +  D  +G+ RGF F+ F+  ++ DK   
Sbjct: 98  KKLFVGGLKGDVAEGDLIEHFSQFGTVEKAEIIADKQSGKKRGFGFVYFQNHDAADKAAV 157

Query: 187 AGEHTINNKKVDPKKA 234
              H I   +V+ KKA
Sbjct: 158 VKFHPIQGHRVEVKKA 173



 Score = 60.5 bits (140), Expect = 5e-09
 Identities = 26/78 (33%), Positives = 45/78 (57%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGL  ++++ ++   FS+FGT+ + E+  DK   +++GF F+ F++    +       
Sbjct: 101 FVGGLKGDVAEGDLIEHFSQFGTVEKAEIIADKQSGKKRGFGFVYFQNHDAADKAAVVKF 160

Query: 435 RTIGGKEVDVKRATPKPD 488
             I G  V+VK+A PK D
Sbjct: 161 HPIQGHRVEVKKAVPKED 178



 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 22/84 (26%), Positives = 43/84 (51%), Gaps = 2/84 (2%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGL+ + S+  +R  F  FGT+ +  +  +    + + F F+T+ + +  +  +    
Sbjct: 10  FIGGLNVQTSESGLRGHFEAFGTLTDCVVVVNPQTKRSRCFGFVTYSNVEEADAAMAASP 69

Query: 435 RTIGGKEVDVKRATPKPDG--PGA 500
             + G  V++KRA  + D   PGA
Sbjct: 70  HAVDGNTVELKRAVSREDSARPGA 93


>BC001008-1|AAH01008.1|  305|Homo sapiens heterogeneous nuclear
           ribonucleoprotein A0 protein.
          Length = 305

 Score = 67.3 bits (157), Expect = 4e-11
 Identities = 31/78 (39%), Positives = 46/78 (58%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLF+GGL+ +T++  LR HF A+G +    V  +P T RSR F F+ +   E  D  MAA
Sbjct: 8   KLFIGGLNVQTSESGLRGHFEAFGTLTDCVVVVNPQTKRSRCFGFVTYSNVEEADAAMAA 67

Query: 190 GEHTINNKKVDPKKAKAR 243
             H ++   V+ K+A +R
Sbjct: 68  SPHAVDGNTVELKRAVSR 85



 Score = 63.7 bits (148), Expect = 5e-10
 Identities = 27/76 (35%), Positives = 43/76 (56%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +KLFVGGL  +  + +L +HF  +G +E   +  D  +G+ RGF F+ F+  ++ DK   
Sbjct: 98  KKLFVGGLKGDVAEGDLIEHFSQFGTVEKAEIIADKQSGKKRGFGFVYFQNHDAADKAAV 157

Query: 187 AGEHTINNKKVDPKKA 234
              H I   +V+ KKA
Sbjct: 158 VKFHPIQGHRVEVKKA 173



 Score = 60.5 bits (140), Expect = 5e-09
 Identities = 26/78 (33%), Positives = 45/78 (57%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGL  ++++ ++   FS+FGT+ + E+  DK   +++GF F+ F++    +       
Sbjct: 101 FVGGLKGDVAEGDLIEHFSQFGTVEKAEIIADKQSGKKRGFGFVYFQNHDAADKAAVVKF 160

Query: 435 RTIGGKEVDVKRATPKPD 488
             I G  V+VK+A PK D
Sbjct: 161 HPIQGHRVEVKKAVPKED 178



 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 22/84 (26%), Positives = 43/84 (51%), Gaps = 2/84 (2%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGL+ + S+  +R  F  FGT+ +  +  +    + + F F+T+ + +  +  +    
Sbjct: 10  FIGGLNVQTSESGLRGHFEAFGTLTDCVVVVNPQTKRSRCFGFVTYSNVEEADAAMAASP 69

Query: 435 RTIGGKEVDVKRATPKPDG--PGA 500
             + G  V++KRA  + D   PGA
Sbjct: 70  HAVDGNTVELKRAVSREDSARPGA 93


>U28686-1|AAB17212.1|  157|Homo sapiens RNPL protein.
          Length = 157

 Score = 64.1 bits (149), Expect = 4e-10
 Identities = 32/79 (40%), Positives = 45/79 (56%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLFVGGL++ T ++ L DHF ++G I  + V  D  T RSRGF FI F  PE     M A
Sbjct: 7   KLFVGGLNFNTDEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNPEHASVAMRA 66

Query: 190 GEHTINNKKVDPKKAKARH 246
               +N + +D ++ +  H
Sbjct: 67  ----MNGESLDGRQIRVDH 81



 Score = 43.2 bits (97), Expect = 8e-04
 Identities = 22/74 (29%), Positives = 40/74 (54%), Gaps = 1/74 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGL+    +  + + FS FG I EV +  D+   + +GF FITF + +  +  ++   
Sbjct: 9   FVGGLNFNTDEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNPEHASVAMRAMN 68

Query: 435 -RTIGGKEVDVKRA 473
             ++ G+++ V  A
Sbjct: 69  GESLDGRQIRVDHA 82


>BC006825-1|AAH06825.1|  157|Homo sapiens RNA binding motif (RNP1,
           RRM) protein 3 protein.
          Length = 157

 Score = 64.1 bits (149), Expect = 4e-10
 Identities = 32/79 (40%), Positives = 45/79 (56%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLFVGGL++ T ++ L DHF ++G I  + V  D  T RSRGF FI F  PE     M A
Sbjct: 7   KLFVGGLNFNTDEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNPEHASVAMRA 66

Query: 190 GEHTINNKKVDPKKAKARH 246
               +N + +D ++ +  H
Sbjct: 67  ----MNGESLDGRQIRVDH 81



 Score = 43.2 bits (97), Expect = 8e-04
 Identities = 22/74 (29%), Positives = 40/74 (54%), Gaps = 1/74 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGL+    +  + + FS FG I EV +  D+   + +GF FITF + +  +  ++   
Sbjct: 9   FVGGLNFNTDEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNPEHASVAMRAMN 68

Query: 435 -RTIGGKEVDVKRA 473
             ++ G+++ V  A
Sbjct: 69  GESLDGRQIRVDHA 82


>X03910-1|CAA27544.1|  225|Homo sapiens protein ( Human mRNA for
           hnRNP C protein cross-reacting with C1 and C2 hnRNP
           core proteins.  ).
          Length = 225

 Score = 62.5 bits (145), Expect = 1e-09
 Identities = 24/50 (48%), Positives = 35/50 (70%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQ 404
           FVGGLS +  +++IR +F  FG +  +E+P D   N+R+GFCFITF  E+
Sbjct: 175 FVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFNQEE 224



 Score = 61.3 bits (142), Expect = 3e-09
 Identities = 25/53 (47%), Positives = 38/53 (71%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPE 165
           +K+FVGGLS +T ++++R++FG +GE+ESI +  D  T + RGF FI F   E
Sbjct: 172 KKIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFNQEE 224


>AF069682-1|AAC24858.2|  392|Homo sapiens testes specific
           heterogenous nuclear ribonucleoprotein G-T protein.
          Length = 392

 Score = 62.1 bits (144), Expect = 2e-09
 Identities = 34/79 (43%), Positives = 46/79 (58%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           R  KLF+GGL+ ET +K L   FG YG I  + +  D  T +SRGFAF+ F++P   D  
Sbjct: 6   RPGKLFIGGLNLETDEKALEAEFGKYGRIVEVLLMKDRETNKSRGFAFVTFESP--ADAK 63

Query: 181 MAAGEHTINNKKVDPKKAK 237
            AA +  +N K +D K  K
Sbjct: 64  AAARD--MNGKSLDGKAIK 80



 Score = 49.2 bits (112), Expect = 1e-05
 Identities = 26/78 (33%), Positives = 44/78 (56%), Gaps = 1/78 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGL+ E  +  +   F ++G I+EV +  D+  N+ +GF F+TFES        +   
Sbjct: 11  FIGGLNLETDEKALEAEFGKYGRIVEVLLMKDRETNKSRGFAFVTFESPADAKAAARDMN 70

Query: 435 -RTIGGKEVDVKRATPKP 485
            +++ GK + V +AT KP
Sbjct: 71  GKSLDGKAIKVAQAT-KP 87


>U23731-1|AAA70033.1|  414|Homo sapiens TAR DNA-binding protein-43
           protein.
          Length = 414

 Score = 61.3 bits (142), Expect = 3e-09
 Identities = 32/91 (35%), Positives = 54/91 (59%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           L V GL W+TT+++L+++F  +GE+  + VK D  TG S+GF F+ F   E+  KVM+  
Sbjct: 106 LIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQ- 164

Query: 193 EHTINNKKVDPKKAKARHGKILSEDSAVKSQ 285
            H I+ +  D K   ++     S+D  ++S+
Sbjct: 165 RHMIDGRWCDCKLPNSKQ----SQDEPLRSR 191



 Score = 46.4 bits (105), Expect = 9e-05
 Identities = 24/76 (31%), Positives = 41/76 (53%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVG  + ++++DE+R FFS++G +++V +P        + F F+TF  +Q+   L     
Sbjct: 194 FVGRCTEDMTEDELREFFSQYGDVMDVFIP-----KPFRAFAFVTFADDQIAQSLC-GED 247

Query: 435 RTIGGKEVDVKRATPK 482
             I G  V +  A PK
Sbjct: 248 LIIKGISVHISNAEPK 263



 Score = 36.7 bits (81), Expect = 0.069
 Identities = 20/73 (27%), Positives = 36/73 (49%)
 Frame = +3

Query: 264 GLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTI 443
           GL  + ++ +++ +FS FG +L V++  D      KGF F+ F +E      + + +  I
Sbjct: 110 GLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRF-TEYETQVKVMSQRHMI 168

Query: 444 GGKEVDVKRATPK 482
            G+  D K    K
Sbjct: 169 DGRWCDCKLPNSK 181



 Score = 36.7 bits (81), Expect = 0.069
 Identities = 23/82 (28%), Positives = 39/82 (47%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           R  K+FVG  + + T+ ELR+ F  YG++  + +         R FAF+ F A + I + 
Sbjct: 189 RSRKVFVGRCTEDMTEDELREFFSQYGDVMDVFIPKP-----FRAFAFVTF-ADDQIAQS 242

Query: 181 MAAGEHTINNKKVDPKKAKARH 246
           +   +  I    V    A+ +H
Sbjct: 243 LCGEDLIIKGISVHISNAEPKH 264


>EF434182-1|ABO32291.1|  414|Homo sapiens TDP43 splice variant 1
           protein.
          Length = 414

 Score = 61.3 bits (142), Expect = 3e-09
 Identities = 32/91 (35%), Positives = 54/91 (59%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           L V GL W+TT+++L+++F  +GE+  + VK D  TG S+GF F+ F   E+  KVM+  
Sbjct: 106 LIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQ- 164

Query: 193 EHTINNKKVDPKKAKARHGKILSEDSAVKSQ 285
            H I+ +  D K   ++     S+D  ++S+
Sbjct: 165 RHMIDGRWCDCKLPNSKQ----SQDEPLRSR 191



 Score = 46.4 bits (105), Expect = 9e-05
 Identities = 24/76 (31%), Positives = 41/76 (53%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVG  + ++++DE+R FFS++G +++V +P        + F F+TF  +Q+   L     
Sbjct: 194 FVGRCTEDMTEDELREFFSQYGDVMDVFIP-----KPFRAFAFVTFADDQIAQSLC-GED 247

Query: 435 RTIGGKEVDVKRATPK 482
             I G  V +  A PK
Sbjct: 248 LIIKGISVHISNAEPK 263



 Score = 36.7 bits (81), Expect = 0.069
 Identities = 20/73 (27%), Positives = 36/73 (49%)
 Frame = +3

Query: 264 GLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTI 443
           GL  + ++ +++ +FS FG +L V++  D      KGF F+ F +E      + + +  I
Sbjct: 110 GLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRF-TEYETQVKVMSQRHMI 168

Query: 444 GGKEVDVKRATPK 482
            G+  D K    K
Sbjct: 169 DGRWCDCKLPNSK 181



 Score = 36.7 bits (81), Expect = 0.069
 Identities = 23/82 (28%), Positives = 39/82 (47%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           R  K+FVG  + + T+ ELR+ F  YG++  + +         R FAF+ F A + I + 
Sbjct: 189 RSRKVFVGRCTEDMTEDELREFFSQYGDVMDVFIPKP-----FRAFAFVTF-ADDQIAQS 242

Query: 181 MAAGEHTINNKKVDPKKAKARH 246
           +   +  I    V    A+ +H
Sbjct: 243 LCGEDLIIKGISVHISNAEPKH 264


>EF434181-1|ABO32290.1|  416|Homo sapiens TDP43 protein.
          Length = 416

 Score = 61.3 bits (142), Expect = 3e-09
 Identities = 32/91 (35%), Positives = 54/91 (59%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           L V GL W+TT+++L+++F  +GE+  + VK D  TG S+GF F+ F   E+  KVM+  
Sbjct: 106 LIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQ- 164

Query: 193 EHTINNKKVDPKKAKARHGKILSEDSAVKSQ 285
            H I+ +  D K   ++     S+D  ++S+
Sbjct: 165 RHMIDGRWCDCKLPNSKQ----SQDEPLRSR 191



 Score = 46.4 bits (105), Expect = 9e-05
 Identities = 24/76 (31%), Positives = 41/76 (53%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVG  + ++++DE+R FFS++G +++V +P        + F F+TF  +Q+   L     
Sbjct: 194 FVGRCTEDMTEDELREFFSQYGDVMDVFIP-----KPFRAFAFVTFADDQIAQSLC-GED 247

Query: 435 RTIGGKEVDVKRATPK 482
             I G  V +  A PK
Sbjct: 248 LIIKGISVHISNAEPK 263



 Score = 36.7 bits (81), Expect = 0.069
 Identities = 20/73 (27%), Positives = 36/73 (49%)
 Frame = +3

Query: 264 GLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTI 443
           GL  + ++ +++ +FS FG +L V++  D      KGF F+ F +E      + + +  I
Sbjct: 110 GLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRF-TEYETQVKVMSQRHMI 168

Query: 444 GGKEVDVKRATPK 482
            G+  D K    K
Sbjct: 169 DGRWCDCKLPNSK 181



 Score = 36.7 bits (81), Expect = 0.069
 Identities = 23/82 (28%), Positives = 39/82 (47%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           R  K+FVG  + + T+ ELR+ F  YG++  + +         R FAF+ F A + I + 
Sbjct: 189 RSRKVFVGRCTEDMTEDELREFFSQYGDVMDVFIPKP-----FRAFAFVTF-ADDQIAQS 242

Query: 181 MAAGEHTINNKKVDPKKAKARH 246
           +   +  I    V    A+ +H
Sbjct: 243 LCGEDLIIKGISVHISNAEPKH 264


>CR533534-1|CAG38565.1|  414|Homo sapiens TARDBP protein.
          Length = 414

 Score = 61.3 bits (142), Expect = 3e-09
 Identities = 32/91 (35%), Positives = 54/91 (59%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           L V GL W+TT+++L+++F  +GE+  + VK D  TG S+GF F+ F   E+  KVM+  
Sbjct: 106 LIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQ- 164

Query: 193 EHTINNKKVDPKKAKARHGKILSEDSAVKSQ 285
            H I+ +  D K   ++     S+D  ++S+
Sbjct: 165 RHMIDGRWCDCKLPNSKQ----SQDEPLRSR 191



 Score = 46.4 bits (105), Expect = 9e-05
 Identities = 24/76 (31%), Positives = 41/76 (53%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVG  + ++++DE+R FFS++G +++V +P        + F F+TF  +Q+   L     
Sbjct: 194 FVGRCTEDMTEDELREFFSQYGDVMDVFIP-----KPFRAFAFVTFADDQIAQSLC-GED 247

Query: 435 RTIGGKEVDVKRATPK 482
             I G  V +  A PK
Sbjct: 248 LIIKGISVHISNAEPK 263



 Score = 36.7 bits (81), Expect = 0.069
 Identities = 20/73 (27%), Positives = 36/73 (49%)
 Frame = +3

Query: 264 GLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTI 443
           GL  + ++ +++ +FS FG +L V++  D      KGF F+ F +E      + + +  I
Sbjct: 110 GLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRF-TEYETQVKVMSQRHMI 168

Query: 444 GGKEVDVKRATPK 482
            G+  D K    K
Sbjct: 169 DGRWCDCKLPNSK 181



 Score = 36.7 bits (81), Expect = 0.069
 Identities = 23/82 (28%), Positives = 39/82 (47%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           R  K+FVG  + + T+ ELR+ F  YG++  + +         R FAF+ F A + I + 
Sbjct: 189 RSRKVFVGRCTEDMTEDELREFFSQYGDVMDVFIPKP-----FRAFAFVTF-ADDQIAQS 242

Query: 181 MAAGEHTINNKKVDPKKAKARH 246
           +   +  I    V    A+ +H
Sbjct: 243 LCGEDLIIKGISVHISNAEPKH 264


>BC095435-1|AAH95435.1|  414|Homo sapiens TAR DNA binding protein
           protein.
          Length = 414

 Score = 61.3 bits (142), Expect = 3e-09
 Identities = 32/91 (35%), Positives = 54/91 (59%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           L V GL W+TT+++L+++F  +GE+  + VK D  TG S+GF F+ F   E+  KVM+  
Sbjct: 106 LIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQ- 164

Query: 193 EHTINNKKVDPKKAKARHGKILSEDSAVKSQ 285
            H I+ +  D K   ++     S+D  ++S+
Sbjct: 165 RHMIDGRWCDCKLPNSKQ----SQDEPLRSR 191



 Score = 46.4 bits (105), Expect = 9e-05
 Identities = 24/76 (31%), Positives = 41/76 (53%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVG  + ++++DE+R FFS++G +++V +P        + F F+TF  +Q+   L     
Sbjct: 194 FVGRCTEDMTEDELREFFSQYGDVMDVFIP-----KPFRAFAFVTFADDQIAQSLC-GED 247

Query: 435 RTIGGKEVDVKRATPK 482
             I G  V +  A PK
Sbjct: 248 LIIKGISVHISNAEPK 263



 Score = 36.7 bits (81), Expect = 0.069
 Identities = 20/73 (27%), Positives = 36/73 (49%)
 Frame = +3

Query: 264 GLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTI 443
           GL  + ++ +++ +FS FG +L V++  D      KGF F+ F +E      + + +  I
Sbjct: 110 GLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRF-TEYETQVKVMSQRHMI 168

Query: 444 GGKEVDVKRATPK 482
            G+  D K    K
Sbjct: 169 DGRWCDCKLPNSK 181



 Score = 36.7 bits (81), Expect = 0.069
 Identities = 23/82 (28%), Positives = 39/82 (47%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           R  K+FVG  + + T+ ELR+ F  YG++  + +         R FAF+ F A + I + 
Sbjct: 189 RSRKVFVGRCTEDMTEDELREFFSQYGDVMDVFIPKP-----FRAFAFVTF-ADDQIAQS 242

Query: 181 MAAGEHTINNKKVDPKKAKARH 246
           +   +  I    V    A+ +H
Sbjct: 243 LCGEDLIIKGISVHISNAEPKH 264


>BC071657-1|AAH71657.1|  414|Homo sapiens TARDBP protein protein.
          Length = 414

 Score = 61.3 bits (142), Expect = 3e-09
 Identities = 32/91 (35%), Positives = 54/91 (59%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           L V GL W+TT+++L+++F  +GE+  + VK D  TG S+GF F+ F   E+  KVM+  
Sbjct: 106 LIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQ- 164

Query: 193 EHTINNKKVDPKKAKARHGKILSEDSAVKSQ 285
            H I+ +  D K   ++     S+D  ++S+
Sbjct: 165 RHMIDGRWCDCKLPNSKQ----SQDEPLRSR 191



 Score = 46.4 bits (105), Expect = 9e-05
 Identities = 24/76 (31%), Positives = 41/76 (53%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVG  + ++++DE+R FFS++G +++V +P        + F F+TF  +Q+   L     
Sbjct: 194 FVGRCTEDMTEDELREFFSQYGDVMDVFIP-----KPFRAFAFVTFADDQIAQSLC-GED 247

Query: 435 RTIGGKEVDVKRATPK 482
             I G  V +  A PK
Sbjct: 248 LIIKGISVHISNAEPK 263



 Score = 36.7 bits (81), Expect = 0.069
 Identities = 20/73 (27%), Positives = 36/73 (49%)
 Frame = +3

Query: 264 GLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTI 443
           GL  + ++ +++ +FS FG +L V++  D      KGF F+ F +E      + + +  I
Sbjct: 110 GLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRF-TEYETQVKVMSQRHMI 168

Query: 444 GGKEVDVKRATPK 482
            G+  D K    K
Sbjct: 169 DGRWCDCKLPNSK 181



 Score = 36.7 bits (81), Expect = 0.069
 Identities = 23/82 (28%), Positives = 39/82 (47%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           R  K+FVG  + + T+ ELR+ F  YG++  + +         R FAF+ F A + I + 
Sbjct: 189 RSRKVFVGRCTEDMTEDELREFFSQYGDVMDVFIPKP-----FRAFAFVTF-ADDQIAQS 242

Query: 181 MAAGEHTINNKKVDPKKAKARH 246
           +   +  I    V    A+ +H
Sbjct: 243 LCGEDLIIKGISVHISNAEPKH 264


>AL109811-2|CAI22099.1|  295|Homo sapiens TAR DNA binding protein
           protein.
          Length = 295

 Score = 61.3 bits (142), Expect = 3e-09
 Identities = 32/91 (35%), Positives = 54/91 (59%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           L V GL W+TT+++L+++F  +GE+  + VK D  TG S+GF F+ F   E+  KVM+  
Sbjct: 106 LIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQ- 164

Query: 193 EHTINNKKVDPKKAKARHGKILSEDSAVKSQ 285
            H I+ +  D K   ++     S+D  ++S+
Sbjct: 165 RHMIDGRWCDCKLPNSKQ----SQDEPLRSR 191



 Score = 46.4 bits (105), Expect = 9e-05
 Identities = 24/76 (31%), Positives = 41/76 (53%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVG  + ++++DE+R FFS++G +++V +P        + F F+TF  +Q+   L     
Sbjct: 194 FVGRCTEDMTEDELREFFSQYGDVMDVFIP-----KPFRAFAFVTFADDQIAQSLC-GED 247

Query: 435 RTIGGKEVDVKRATPK 482
             I G  V +  A PK
Sbjct: 248 LIIKGISVHISNAEPK 263



 Score = 36.7 bits (81), Expect = 0.069
 Identities = 20/73 (27%), Positives = 36/73 (49%)
 Frame = +3

Query: 264 GLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTI 443
           GL  + ++ +++ +FS FG +L V++  D      KGF F+ F +E      + + +  I
Sbjct: 110 GLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRF-TEYETQVKVMSQRHMI 168

Query: 444 GGKEVDVKRATPK 482
            G+  D K    K
Sbjct: 169 DGRWCDCKLPNSK 181



 Score = 36.7 bits (81), Expect = 0.069
 Identities = 23/82 (28%), Positives = 39/82 (47%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           R  K+FVG  + + T+ ELR+ F  YG++  + +         R FAF+ F A + I + 
Sbjct: 189 RSRKVFVGRCTEDMTEDELREFFSQYGDVMDVFIPKP-----FRAFAFVTF-ADDQIAQS 242

Query: 181 MAAGEHTINNKKVDPKKAKARH 246
           +   +  I    V    A+ +H
Sbjct: 243 LCGEDLIIKGISVHISNAEPKH 264


>AL109811-1|CAI22098.1|  414|Homo sapiens TAR DNA binding protein
           protein.
          Length = 414

 Score = 61.3 bits (142), Expect = 3e-09
 Identities = 32/91 (35%), Positives = 54/91 (59%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           L V GL W+TT+++L+++F  +GE+  + VK D  TG S+GF F+ F   E+  KVM+  
Sbjct: 106 LIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQ- 164

Query: 193 EHTINNKKVDPKKAKARHGKILSEDSAVKSQ 285
            H I+ +  D K   ++     S+D  ++S+
Sbjct: 165 RHMIDGRWCDCKLPNSKQ----SQDEPLRSR 191



 Score = 46.4 bits (105), Expect = 9e-05
 Identities = 24/76 (31%), Positives = 41/76 (53%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVG  + ++++DE+R FFS++G +++V +P        + F F+TF  +Q+   L     
Sbjct: 194 FVGRCTEDMTEDELREFFSQYGDVMDVFIP-----KPFRAFAFVTFADDQIAQSLC-GED 247

Query: 435 RTIGGKEVDVKRATPK 482
             I G  V +  A PK
Sbjct: 248 LIIKGISVHISNAEPK 263



 Score = 36.7 bits (81), Expect = 0.069
 Identities = 20/73 (27%), Positives = 36/73 (49%)
 Frame = +3

Query: 264 GLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTI 443
           GL  + ++ +++ +FS FG +L V++  D      KGF F+ F +E      + + +  I
Sbjct: 110 GLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRF-TEYETQVKVMSQRHMI 168

Query: 444 GGKEVDVKRATPK 482
            G+  D K    K
Sbjct: 169 DGRWCDCKLPNSK 181



 Score = 36.7 bits (81), Expect = 0.069
 Identities = 23/82 (28%), Positives = 39/82 (47%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           R  K+FVG  + + T+ ELR+ F  YG++  + +         R FAF+ F A + I + 
Sbjct: 189 RSRKVFVGRCTEDMTEDELREFFSQYGDVMDVFIPKP-----FRAFAFVTF-ADDQIAQS 242

Query: 181 MAAGEHTINNKKVDPKKAKARH 246
           +   +  I    V    A+ +H
Sbjct: 243 LCGEDLIIKGISVHISNAEPKH 264


>AK222754-1|BAD96474.1|  414|Homo sapiens TAR DNA binding protein
           variant protein.
          Length = 414

 Score = 61.3 bits (142), Expect = 3e-09
 Identities = 32/91 (35%), Positives = 54/91 (59%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           L V GL W+TT+++L+++F  +GE+  + VK D  TG S+GF F+ F   E+  KVM+  
Sbjct: 106 LIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQ- 164

Query: 193 EHTINNKKVDPKKAKARHGKILSEDSAVKSQ 285
            H I+ +  D K   ++     S+D  ++S+
Sbjct: 165 RHMIDGRWCDCKLPNSKQ----SQDEPLRSR 191



 Score = 46.4 bits (105), Expect = 9e-05
 Identities = 24/76 (31%), Positives = 41/76 (53%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVG  + ++++DE+R FFS++G +++V +P        + F F+TF  +Q+   L     
Sbjct: 194 FVGRCTGDMTEDELREFFSQYGDVMDVFIP-----KPFRAFAFVTFADDQIAQSLC-GED 247

Query: 435 RTIGGKEVDVKRATPK 482
             I G  V +  A PK
Sbjct: 248 LIIKGISVHISNAEPK 263



 Score = 37.1 bits (82), Expect = 0.052
 Identities = 23/82 (28%), Positives = 39/82 (47%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           R  K+FVG  + + T+ ELR+ F  YG++  + +         R FAF+ F A + I + 
Sbjct: 189 RSRKVFVGRCTGDMTEDELREFFSQYGDVMDVFIPKP-----FRAFAFVTF-ADDQIAQS 242

Query: 181 MAAGEHTINNKKVDPKKAKARH 246
           +   +  I    V    A+ +H
Sbjct: 243 LCGEDLIIKGISVHISNAEPKH 264



 Score = 36.7 bits (81), Expect = 0.069
 Identities = 20/73 (27%), Positives = 36/73 (49%)
 Frame = +3

Query: 264 GLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTI 443
           GL  + ++ +++ +FS FG +L V++  D      KGF F+ F +E      + + +  I
Sbjct: 110 GLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRF-TEYETQVKVMSQRHMI 168

Query: 444 GGKEVDVKRATPK 482
            G+  D K    K
Sbjct: 169 DGRWCDCKLPNSK 181


>AF279289-1|AAF82129.1|  386|Homo sapiens testes-specific
           heterogenous nuclear ribonucleoprotein G-T protein.
          Length = 386

 Score = 60.9 bits (141), Expect = 4e-09
 Identities = 31/76 (40%), Positives = 42/76 (55%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLF+GGL+ ET +K L   FG YG I  + +  D  T +SRGFAF+ F++P        A
Sbjct: 3   KLFIGGLNLETDEKALEAEFGKYGRIVEVLLMKDRETNKSRGFAFVTFESPAD----AKA 58

Query: 190 GEHTINNKKVDPKKAK 237
               +N K +D K  K
Sbjct: 59  AVRDMNGKSLDGKAIK 74



 Score = 50.0 bits (114), Expect = 7e-06
 Identities = 26/78 (33%), Positives = 45/78 (57%), Gaps = 1/78 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGL+ E  +  +   F ++G I+EV +  D+  N+ +GF F+TFES       ++   
Sbjct: 5   FIGGLNLETDEKALEAEFGKYGRIVEVLLMKDRETNKSRGFAFVTFESPADAKAAVRDMN 64

Query: 435 -RTIGGKEVDVKRATPKP 485
            +++ GK + V +AT KP
Sbjct: 65  GKSLDGKAIKVAQAT-KP 81


>Z23064-1|CAA80599.1|  391|Homo sapiens hnRNP G protein protein.
          Length = 391

 Score = 60.5 bits (140), Expect = 5e-09
 Identities = 34/79 (43%), Positives = 46/79 (58%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           R  KLF+GGL+ ET +K L   FG YG I  + +  D  T +SRGFAF+ F++P   D  
Sbjct: 6   RPGKLFIGGLNTETNEKALEAVFGKYGRIVEVLLMKDRETNKSRGFAFVTFESP--ADAK 63

Query: 181 MAAGEHTINNKKVDPKKAK 237
            AA +  +N K +D K  K
Sbjct: 64  DAARD--MNGKSLDGKAIK 80



 Score = 55.6 bits (128), Expect = 1e-07
 Identities = 27/78 (34%), Positives = 48/78 (61%), Gaps = 1/78 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGL++E ++  +   F ++G I+EV +  D+  N+ +GF F+TFES     D  +   
Sbjct: 11  FIGGLNTETNEKALEAVFGKYGRIVEVLLMKDRETNKSRGFAFVTFESPADAKDAARDMN 70

Query: 435 -RTIGGKEVDVKRATPKP 485
            +++ GK + V++AT KP
Sbjct: 71  GKSLDGKAIKVEQAT-KP 87


>BC057796-1|AAH57796.1|  392|Homo sapiens RNA binding motif protein,
           X-linked-like 2 protein.
          Length = 392

 Score = 60.5 bits (140), Expect = 5e-09
 Identities = 33/79 (41%), Positives = 45/79 (56%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           R  KLF+GG + ET +K L   FG YG I  + +  D  T +SRGFAF+ F++P   D  
Sbjct: 6   RPGKLFIGGFNLETDEKALEAEFGKYGRIVEVLLMKDRETNKSRGFAFVTFESP--ADAK 63

Query: 181 MAAGEHTINNKKVDPKKAK 237
            AA +  +N K +D K  K
Sbjct: 64  AAARD--MNGKSLDGKAIK 80



 Score = 47.6 bits (108), Expect = 4e-05
 Identities = 25/78 (32%), Positives = 43/78 (55%), Gaps = 1/78 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GG + E  +  +   F ++G I+EV +  D+  N+ +GF F+TFES        +   
Sbjct: 11  FIGGFNLETDEKALEAEFGKYGRIVEVLLMKDRETNKSRGFAFVTFESPADAKAAARDMN 70

Query: 435 -RTIGGKEVDVKRATPKP 485
            +++ GK + V +AT KP
Sbjct: 71  GKSLDGKAIKVAQAT-KP 87


>BC007435-1|AAH07435.1|  391|Homo sapiens RNA binding motif protein,
           X-linked protein.
          Length = 391

 Score = 60.5 bits (140), Expect = 5e-09
 Identities = 34/79 (43%), Positives = 46/79 (58%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           R  KLF+GGL+ ET +K L   FG YG I  + +  D  T +SRGFAF+ F++P   D  
Sbjct: 6   RPGKLFIGGLNTETNEKALEAVFGKYGRIVEVLLMKDRETNKSRGFAFVTFESP--ADAK 63

Query: 181 MAAGEHTINNKKVDPKKAK 237
            AA +  +N K +D K  K
Sbjct: 64  DAARD--MNGKSLDGKAIK 80



 Score = 55.6 bits (128), Expect = 1e-07
 Identities = 27/78 (34%), Positives = 48/78 (61%), Gaps = 1/78 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGL++E ++  +   F ++G I+EV +  D+  N+ +GF F+TFES     D  +   
Sbjct: 11  FIGGLNTETNEKALEAVFGKYGRIVEVLLMKDRETNKSRGFAFVTFESPADAKDAARDMN 70

Query: 435 -RTIGGKEVDVKRATPKP 485
            +++ GK + V++AT KP
Sbjct: 71  GKSLDGKAIKVEQAT-KP 87


>BC006550-1|AAH06550.1|  391|Homo sapiens RNA binding motif protein,
           X-linked protein.
          Length = 391

 Score = 60.5 bits (140), Expect = 5e-09
 Identities = 34/79 (43%), Positives = 46/79 (58%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           R  KLF+GGL+ ET +K L   FG YG I  + +  D  T +SRGFAF+ F++P   D  
Sbjct: 6   RPGKLFIGGLNTETNEKALEAVFGKYGRIVEVLLMKDRETNKSRGFAFVTFESP--ADAK 63

Query: 181 MAAGEHTINNKKVDPKKAK 237
            AA +  +N K +D K  K
Sbjct: 64  DAARD--MNGKSLDGKAIK 80



 Score = 55.6 bits (128), Expect = 1e-07
 Identities = 27/78 (34%), Positives = 48/78 (61%), Gaps = 1/78 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGL++E ++  +   F ++G I+EV +  D+  N+ +GF F+TFES     D  +   
Sbjct: 11  FIGGLNTETNEKALEAVFGKYGRIVEVLLMKDRETNKSRGFAFVTFESPADAKDAARDMN 70

Query: 435 -RTIGGKEVDVKRATPKP 485
            +++ GK + V++AT KP
Sbjct: 71  GKSLDGKAIKVEQAT-KP 87


>AY464692-1|AAR28036.1|  391|Homo sapiens heterogeneous nuclear
           ribonucleoprotein G protein.
          Length = 391

 Score = 60.5 bits (140), Expect = 5e-09
 Identities = 34/79 (43%), Positives = 46/79 (58%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           R  KLF+GGL+ ET +K L   FG YG I  + +  D  T +SRGFAF+ F++P   D  
Sbjct: 6   RPGKLFIGGLNTETNEKALEAVFGKYGRIVEVLLMKDRETNKSRGFAFVTFESP--ADAK 63

Query: 181 MAAGEHTINNKKVDPKKAK 237
            AA +  +N K +D K  K
Sbjct: 64  DAARD--MNGKSLDGKAIK 80



 Score = 55.6 bits (128), Expect = 1e-07
 Identities = 27/78 (34%), Positives = 48/78 (61%), Gaps = 1/78 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGL++E ++  +   F ++G I+EV +  D+  N+ +GF F+TFES     D  +   
Sbjct: 11  FIGGLNTETNEKALEAVFGKYGRIVEVLLMKDRETNKSRGFAFVTFESPADAKDAARDMN 70

Query: 435 -RTIGGKEVDVKRATPKP 485
            +++ GK + V++AT KP
Sbjct: 71  GKSLDGKAIKVEQAT-KP 87


>AL683813-6|CAI39448.1|  391|Homo sapiens RNA binding motif protein,
           X-linked protein.
          Length = 391

 Score = 60.5 bits (140), Expect = 5e-09
 Identities = 34/79 (43%), Positives = 46/79 (58%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           R  KLF+GGL+ ET +K L   FG YG I  + +  D  T +SRGFAF+ F++P   D  
Sbjct: 6   RPGKLFIGGLNTETNEKALEAVFGKYGRIVEVLLMKDRETNKSRGFAFVTFESP--ADAK 63

Query: 181 MAAGEHTINNKKVDPKKAK 237
            AA +  +N K +D K  K
Sbjct: 64  DAARD--MNGKSLDGKAIK 80



 Score = 55.6 bits (128), Expect = 1e-07
 Identities = 27/78 (34%), Positives = 48/78 (61%), Gaps = 1/78 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGL++E ++  +   F ++G I+EV +  D+  N+ +GF F+TFES     D  +   
Sbjct: 11  FIGGLNTETNEKALEAVFGKYGRIVEVLLMKDRETNKSRGFAFVTFESPADAKDAARDMN 70

Query: 435 -RTIGGKEVDVKRATPKP 485
            +++ GK + V++AT KP
Sbjct: 71  GKSLDGKAIKVEQAT-KP 87


>AF266723-1|AAK58567.1|  391|Homo sapiens RBMX protein.
          Length = 391

 Score = 60.5 bits (140), Expect = 5e-09
 Identities = 34/79 (43%), Positives = 46/79 (58%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           R  KLF+GGL+ ET +K L   FG YG I  + +  D  T +SRGFAF+ F++P   D  
Sbjct: 6   RPGKLFIGGLNTETNEKALEAVFGKYGRIVEVLLMKDRETNKSRGFAFVTFESP--ADAK 63

Query: 181 MAAGEHTINNKKVDPKKAK 237
            AA +  +N K +D K  K
Sbjct: 64  DAARD--MNGKSLDGKAIK 80



 Score = 55.6 bits (128), Expect = 1e-07
 Identities = 27/78 (34%), Positives = 48/78 (61%), Gaps = 1/78 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGL++E ++  +   F ++G I+EV +  D+  N+ +GF F+TFES     D  +   
Sbjct: 11  FIGGLNTETNEKALEAVFGKYGRIVEVLLMKDRETNKSRGFAFVTFESPADAKDAARDMN 70

Query: 435 -RTIGGKEVDVKRATPKP 485
            +++ GK + V++AT KP
Sbjct: 71  GKSLDGKAIKVEQAT-KP 87


>DQ120650-1|ABB92435.1|  384|Homo sapiens RBM1 protein.
          Length = 384

 Score = 60.1 bits (139), Expect = 6e-09
 Identities = 34/79 (43%), Positives = 46/79 (58%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           R  KLF+GGL+ ET +K L   FG YG I  + +  D  T +SRGFAF+ F++P   D  
Sbjct: 6   RPGKLFIGGLNTETNEKALETVFGKYGRIVEVLLIKDRETNKSRGFAFVTFESP--ADAK 63

Query: 181 MAAGEHTINNKKVDPKKAK 237
            AA +  +N K +D K  K
Sbjct: 64  DAARD--MNGKSLDGKAIK 80



 Score = 56.0 bits (129), Expect = 1e-07
 Identities = 27/78 (34%), Positives = 48/78 (61%), Gaps = 1/78 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGL++E ++  +   F ++G I+EV +  D+  N+ +GF F+TFES     D  +   
Sbjct: 11  FIGGLNTETNEKALETVFGKYGRIVEVLLIKDRETNKSRGFAFVTFESPADAKDAARDMN 70

Query: 435 -RTIGGKEVDVKRATPKP 485
            +++ GK + V++AT KP
Sbjct: 71  GKSLDGKAIKVEQAT-KP 87


>BC012942-1|AAH12942.1|  390|Homo sapiens RNA binding motif protein,
           X-linked-like 1 protein.
          Length = 390

 Score = 60.1 bits (139), Expect = 6e-09
 Identities = 34/79 (43%), Positives = 46/79 (58%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           R  KLF+GGL+ ET +K L   FG YG I  + +  D  T +SRGFAF+ F++P   D  
Sbjct: 6   RPGKLFIGGLNTETNEKALETVFGKYGRIVEVLLIKDRETNKSRGFAFVTFESP--ADAK 63

Query: 181 MAAGEHTINNKKVDPKKAK 237
            AA +  +N K +D K  K
Sbjct: 64  DAARD--MNGKSLDGKAIK 80



 Score = 56.0 bits (129), Expect = 1e-07
 Identities = 27/78 (34%), Positives = 48/78 (61%), Gaps = 1/78 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGL++E ++  +   F ++G I+EV +  D+  N+ +GF F+TFES     D  +   
Sbjct: 11  FIGGLNTETNEKALETVFGKYGRIVEVLLIKDRETNKSRGFAFVTFESPADAKDAARDMN 70

Query: 435 -RTIGGKEVDVKRATPKP 485
            +++ GK + V++AT KP
Sbjct: 71  GKSLDGKAIKVEQAT-KP 87


>AL139416-3|CAI21694.1|  159|Homo sapiens RNA binding motif protein,
           X-linked-like 1 protein.
          Length = 159

 Score = 60.1 bits (139), Expect = 6e-09
 Identities = 34/79 (43%), Positives = 46/79 (58%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           R  KLF+GGL+ ET +K L   FG YG I  + +  D  T +SRGFAF+ F++P   D  
Sbjct: 6   RPGKLFIGGLNTETNEKALETVFGKYGRIVEVLLIKDRETNKSRGFAFVTFESP--ADAK 63

Query: 181 MAAGEHTINNKKVDPKKAK 237
            AA +  +N K +D K  K
Sbjct: 64  DAARD--MNGKSLDGKAIK 80



 Score = 56.0 bits (129), Expect = 1e-07
 Identities = 27/78 (34%), Positives = 48/78 (61%), Gaps = 1/78 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGL++E ++  +   F ++G I+EV +  D+  N+ +GF F+TFES     D  +   
Sbjct: 11  FIGGLNTETNEKALETVFGKYGRIVEVLLIKDRETNKSRGFAFVTFESPADAKDAARDMN 70

Query: 435 -RTIGGKEVDVKRATPKP 485
            +++ GK + V++AT KP
Sbjct: 71  GKSLDGKAIKVEQAT-KP 87


>AL139416-2|CAI21693.1|  390|Homo sapiens RNA binding motif protein,
           X-linked-like 1 protein.
          Length = 390

 Score = 60.1 bits (139), Expect = 6e-09
 Identities = 34/79 (43%), Positives = 46/79 (58%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           R  KLF+GGL+ ET +K L   FG YG I  + +  D  T +SRGFAF+ F++P   D  
Sbjct: 6   RPGKLFIGGLNTETNEKALETVFGKYGRIVEVLLIKDRETNKSRGFAFVTFESP--ADAK 63

Query: 181 MAAGEHTINNKKVDPKKAK 237
            AA +  +N K +D K  K
Sbjct: 64  DAARD--MNGKSLDGKAIK 80



 Score = 56.0 bits (129), Expect = 1e-07
 Identities = 27/78 (34%), Positives = 48/78 (61%), Gaps = 1/78 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGL++E ++  +   F ++G I+EV +  D+  N+ +GF F+TFES     D  +   
Sbjct: 11  FIGGLNTETNEKALETVFGKYGRIVEVLLIKDRETNKSRGFAFVTFESPADAKDAARDMN 70

Query: 435 -RTIGGKEVDVKRATPKP 485
            +++ GK + V++AT KP
Sbjct: 71  GKSLDGKAIKVEQAT-KP 87


>X04347-1|CAA27874.1|  196|Homo sapiens protein ( Human liver mRNA
           fragment DNA binding protein UPI homologue
           (C-terminus).  ).
          Length = 196

 Score = 59.7 bits (138), Expect = 9e-09
 Identities = 24/59 (40%), Positives = 38/59 (64%)
 Frame = +1

Query: 67  FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKAR 243
           F  YG+IE I + TDP +G+ RGFAF+ F   +S+DK++    HT+N    + +KA ++
Sbjct: 1   FEQYGKIEVIEIMTDPGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSK 59



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 16/61 (26%), Positives = 33/61 (54%)
 Frame = +3

Query: 306 FSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKP 485
           F ++G I  +E+  D    +++GF F+TF+    V+ ++     T+ G   +V++A  K 
Sbjct: 1   FEQYGKIEVIEIMTDPGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQ 60

Query: 486 D 488
           +
Sbjct: 61  E 61


>AY547318-1|AAS55633.1|  236|Homo sapiens unknown protein.
          Length = 236

 Score = 58.4 bits (135), Expect = 2e-08
 Identities = 27/73 (36%), Positives = 41/73 (56%)
 Frame = +1

Query: 4   HEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 183
           + K+FVGGL + TTD  LR +F  +GEIE   V TD  TG+SRG+ F+      + ++  
Sbjct: 10  YTKIFVGGLPYHTTDASLRKYFEVFGEIEEAVVITDRQTGKSRGYGFVTMADRAAAERAC 69

Query: 184 AAGEHTINNKKVD 222
                 I+ +K +
Sbjct: 70  KDPNPIIDGRKAN 82


>AL136305-1|CAC36889.1|  236|Homo sapiens protein ( Human DNA
           sequence from clone RP1-259A10 on chromosome 6p22.1-23
           Contains the gene for an ssDNA binding protein and a CpG
           island.  ).
          Length = 236

 Score = 58.4 bits (135), Expect = 2e-08
 Identities = 27/73 (36%), Positives = 41/73 (56%)
 Frame = +1

Query: 4   HEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 183
           + K+FVGGL + TTD  LR +F  +GEIE   V TD  TG+SRG+ F+      + ++  
Sbjct: 10  YTKIFVGGLPYHTTDASLRKYFEVFGEIEEAVVITDRQTGKSRGYGFVTMADRAAAERAC 69

Query: 184 AAGEHTINNKKVD 222
                 I+ +K +
Sbjct: 70  KDPNPIIDGRKAN 82


>AK095016-1|BAC04474.1|  211|Homo sapiens protein ( Homo sapiens
           cDNA FLJ37697 fis, clone BRHIP2015360, highly similar to
           Xenopus laevis RRM-containing protein SEB-4 mRNA. ).
          Length = 211

 Score = 58.4 bits (135), Expect = 2e-08
 Identities = 27/73 (36%), Positives = 41/73 (56%)
 Frame = +1

Query: 4   HEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 183
           + K+FVGGL + TTD  LR +F  +GEIE   V TD  TG+SRG+ F+      + ++  
Sbjct: 10  YTKIFVGGLPYHTTDASLRKYFEVFGEIEEAVVITDRQTGKSRGYGFVTMADRAAAERAC 69

Query: 184 AAGEHTINNKKVD 222
                 I+ +K +
Sbjct: 70  KDPNPIIDGRKAN 82


>D78134-1|BAA11212.1|  172|Homo sapiens CIRP protein.
          Length = 172

 Score = 58.0 bits (134), Expect = 3e-08
 Identities = 27/71 (38%), Positives = 44/71 (61%), Gaps = 1/71 (1%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFK-APESIDKVMA 186
           KLFVGGLS++T ++ L   F  YG+I  + V  D  T RSRGF F+ F+   ++ D +MA
Sbjct: 7   KLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMA 66

Query: 187 AGEHTINNKKV 219
               +++ +++
Sbjct: 67  MNGKSVDGRQI 77



 Score = 49.6 bits (113), Expect = 9e-06
 Identities = 24/79 (30%), Positives = 45/79 (56%), Gaps = 1/79 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVND-LLKTP 431
           FVGGLS + ++  +   FS++G I EV +  D+   + +GF F+TFE+     D ++   
Sbjct: 9   FVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMN 68

Query: 432 KRTIGGKEVDVKRATPKPD 488
            +++ G+++ V +A    D
Sbjct: 69  GKSVDGRQIRVDQAGKSSD 87


>BT007210-1|AAP35874.1|  172|Homo sapiens cold inducible RNA binding
           protein protein.
          Length = 172

 Score = 58.0 bits (134), Expect = 3e-08
 Identities = 27/71 (38%), Positives = 44/71 (61%), Gaps = 1/71 (1%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFK-APESIDKVMA 186
           KLFVGGLS++T ++ L   F  YG+I  + V  D  T RSRGF F+ F+   ++ D +MA
Sbjct: 7   KLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMA 66

Query: 187 AGEHTINNKKV 219
               +++ +++
Sbjct: 67  MNGKSVDGRQI 77



 Score = 49.6 bits (113), Expect = 9e-06
 Identities = 24/79 (30%), Positives = 45/79 (56%), Gaps = 1/79 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVND-LLKTP 431
           FVGGLS + ++  +   FS++G I EV +  D+   + +GF F+TFE+     D ++   
Sbjct: 9   FVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMN 68

Query: 432 KRTIGGKEVDVKRATPKPD 488
            +++ G+++ V +A    D
Sbjct: 69  GKSVDGRQIRVDQAGKSSD 87


>BC000901-1|AAH00901.1|  172|Homo sapiens cold inducible RNA binding
           protein protein.
          Length = 172

 Score = 58.0 bits (134), Expect = 3e-08
 Identities = 27/71 (38%), Positives = 44/71 (61%), Gaps = 1/71 (1%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFK-APESIDKVMA 186
           KLFVGGLS++T ++ L   F  YG+I  + V  D  T RSRGF F+ F+   ++ D +MA
Sbjct: 7   KLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMA 66

Query: 187 AGEHTINNKKV 219
               +++ +++
Sbjct: 67  MNGKSVDGRQI 77



 Score = 49.6 bits (113), Expect = 9e-06
 Identities = 24/79 (30%), Positives = 45/79 (56%), Gaps = 1/79 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVND-LLKTP 431
           FVGGLS + ++  +   FS++G I EV +  D+   + +GF F+TFE+     D ++   
Sbjct: 9   FVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMN 68

Query: 432 KRTIGGKEVDVKRATPKPD 488
            +++ G+++ V +A    D
Sbjct: 69  GKSVDGRQIRVDQAGKSSD 87


>BC000403-1|AAH00403.1|  172|Homo sapiens cold inducible RNA binding
           protein protein.
          Length = 172

 Score = 58.0 bits (134), Expect = 3e-08
 Identities = 27/71 (38%), Positives = 44/71 (61%), Gaps = 1/71 (1%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFK-APESIDKVMA 186
           KLFVGGLS++T ++ L   F  YG+I  + V  D  T RSRGF F+ F+   ++ D +MA
Sbjct: 7   KLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMA 66

Query: 187 AGEHTINNKKV 219
               +++ +++
Sbjct: 67  MNGKSVDGRQI 77



 Score = 49.6 bits (113), Expect = 9e-06
 Identities = 24/79 (30%), Positives = 45/79 (56%), Gaps = 1/79 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVND-LLKTP 431
           FVGGLS + ++  +   FS++G I EV +  D+   + +GF F+TFE+     D ++   
Sbjct: 9   FVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMN 68

Query: 432 KRTIGGKEVDVKRATPKPD 488
            +++ G+++ V +A    D
Sbjct: 69  GKSVDGRQIRVDQAGKSSD 87


>AF021336-1|AAC51787.1|  172|Homo sapiens DNA damage-inducible RNA
           binding protein protein.
          Length = 172

 Score = 58.0 bits (134), Expect = 3e-08
 Identities = 27/71 (38%), Positives = 44/71 (61%), Gaps = 1/71 (1%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFK-APESIDKVMA 186
           KLFVGGLS++T ++ L   F  YG+I  + V  D  T RSRGF F+ F+   ++ D +MA
Sbjct: 7   KLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMA 66

Query: 187 AGEHTINNKKV 219
               +++ +++
Sbjct: 67  MNGKSVDGRQI 77



 Score = 49.6 bits (113), Expect = 9e-06
 Identities = 24/79 (30%), Positives = 45/79 (56%), Gaps = 1/79 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVND-LLKTP 431
           FVGGLS + ++  +   FS++G I EV +  D+   + +GF F+TFE+     D ++   
Sbjct: 9   FVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMN 68

Query: 432 KRTIGGKEVDVKRATPKPD 488
            +++ G+++ V +A    D
Sbjct: 69  GKSVDGRQIRVDQAGKSSD 87


>AC004258-1|AAC04895.1|  172|Homo sapiens CIRP protein.
          Length = 172

 Score = 58.0 bits (134), Expect = 3e-08
 Identities = 27/71 (38%), Positives = 44/71 (61%), Gaps = 1/71 (1%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFK-APESIDKVMA 186
           KLFVGGLS++T ++ L   F  YG+I  + V  D  T RSRGF F+ F+   ++ D +MA
Sbjct: 7   KLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMA 66

Query: 187 AGEHTINNKKV 219
               +++ +++
Sbjct: 67  MNGKSVDGRQI 77



 Score = 49.6 bits (113), Expect = 9e-06
 Identities = 24/79 (30%), Positives = 45/79 (56%), Gaps = 1/79 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVND-LLKTP 431
           FVGGLS + ++  +   FS++G I EV +  D+   + +GF F+TFE+     D ++   
Sbjct: 9   FVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMN 68

Query: 432 KRTIGGKEVDVKRATPKPD 488
            +++ G+++ V +A    D
Sbjct: 69  GKSVDGRQIRVDQAGKSSD 87


>X75315-1|CAA53064.1|  230|Homo sapiens SEB4B protein.
          Length = 230

 Score = 56.8 bits (131), Expect = 6e-08
 Identities = 26/71 (36%), Positives = 40/71 (56%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+FVGGL + TTD  LR +F  +G+IE   V TD  TG+SRG+ F+      + ++    
Sbjct: 26  KIFVGGLPYHTTDASLRKYFEGFGDIEEAVVITDRQTGKSRGYGFVTMADRAAAERACKD 85

Query: 190 GEHTINNKKVD 222
               I+ +K +
Sbjct: 86  PNPIIDGRKAN 96


>X75314-1|CAA53063.1|  229|Homo sapiens SEB4D protein.
          Length = 229

 Score = 56.8 bits (131), Expect = 6e-08
 Identities = 26/71 (36%), Positives = 40/71 (56%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+FVGGL + TTD  LR +F  +G+IE   V TD  TG+SRG+ F+      + ++    
Sbjct: 25  KIFVGGLPYHTTDASLRKYFEGFGDIEEAVVITDRQTGKSRGYGFVTMADRAAAERACKD 84

Query: 190 GEHTINNKKVD 222
               I+ +K +
Sbjct: 85  PNPIIDGRKAN 95


>BC018711-1|AAH18711.1|  216|Homo sapiens RBM38 protein protein.
          Length = 216

 Score = 56.8 bits (131), Expect = 6e-08
 Identities = 26/71 (36%), Positives = 40/71 (56%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+FVGGL + TTD  LR +F  +G+IE   V TD  TG+SRG+ F+      + ++    
Sbjct: 12  KIFVGGLPYHTTDASLRKYFEGFGDIEEAVVITDRQTGKSRGYGFVTMADRAAAERACKD 71

Query: 190 GEHTINNKKVD 222
               I+ +K +
Sbjct: 72  PNPIIDGRKAN 82


>AF432218-1|AAL99924.1|  216|Homo sapiens CLL-associated antigen
           KW-5 protein.
          Length = 216

 Score = 56.8 bits (131), Expect = 6e-08
 Identities = 26/71 (36%), Positives = 40/71 (56%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+FVGGL + TTD  LR +F  +G+IE   V TD  TG+SRG+ F+      + ++    
Sbjct: 12  KIFVGGLPYHTTDASLRKYFEGFGDIEEAVVITDRQTGKSRGYGFVTMADRAAAERACKD 71

Query: 190 GEHTINNKKVD 222
               I+ +K +
Sbjct: 72  PNPIIDGRKAN 82


>U53209-1|AAC50658.1|  282|Homo sapiens transformer-2 alpha protein.
          Length = 282

 Score = 56.0 bits (129), Expect = 1e-07
 Identities = 32/75 (42%), Positives = 44/75 (58%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           L V GLS  TT+++LR+ F  YG +  +NV  D  TGRSRGFAF+ F   E ID    A 
Sbjct: 121 LGVFGLSLYTTERDLREVFSRYGPLSGVNVVYDQRTGRSRGFAFVYF---ERIDDSKEAM 177

Query: 193 EHTINNKKVDPKKAK 237
           E   N  ++D ++ +
Sbjct: 178 ERA-NGMELDGRRIR 191



 Score = 37.5 bits (83), Expect = 0.039
 Identities = 21/71 (29%), Positives = 39/71 (54%)
 Frame = +3

Query: 258 VGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKR 437
           V GLS   ++ ++R  FS +G +  V + +D+   + +GF F+ FE    ++D  +  +R
Sbjct: 123 VFGLSLYTTERDLREVFSRYGPLSGVNVVYDQRTGRSRGFAFVYFER---IDDSKEAMER 179

Query: 438 TIGGKEVDVKR 470
              G E+D +R
Sbjct: 180 A-NGMELDGRR 189


>BC017094-1|AAH17094.1|  282|Homo sapiens transformer-2 alpha
           protein.
          Length = 282

 Score = 56.0 bits (129), Expect = 1e-07
 Identities = 32/75 (42%), Positives = 44/75 (58%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           L V GLS  TT+++LR+ F  YG +  +NV  D  TGRSRGFAF+ F   E ID    A 
Sbjct: 121 LGVFGLSLYTTERDLREVFSRYGPLSGVNVVYDQRTGRSRGFAFVYF---ERIDDSKEAM 177

Query: 193 EHTINNKKVDPKKAK 237
           E   N  ++D ++ +
Sbjct: 178 ERA-NGMELDGRRIR 191



 Score = 37.5 bits (83), Expect = 0.039
 Identities = 21/71 (29%), Positives = 39/71 (54%)
 Frame = +3

Query: 258 VGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKR 437
           V GLS   ++ ++R  FS +G +  V + +D+   + +GF F+ FE    ++D  +  +R
Sbjct: 123 VFGLSLYTTERDLREVFSRYGPLSGVNVVYDQRTGRSRGFAFVYFER---IDDSKEAMER 179

Query: 438 TIGGKEVDVKR 470
              G E+D +R
Sbjct: 180 A-NGMELDGRR 189


>AC023105-1|AAQ96870.1|  282|Homo sapiens unknown protein.
          Length = 282

 Score = 56.0 bits (129), Expect = 1e-07
 Identities = 32/75 (42%), Positives = 44/75 (58%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           L V GLS  TT+++LR+ F  YG +  +NV  D  TGRSRGFAF+ F   E ID    A 
Sbjct: 121 LGVFGLSLYTTERDLREVFSRYGPLSGVNVVYDQRTGRSRGFAFVYF---ERIDDSKEAM 177

Query: 193 EHTINNKKVDPKKAK 237
           E   N  ++D ++ +
Sbjct: 178 ERA-NGMELDGRRIR 191



 Score = 37.5 bits (83), Expect = 0.039
 Identities = 21/71 (29%), Positives = 39/71 (54%)
 Frame = +3

Query: 258 VGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKR 437
           V GLS   ++ ++R  FS +G +  V + +D+   + +GF F+ FE    ++D  +  +R
Sbjct: 123 VFGLSLYTTERDLREVFSRYGPLSGVNVVYDQRTGRSRGFAFVYFER---IDDSKEAMER 179

Query: 438 TIGGKEVDVKR 470
              G E+D +R
Sbjct: 180 A-NGMELDGRR 189


>AB097048-1|BAC77401.1|  282|Homo sapiens putative MAPK activating
           protein protein.
          Length = 282

 Score = 56.0 bits (129), Expect = 1e-07
 Identities = 32/75 (42%), Positives = 44/75 (58%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           L V GLS  TT+++LR+ F  YG +  +NV  D  TGRSRGFAF+ F   E ID    A 
Sbjct: 121 LGVFGLSLYTTERDLREVFSRYGPLSGVNVVYDQRTGRSRGFAFVYF---ERIDDSKEAM 177

Query: 193 EHTINNKKVDPKKAK 237
           E   N  ++D ++ +
Sbjct: 178 ERA-NGMELDGRRIR 191



 Score = 37.5 bits (83), Expect = 0.039
 Identities = 21/71 (29%), Positives = 39/71 (54%)
 Frame = +3

Query: 258 VGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKR 437
           V GLS   ++ ++R  FS +G +  V + +D+   + +GF F+ FE    ++D  +  +R
Sbjct: 123 VFGLSLYTTERDLREVFSRYGPLSGVNVVYDQRTGRSRGFAFVYFER---IDDSKEAMER 179

Query: 438 TIGGKEVDVKR 470
              G E+D +R
Sbjct: 180 A-NGMELDGRR 189


>AK128423-1|BAC87434.1|  135|Homo sapiens protein ( Homo sapiens
           cDNA FLJ46566 fis, clone THYMU3040829, moderately
           similar to Cold-inducible RNA-binding protein. ).
          Length = 135

 Score = 55.2 bits (127), Expect = 2e-07
 Identities = 27/60 (45%), Positives = 38/60 (63%), Gaps = 1/60 (1%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFK-APESIDKVMA 186
           KLFVGGLS++T ++ L   F  YG+I  + V  D  T RSRGF F+ F+   ++ D +MA
Sbjct: 7   KLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMA 66



 Score = 44.8 bits (101), Expect = 3e-04
 Identities = 20/56 (35%), Positives = 33/56 (58%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLL 422
           FVGGLS + ++  +   FS++G I EV +  D+   + +GF F+TFE+     D +
Sbjct: 9   FVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAM 64


>X76059-1|CAA53659.1|  496|Homo sapiens protein ( H.sapiens mRNA for
           YRRM1. ).
          Length = 496

 Score = 52.8 bits (121), Expect = 1e-06
 Identities = 33/81 (40%), Positives = 45/81 (55%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLF+GGL+ ET +K L+  FG +G I  + +  D  T +SRGFAFI F+ P   D   AA
Sbjct: 9   KLFIGGLNRETNEKMLKAVFGKHGPISEVLLIKD-RTSKSRGFAFITFENP--ADAKNAA 65

Query: 190 GEHTINNKKVDPKKAKARHGK 252
            +  +N K +  K  K    K
Sbjct: 66  KD--MNGKSLHGKAIKVEQAK 84



 Score = 44.8 bits (101), Expect = 3e-04
 Identities = 25/74 (33%), Positives = 42/74 (56%), Gaps = 1/74 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGL+ E ++  ++  F + G I EV +  D+T   R GF FITFE+     +  K   
Sbjct: 11  FIGGLNRETNEKMLKAVFGKHGPISEVLLIKDRTSKSR-GFAFITFENPADAKNAAKDMN 69

Query: 435 -RTIGGKEVDVKRA 473
            +++ GK + V++A
Sbjct: 70  GKSLHGKAIKVEQA 83


>L10911-1|AAA16347.1|  530|Homo sapiens splicing factor protein.
          Length = 530

 Score = 52.8 bits (121), Expect = 1e-06
 Identities = 31/105 (29%), Positives = 50/105 (47%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           +L+VG L +  T+  LR  F  +G IESI +  D  TGRS+G+ FI F   E   K +  
Sbjct: 251 RLYVGSLHFNITEDMLRGIFEPFGRIESIQLMMDSETGRSKGYGFITFSDSECAKKAL-- 308

Query: 190 GEHTINNKKVDPKKAKARHGKILSEDSAVKSQMMKSETSSVNLEL 324
               +N  ++  +  K  H    ++ S+  S +   E     ++L
Sbjct: 309 --EQLNGFELAGRPMKVGHVTERTDASSASSFLDSDELERTGIDL 351



 Score = 44.8 bits (101), Expect = 3e-04
 Identities = 25/83 (30%), Positives = 40/83 (48%), Gaps = 1/83 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF-ESEQVVNDLLKTP 431
           +VG L   I++D +R  F  FG I  +++  D    + KG+ FITF +SE     L +  
Sbjct: 253 YVGSLHFNITEDMLRGIFEPFGRIESIQLMMDSETGRSKGYGFITFSDSECAKKALEQLN 312

Query: 432 KRTIGGKEVDVKRATPKPDGPGA 500
              + G+ + V   T + D   A
Sbjct: 313 GFELAGRPMKVGHVTERTDASSA 335


>L10910-1|AAA16346.1|  524|Homo sapiens splicing factor protein.
          Length = 524

 Score = 52.8 bits (121), Expect = 1e-06
 Identities = 31/105 (29%), Positives = 50/105 (47%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           +L+VG L +  T+  LR  F  +G IESI +  D  TGRS+G+ FI F   E   K +  
Sbjct: 251 RLYVGSLHFNITEDMLRGIFEPFGRIESIQLMMDSETGRSKGYGFITFSDSECAKKAL-- 308

Query: 190 GEHTINNKKVDPKKAKARHGKILSEDSAVKSQMMKSETSSVNLEL 324
               +N  ++  +  K  H    ++ S+  S +   E     ++L
Sbjct: 309 --EQLNGFELAGRPMKVGHVTERTDASSASSFLDSDELERTGIDL 351



 Score = 44.8 bits (101), Expect = 3e-04
 Identities = 25/83 (30%), Positives = 40/83 (48%), Gaps = 1/83 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF-ESEQVVNDLLKTP 431
           +VG L   I++D +R  F  FG I  +++  D    + KG+ FITF +SE     L +  
Sbjct: 253 YVGSLHFNITEDMLRGIFEPFGRIESIQLMMDSETGRSKGYGFITFSDSECAKKALEQLN 312

Query: 432 KRTIGGKEVDVKRATPKPDGPGA 500
              + G+ + V   T + D   A
Sbjct: 313 GFELAGRPMKVGHVTERTDASSA 335


>BC141835-1|AAI41836.1|  530|Homo sapiens RNA binding motif protein
           39 protein.
          Length = 530

 Score = 52.8 bits (121), Expect = 1e-06
 Identities = 31/105 (29%), Positives = 50/105 (47%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           +L+VG L +  T+  LR  F  +G IESI +  D  TGRS+G+ FI F   E   K +  
Sbjct: 251 RLYVGSLHFNITEDMLRGIFEPFGRIESIQLMMDSETGRSKGYGFITFSDSECAKKAL-- 308

Query: 190 GEHTINNKKVDPKKAKARHGKILSEDSAVKSQMMKSETSSVNLEL 324
               +N  ++  +  K  H    ++ S+  S +   E     ++L
Sbjct: 309 --EQLNGFELAGRPMKVGHVTERTDASSASSFLDSDELERTGIDL 351



 Score = 44.8 bits (101), Expect = 3e-04
 Identities = 25/83 (30%), Positives = 40/83 (48%), Gaps = 1/83 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF-ESEQVVNDLLKTP 431
           +VG L   I++D +R  F  FG I  +++  D    + KG+ FITF +SE     L +  
Sbjct: 253 YVGSLHFNITEDMLRGIFEPFGRIESIQLMMDSETGRSKGYGFITFSDSECAKKALEQLN 312

Query: 432 KRTIGGKEVDVKRATPKPDGPGA 500
              + G+ + V   T + D   A
Sbjct: 313 GFELAGRPMKVGHVTERTDASSA 335


>BC131543-1|AAI31544.1|  508|Homo sapiens RBM39 protein protein.
          Length = 508

 Score = 52.8 bits (121), Expect = 1e-06
 Identities = 31/105 (29%), Positives = 50/105 (47%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           +L+VG L +  T+  LR  F  +G IESI +  D  TGRS+G+ FI F   E   K +  
Sbjct: 229 RLYVGSLHFNITEDMLRGIFEPFGRIESIQLMMDSETGRSKGYGFITFSDSECAKKAL-- 286

Query: 190 GEHTINNKKVDPKKAKARHGKILSEDSAVKSQMMKSETSSVNLEL 324
               +N  ++  +  K  H    ++ S+  S +   E     ++L
Sbjct: 287 --EQLNGFELAGRPMKVGHVTERTDASSASSFLDSDELERTGIDL 329



 Score = 44.8 bits (101), Expect = 3e-04
 Identities = 25/83 (30%), Positives = 40/83 (48%), Gaps = 1/83 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF-ESEQVVNDLLKTP 431
           +VG L   I++D +R  F  FG I  +++  D    + KG+ FITF +SE     L +  
Sbjct: 231 YVGSLHFNITEDMLRGIFEPFGRIESIQLMMDSETGRSKGYGFITFSDSECAKKALEQLN 290

Query: 432 KRTIGGKEVDVKRATPKPDGPGA 500
              + G+ + V   T + D   A
Sbjct: 291 GFELAGRPMKVGHVTERTDASSA 313


>BC070298-1|AAH70298.1|  459|Homo sapiens RBMY1A1 protein protein.
          Length = 459

 Score = 52.8 bits (121), Expect = 1e-06
 Identities = 33/81 (40%), Positives = 45/81 (55%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLF+GGL+ ET +K L+  FG +G I  + +  D  T +SRGFAFI F+ P   D   AA
Sbjct: 9   KLFIGGLNRETNEKMLKAVFGKHGPISEVLLIKD-RTSKSRGFAFITFENP--ADAKNAA 65

Query: 190 GEHTINNKKVDPKKAKARHGK 252
            +  +N K +  K  K    K
Sbjct: 66  KD--MNGKSLHGKAIKVEQAK 84



 Score = 44.8 bits (101), Expect = 3e-04
 Identities = 25/74 (33%), Positives = 42/74 (56%), Gaps = 1/74 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGL+ E ++  ++  F + G I EV +  D+T   R GF FITFE+     +  K   
Sbjct: 11  FIGGLNRETNEKMLKAVFGKHGPISEVLLIKDRTSKSR-GFAFITFENPADAKNAAKDMN 69

Query: 435 -RTIGGKEVDVKRA 473
            +++ GK + V++A
Sbjct: 70  GKSLHGKAIKVEQA 83


>AL357374-9|CAC11119.1|  524|Homo sapiens RNA binding motif protein
           39 protein.
          Length = 524

 Score = 52.8 bits (121), Expect = 1e-06
 Identities = 31/105 (29%), Positives = 50/105 (47%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           +L+VG L +  T+  LR  F  +G IESI +  D  TGRS+G+ FI F   E   K +  
Sbjct: 251 RLYVGSLHFNITEDMLRGIFEPFGRIESIQLMMDSETGRSKGYGFITFSDSECAKKAL-- 308

Query: 190 GEHTINNKKVDPKKAKARHGKILSEDSAVKSQMMKSETSSVNLEL 324
               +N  ++  +  K  H    ++ S+  S +   E     ++L
Sbjct: 309 --EQLNGFELAGRPMKVGHVTERTDASSASSFLDSDELERTGIDL 351



 Score = 44.8 bits (101), Expect = 3e-04
 Identities = 25/83 (30%), Positives = 40/83 (48%), Gaps = 1/83 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF-ESEQVVNDLLKTP 431
           +VG L   I++D +R  F  FG I  +++  D    + KG+ FITF +SE     L +  
Sbjct: 253 YVGSLHFNITEDMLRGIFEPFGRIESIQLMMDSETGRSKGYGFITFSDSECAKKALEQLN 312

Query: 432 KRTIGGKEVDVKRATPKPDGPGA 500
              + G+ + V   T + D   A
Sbjct: 313 GFELAGRPMKVGHVTERTDASSA 335


>AL357374-8|CAC11118.1|  530|Homo sapiens RNA binding motif protein
           39 protein.
          Length = 530

 Score = 52.8 bits (121), Expect = 1e-06
 Identities = 31/105 (29%), Positives = 50/105 (47%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           +L+VG L +  T+  LR  F  +G IESI +  D  TGRS+G+ FI F   E   K +  
Sbjct: 251 RLYVGSLHFNITEDMLRGIFEPFGRIESIQLMMDSETGRSKGYGFITFSDSECAKKAL-- 308

Query: 190 GEHTINNKKVDPKKAKARHGKILSEDSAVKSQMMKSETSSVNLEL 324
               +N  ++  +  K  H    ++ S+  S +   E     ++L
Sbjct: 309 --EQLNGFELAGRPMKVGHVTERTDASSASSFLDSDELERTGIDL 351



 Score = 44.8 bits (101), Expect = 3e-04
 Identities = 25/83 (30%), Positives = 40/83 (48%), Gaps = 1/83 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF-ESEQVVNDLLKTP 431
           +VG L   I++D +R  F  FG I  +++  D    + KG+ FITF +SE     L +  
Sbjct: 253 YVGSLHFNITEDMLRGIFEPFGRIESIQLMMDSETGRSKGYGFITFSDSECAKKALEQLN 312

Query: 432 KRTIGGKEVDVKRATPKPDGPGA 500
              + G+ + V   T + D   A
Sbjct: 313 GFELAGRPMKVGHVTERTDASSA 335


>M96954-1|AAA36384.1|  375|Homo sapiens nucleolysin TIAR protein.
          Length = 375

 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 28/94 (29%), Positives = 51/94 (54%), Gaps = 1/94 (1%)
 Frame = +3

Query: 216 SRPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFE 395
           S  K+  S  +  FVG LS EI+ ++I++ F+ FG I +  +  D    + KG+ F++F 
Sbjct: 87  SSQKKDTSNHFHVFVGDLSPEITTEDIKSAFAPFGKISDARVVKDMATGKSKGYGFVSFY 146

Query: 396 SE-QVVNDLLKTPKRTIGGKEVDVKRATPKPDGP 494
           ++    N ++    + +GG+++    AT KP  P
Sbjct: 147 NKLDAENAIVHMGGQWLGGRQIRTNWATRKPPAP 180



 Score = 44.0 bits (99), Expect = 5e-04
 Identities = 19/50 (38%), Positives = 30/50 (60%)
 Frame = +1

Query: 4   HEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVF 153
           H  +FVG LS E T ++++  F  +G+I    V  D  TG+S+G+ F+ F
Sbjct: 96  HFHVFVGDLSPEITTEDIKSAFAPFGKISDARVVKDMATGKSKGYGFVSF 145



 Score = 36.3 bits (80), Expect = 0.091
 Identities = 25/75 (33%), Positives = 35/75 (46%), Gaps = 1/75 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF-ESEQVVNDLLKTP 431
           +VG LS ++++  I   FS+ G     +M  + T N    +CF+ F E       L    
Sbjct: 12  YVGNLSRDVTEVLILQLFSQIGPCKSCKMITEHTSND--PYCFVEFYEHRDAAAALAAMN 69

Query: 432 KRTIGGKEVDVKRAT 476
            R I GKEV V  AT
Sbjct: 70  GRKILGKEVKVNWAT 84


>D64015-1|BAA21559.1|  265|Homo sapiens T-cluster binding protein
           protein.
          Length = 265

 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 28/94 (29%), Positives = 51/94 (54%), Gaps = 1/94 (1%)
 Frame = +3

Query: 216 SRPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFE 395
           S  K+  S  +  FVG LS EI+ ++I++ F+ FG I +  +  D    + KG+ F++F 
Sbjct: 48  SSQKKDTSNHFHVFVGDLSPEITTEDIKSAFAPFGKISDARVVKDMATGKSKGYGFVSFY 107

Query: 396 SE-QVVNDLLKTPKRTIGGKEVDVKRATPKPDGP 494
           ++    N ++    + +GG+++    AT KP  P
Sbjct: 108 NKLDAENAIVHMGGQWLGGRQIRTNWATRKPPAP 141



 Score = 44.0 bits (99), Expect = 5e-04
 Identities = 19/50 (38%), Positives = 30/50 (60%)
 Frame = +1

Query: 4   HEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVF 153
           H  +FVG LS E T ++++  F  +G+I    V  D  TG+S+G+ F+ F
Sbjct: 57  HFHVFVGDLSPEITTEDIKSAFAPFGKISDARVVKDMATGKSKGYGFVSF 106


>AY633610-1|AAV33303.1|  374|Homo sapiens aging-associated gene 7
           protein protein.
          Length = 374

 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 28/94 (29%), Positives = 51/94 (54%), Gaps = 1/94 (1%)
 Frame = +3

Query: 216 SRPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFE 395
           S  K+  S  +  FVG LS EI+ ++I++ F+ FG I +  +  D    + KG+ F++F 
Sbjct: 87  SSQKKDTSNHFHVFVGDLSPEITTEDIKSAFAPFGKISDARVVKDMATGKSKGYGFVSFY 146

Query: 396 SE-QVVNDLLKTPKRTIGGKEVDVKRATPKPDGP 494
           ++    N ++    + +GG+++    AT KP  P
Sbjct: 147 NKLDAENAIVHMGGQWLGGRQIRTNWATRKPPAP 180



 Score = 44.0 bits (99), Expect = 5e-04
 Identities = 19/50 (38%), Positives = 30/50 (60%)
 Frame = +1

Query: 4   HEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVF 153
           H  +FVG LS E T ++++  F  +G+I    V  D  TG+S+G+ F+ F
Sbjct: 96  HFHVFVGDLSPEITTEDIKSAFAPFGKISDARVVKDMATGKSKGYGFVSF 145



 Score = 36.3 bits (80), Expect = 0.091
 Identities = 25/75 (33%), Positives = 35/75 (46%), Gaps = 1/75 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF-ESEQVVNDLLKTP 431
           +VG LS ++++  I   FS+ G     +M  + T N    +CF+ F E       L    
Sbjct: 12  YVGNLSRDVTEVLILQLFSQIGPCKSCKMITEHTSND--PYCFVEFYEHRDAAAALAAMN 69

Query: 432 KRTIGGKEVDVKRAT 476
            R I GKEV V  AT
Sbjct: 70  GRKILGKEVKVNWAT 84


>U36608-1|AAC16917.1|  220|Homo sapiens Y-chromosome RNA recognition
           motif protein protein.
          Length = 220

 Score = 51.2 bits (117), Expect = 3e-06
 Identities = 32/81 (39%), Positives = 45/81 (55%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLF+GGL+ ET +K L+  FG +G I  + +  D  T +SRGFAFI F+ P   D   AA
Sbjct: 9   KLFIGGLNRETNEKMLKAVFGKHGPISEVLLIKD-RTSKSRGFAFITFENP--ADAKNAA 65

Query: 190 GEHTINNKKVDPKKAKARHGK 252
            +  +N K +  K  K    +
Sbjct: 66  KD--MNGKSLHGKAIKVEQAQ 84



 Score = 44.8 bits (101), Expect = 3e-04
 Identities = 25/74 (33%), Positives = 42/74 (56%), Gaps = 1/74 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGL+ E ++  ++  F + G I EV +  D+T   R GF FITFE+     +  K   
Sbjct: 11  FIGGLNRETNEKMLKAVFGKHGPISEVLLIKDRTSKSR-GFAFITFENPADAKNAAKDMN 69

Query: 435 -RTIGGKEVDVKRA 473
            +++ GK + V++A
Sbjct: 70  GKSLHGKAIKVEQA 83


>BX537770-1|CAD97833.1|  373|Homo sapiens hypothetical protein
           protein.
          Length = 373

 Score = 51.2 bits (117), Expect = 3e-06
 Identities = 24/58 (41%), Positives = 33/58 (56%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 183
           +L+VG L +  T+  LR  F  +G IESI +  D  TGRS+G+ FI F   E   K +
Sbjct: 94  RLYVGSLHFNITEDMLRGIFEPFGRIESIQLMMDSETGRSKGYGFITFSDSECAKKAL 151



 Score = 44.8 bits (101), Expect = 3e-04
 Identities = 25/83 (30%), Positives = 40/83 (48%), Gaps = 1/83 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF-ESEQVVNDLLKTP 431
           +VG L   I++D +R  F  FG I  +++  D    + KG+ FITF +SE     L +  
Sbjct: 96  YVGSLHFNITEDMLRGIFEPFGRIESIQLMMDSETGRSKGYGFITFSDSECAKKALEQLN 155

Query: 432 KRTIGGKEVDVKRATPKPDGPGA 500
              + G+ + V   T + D   A
Sbjct: 156 GFELAGRPMKVGHVTERTDASSA 178


>BC033674-1|AAH33674.1|  283|Homo sapiens bol, boule-like
           (Drosophila) protein.
          Length = 283

 Score = 51.2 bits (117), Expect = 3e-06
 Identities = 19/62 (30%), Positives = 36/62 (58%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           ++FVGG+ ++T + +LR  F  YG ++ + +  D   G S+G+ F+ F+  E   K++  
Sbjct: 34  RIFVGGIDFKTNESDLRKFFSQYGSVKEVKIVND-RAGVSKGYGFVTFETQEDAQKILQE 92

Query: 190 GE 195
            E
Sbjct: 93  AE 94



 Score = 48.0 bits (109), Expect = 3e-05
 Identities = 22/74 (29%), Positives = 45/74 (60%)
 Frame = +3

Query: 216 SRPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFE 395
           S P+ G       FVGG+  + ++ ++R FFS++G++ EV++  D+     KG+ F+TFE
Sbjct: 23  SAPRYGTVIPNRIFVGGIDFKTNESDLRKFFSQYGSVKEVKIVNDRA-GVSKGYGFVTFE 81

Query: 396 SEQVVNDLLKTPKR 437
           +++    +L+  ++
Sbjct: 82  TQEDAQKILQEAEK 95


>AM295005-1|CAL25726.1|  289|Homo sapiens boll protein protein.
          Length = 289

 Score = 51.2 bits (117), Expect = 3e-06
 Identities = 19/62 (30%), Positives = 36/62 (58%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           ++FVGG+ ++T + +LR  F  YG ++ + +  D   G S+G+ F+ F+  E   K++  
Sbjct: 40  RIFVGGIDFKTNESDLRKFFSQYGSVKEVKIVND-RAGVSKGYGFVTFETQEDAQKILQE 98

Query: 190 GE 195
            E
Sbjct: 99  AE 100



 Score = 48.0 bits (109), Expect = 3e-05
 Identities = 22/74 (29%), Positives = 45/74 (60%)
 Frame = +3

Query: 216 SRPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFE 395
           S P+ G       FVGG+  + ++ ++R FFS++G++ EV++  D+     KG+ F+TFE
Sbjct: 29  SAPRYGTVIPNRIFVGGIDFKTNESDLRKFFSQYGSVKEVKIVNDRA-GVSKGYGFVTFE 87

Query: 396 SEQVVNDLLKTPKR 437
           +++    +L+  ++
Sbjct: 88  TQEDAQKILQEAEK 101


>AK093453-1|BAC04171.1|  339|Homo sapiens protein ( Homo sapiens
           cDNA FLJ36134 fis, clone TESTI2024648, weakly similar to
           Homo sapiens germline specific RNA binding protein
           (DAZL1) mRNA. ).
          Length = 339

 Score = 51.2 bits (117), Expect = 3e-06
 Identities = 19/62 (30%), Positives = 36/62 (58%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           ++FVGG+ ++T + +LR  F  YG ++ + +  D   G S+G+ F+ F+  E   K++  
Sbjct: 40  RIFVGGIDFKTNESDLRKFFSQYGSVKEVKIVND-RAGVSKGYGFVTFETQEDAQKILQE 98

Query: 190 GE 195
            E
Sbjct: 99  AE 100



 Score = 48.0 bits (109), Expect = 3e-05
 Identities = 22/74 (29%), Positives = 45/74 (60%)
 Frame = +3

Query: 216 SRPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFE 395
           S P+ G       FVGG+  + ++ ++R FFS++G++ EV++  D+     KG+ F+TFE
Sbjct: 29  SAPRYGTVIPNRIFVGGIDFKTNESDLRKFFSQYGSVKEVKIVNDRA-GVSKGYGFVTFE 87

Query: 396 SEQVVNDLLKTPKR 437
           +++    +L+  ++
Sbjct: 88  TQEDAQKILQEAEK 101


>AK058099-1|BAB71664.1|  283|Homo sapiens protein ( Homo sapiens
           cDNA FLJ25370 fis, clone TST01870. ).
          Length = 283

 Score = 51.2 bits (117), Expect = 3e-06
 Identities = 19/62 (30%), Positives = 36/62 (58%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           ++FVGG+ ++T + +LR  F  YG ++ + +  D   G S+G+ F+ F+  E   K++  
Sbjct: 34  RIFVGGIDFKTNESDLRKFFSQYGSVKEVKIVND-RAGVSKGYGFVTFETQEDAQKILQE 92

Query: 190 GE 195
            E
Sbjct: 93  AE 94



 Score = 48.0 bits (109), Expect = 3e-05
 Identities = 22/74 (29%), Positives = 45/74 (60%)
 Frame = +3

Query: 216 SRPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFE 395
           S P+ G       FVGG+  + ++ ++R FFS++G++ EV++  D+     KG+ F+TFE
Sbjct: 23  SAPRYGTVIPNRIFVGGIDFKTNESDLRKFFSQYGSVKEVKIVNDRA-GVSKGYGFVTFE 81

Query: 396 SEQVVNDLLKTPKR 437
           +++    +L+  ++
Sbjct: 82  TQEDAQKILQEAEK 95


>AF272858-1|AAK58689.1|  283|Homo sapiens BOULE protein.
          Length = 283

 Score = 51.2 bits (117), Expect = 3e-06
 Identities = 19/62 (30%), Positives = 36/62 (58%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           ++FVGG+ ++T + +LR  F  YG ++ + +  D   G S+G+ F+ F+  E   K++  
Sbjct: 34  RIFVGGIDFKTNESDLRKFFSQYGSVKEVKIVND-RAGVSKGYGFVTFETQEDAQKILQE 92

Query: 190 GE 195
            E
Sbjct: 93  AE 94



 Score = 48.0 bits (109), Expect = 3e-05
 Identities = 22/74 (29%), Positives = 45/74 (60%)
 Frame = +3

Query: 216 SRPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFE 395
           S P+ G       FVGG+  + ++ ++R FFS++G++ EV++  D+     KG+ F+TFE
Sbjct: 23  SAPRYGTVIPNRIFVGGIDFKTNESDLRKFFSQYGSVKEVKIVNDRA-GVSKGYGFVTFE 81

Query: 396 SEQVVNDLLKTPKR 437
           +++    +L+  ++
Sbjct: 82  TQEDAQKILQEAEK 95


>AC011997-1|AAX93045.1|  283|Homo sapiens unknown protein.
          Length = 283

 Score = 51.2 bits (117), Expect = 3e-06
 Identities = 19/62 (30%), Positives = 36/62 (58%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           ++FVGG+ ++T + +LR  F  YG ++ + +  D   G S+G+ F+ F+  E   K++  
Sbjct: 34  RIFVGGIDFKTNESDLRKFFSQYGSVKEVKIVND-RAGVSKGYGFVTFETQEDAQKILQE 92

Query: 190 GE 195
            E
Sbjct: 93  AE 94



 Score = 48.0 bits (109), Expect = 3e-05
 Identities = 22/74 (29%), Positives = 45/74 (60%)
 Frame = +3

Query: 216 SRPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFE 395
           S P+ G       FVGG+  + ++ ++R FFS++G++ EV++  D+     KG+ F+TFE
Sbjct: 23  SAPRYGTVIPNRIFVGGIDFKTNESDLRKFFSQYGSVKEVKIVNDRA-GVSKGYGFVTFE 81

Query: 396 SEQVVNDLLKTPKR 437
           +++    +L+  ++
Sbjct: 82  TQEDAQKILQEAEK 95


>X76060-1|CAA53660.1|  419|Homo sapiens YRRM2 protein.
          Length = 419

 Score = 50.8 bits (116), Expect = 4e-06
 Identities = 25/51 (49%), Positives = 34/51 (66%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAP 162
           KLF+GGL+ ET +K L+  FG +G I  + +  D  T +SRGFAFI F+ P
Sbjct: 9   KLFIGGLNRETNEKMLKAVFGKHGPISEVLLIKD-RTSKSRGFAFITFENP 58



 Score = 44.8 bits (101), Expect = 3e-04
 Identities = 26/74 (35%), Positives = 41/74 (55%), Gaps = 1/74 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGL+ E ++  ++  F + G I EV +  D+T   R GF FITFE+     +  K   
Sbjct: 11  FIGGLNRETNEKMLKAVFGKHGPISEVLLIKDRTSKSR-GFAFITFENPADAKNAAKDMN 69

Query: 435 RT-IGGKEVDVKRA 473
            T + GK + V++A
Sbjct: 70  GTSLHGKAIKVEQA 83


>U68063-1|AAB08701.1|  288|Homo sapiens transformer-2 beta protein.
          Length = 288

 Score = 50.8 bits (116), Expect = 4e-06
 Identities = 28/75 (37%), Positives = 44/75 (58%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           L V GLS  TT+++LR+ F  YG I  +++  D  + RSRGFAF+ F   E++D    A 
Sbjct: 120 LGVFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYF---ENVDDAKEAK 176

Query: 193 EHTINNKKVDPKKAK 237
           E   N  ++D ++ +
Sbjct: 177 ERA-NGMELDGRRIR 190



 Score = 44.0 bits (99), Expect = 5e-04
 Identities = 24/71 (33%), Positives = 41/71 (57%)
 Frame = +3

Query: 258 VGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKR 437
           V GLS   ++ ++R  FS++G I +V + +D+   + +GF F+ FE+   V+D  K  K 
Sbjct: 122 VFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFEN---VDD-AKEAKE 177

Query: 438 TIGGKEVDVKR 470
              G E+D +R
Sbjct: 178 RANGMELDGRR 188


>U61267-1|AAC28242.1|  288|Homo sapiens htra2-beta protein.
          Length = 288

 Score = 50.8 bits (116), Expect = 4e-06
 Identities = 28/75 (37%), Positives = 44/75 (58%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           L V GLS  TT+++LR+ F  YG I  +++  D  + RSRGFAF+ F   E++D    A 
Sbjct: 120 LGVFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYF---ENVDDAKEAK 176

Query: 193 EHTINNKKVDPKKAK 237
           E   N  ++D ++ +
Sbjct: 177 ERA-NGMELDGRRIR 190



 Score = 44.0 bits (99), Expect = 5e-04
 Identities = 24/71 (33%), Positives = 41/71 (57%)
 Frame = +3

Query: 258 VGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKR 437
           V GLS   ++ ++R  FS++G I +V + +D+   + +GF F+ FE+   V+D  K  K 
Sbjct: 122 VFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFEN---VDD-AKEAKE 177

Query: 438 TIGGKEVDVKR 470
              G E+D +R
Sbjct: 178 RANGMELDGRR 188


>BC030018-1|AAH30018.1|  496|Homo sapiens RNA binding motif protein,
           Y-linked, family 1, member F protein.
          Length = 496

 Score = 50.8 bits (116), Expect = 4e-06
 Identities = 25/51 (49%), Positives = 34/51 (66%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAP 162
           KLF+GGL+ ET +K L+  FG +G I  + +  D  T +SRGFAFI F+ P
Sbjct: 9   KLFIGGLNRETNEKMLKAVFGKHGPISEVLLIKD-RTSKSRGFAFITFENP 58



 Score = 44.8 bits (101), Expect = 3e-04
 Identities = 26/74 (35%), Positives = 41/74 (55%), Gaps = 1/74 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGL+ E ++  ++  F + G I EV +  D+T   R GF FITFE+     +  K   
Sbjct: 11  FIGGLNRETNEKMLKAVFGKHGPISEVLLIKDRTSKSR-GFAFITFENPADAKNAAKDMN 69

Query: 435 RT-IGGKEVDVKRA 473
            T + GK + V++A
Sbjct: 70  GTSLHGKAIKVEQA 83


>BC005898-1|AAH05898.1|  288|Homo sapiens splicing factor,
           arginine/serine-rich 10 (transformer 2 homolog,
           Drosophila) protein.
          Length = 288

 Score = 50.8 bits (116), Expect = 4e-06
 Identities = 28/75 (37%), Positives = 44/75 (58%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           L V GLS  TT+++LR+ F  YG I  +++  D  + RSRGFAF+ F   E++D    A 
Sbjct: 120 LGVFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYF---ENVDDAKEAK 176

Query: 193 EHTINNKKVDPKKAK 237
           E   N  ++D ++ +
Sbjct: 177 ERA-NGMELDGRRIR 190



 Score = 44.0 bits (99), Expect = 5e-04
 Identities = 24/71 (33%), Positives = 41/71 (57%)
 Frame = +3

Query: 258 VGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKR 437
           V GLS   ++ ++R  FS++G I +V + +D+   + +GF F+ FE+   V+D  K  K 
Sbjct: 122 VFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFEN---VDD-AKEAKE 177

Query: 438 TIGGKEVDVKR 470
              G E+D +R
Sbjct: 178 RANGMELDGRR 188


>BC000451-1|AAH00451.1|  288|Homo sapiens splicing factor,
           arginine/serine-rich 10 (transformer 2 homolog,
           Drosophila) protein.
          Length = 288

 Score = 50.8 bits (116), Expect = 4e-06
 Identities = 28/75 (37%), Positives = 44/75 (58%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           L V GLS  TT+++LR+ F  YG I  +++  D  + RSRGFAF+ F   E++D    A 
Sbjct: 120 LGVFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYF---ENVDDAKEAK 176

Query: 193 EHTINNKKVDPKKAK 237
           E   N  ++D ++ +
Sbjct: 177 ERA-NGMELDGRRIR 190



 Score = 44.0 bits (99), Expect = 5e-04
 Identities = 24/71 (33%), Positives = 41/71 (57%)
 Frame = +3

Query: 258 VGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKR 437
           V GLS   ++ ++R  FS++G I +V + +D+   + +GF F+ FE+   V+D  K  K 
Sbjct: 122 VFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFEN---VDD-AKEAKE 177

Query: 438 TIGGKEVDVKR 470
              G E+D +R
Sbjct: 178 RANGMELDGRR 188


>BC000160-1|AAH00160.1|  288|Homo sapiens splicing factor,
           arginine/serine-rich 10 (transformer 2 homolog,
           Drosophila) protein.
          Length = 288

 Score = 50.8 bits (116), Expect = 4e-06
 Identities = 28/75 (37%), Positives = 44/75 (58%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           L V GLS  TT+++LR+ F  YG I  +++  D  + RSRGFAF+ F   E++D    A 
Sbjct: 120 LGVFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYF---ENVDDAKEAK 176

Query: 193 EHTINNKKVDPKKAK 237
           E   N  ++D ++ +
Sbjct: 177 ERA-NGMELDGRRIR 190



 Score = 44.0 bits (99), Expect = 5e-04
 Identities = 24/71 (33%), Positives = 41/71 (57%)
 Frame = +3

Query: 258 VGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKR 437
           V GLS   ++ ++R  FS++G I +V + +D+   + +GF F+ FE+   V+D  K  K 
Sbjct: 122 VFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFEN---VDD-AKEAKE 177

Query: 438 TIGGKEVDVKR 470
              G E+D +R
Sbjct: 178 RANGMELDGRR 188


>AK098191-1|BAC05256.1|  252|Homo sapiens protein ( Homo sapiens
           cDNA FLJ40872 fis, clone TUTER2000283, highly similar to
           Homo sapiens transformer-2-beta (SFRS10) gene. ).
          Length = 252

 Score = 50.8 bits (116), Expect = 4e-06
 Identities = 28/75 (37%), Positives = 44/75 (58%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           L V GLS  TT+++LR+ F  YG I  +++  D  + RSRGFAF+ F   E++D    A 
Sbjct: 84  LGVFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYF---ENVDDAKEAK 140

Query: 193 EHTINNKKVDPKKAK 237
           E   N  ++D ++ +
Sbjct: 141 ERA-NGMELDGRRIR 154



 Score = 44.0 bits (99), Expect = 5e-04
 Identities = 24/71 (33%), Positives = 41/71 (57%)
 Frame = +3

Query: 258 VGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKR 437
           V GLS   ++ ++R  FS++G I +V + +D+   + +GF F+ FE+   V+D  K  K 
Sbjct: 86  VFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFEN---VDD-AKEAKE 141

Query: 438 TIGGKEVDVKR 470
              G E+D +R
Sbjct: 142 RANGMELDGRR 152


>AF057159-3|AAD19278.1|  188|Homo sapiens transformer-2-beta isoform
           3 protein.
          Length = 188

 Score = 50.8 bits (116), Expect = 4e-06
 Identities = 28/75 (37%), Positives = 44/75 (58%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           L V GLS  TT+++LR+ F  YG I  +++  D  + RSRGFAF+ F   E++D    A 
Sbjct: 20  LGVFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYF---ENVDDAKEAK 76

Query: 193 EHTINNKKVDPKKAK 237
           E   N  ++D ++ +
Sbjct: 77  ERA-NGMELDGRRIR 90



 Score = 44.0 bits (99), Expect = 5e-04
 Identities = 24/71 (33%), Positives = 41/71 (57%)
 Frame = +3

Query: 258 VGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKR 437
           V GLS   ++ ++R  FS++G I +V + +D+   + +GF F+ FE+   V+D  K  K 
Sbjct: 22  VFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFEN---VDD-AKEAKE 77

Query: 438 TIGGKEVDVKR 470
              G E+D +R
Sbjct: 78  RANGMELDGRR 88


>AF057159-1|AAD19277.1|  288|Homo sapiens transformer-2-beta isoform
           1 protein.
          Length = 288

 Score = 50.8 bits (116), Expect = 4e-06
 Identities = 28/75 (37%), Positives = 44/75 (58%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           L V GLS  TT+++LR+ F  YG I  +++  D  + RSRGFAF+ F   E++D    A 
Sbjct: 120 LGVFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYF---ENVDDAKEAK 176

Query: 193 EHTINNKKVDPKKAK 237
           E   N  ++D ++ +
Sbjct: 177 ERA-NGMELDGRRIR 190



 Score = 44.0 bits (99), Expect = 5e-04
 Identities = 24/71 (33%), Positives = 41/71 (57%)
 Frame = +3

Query: 258 VGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKR 437
           V GLS   ++ ++R  FS++G I +V + +D+   + +GF F+ FE+   V+D  K  K 
Sbjct: 122 VFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFEN---VDD-AKEAKE 177

Query: 438 TIGGKEVDVKR 470
              G E+D +R
Sbjct: 178 RANGMELDGRR 188


>AB209208-1|BAD92445.1|  278|Homo sapiens splicing factor,
           arginine/serine-rich 10 (transformer 2 homolog,
           Drosophila) va protein.
          Length = 278

 Score = 50.8 bits (116), Expect = 4e-06
 Identities = 28/75 (37%), Positives = 44/75 (58%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           L V GLS  TT+++LR+ F  YG I  +++  D  + RSRGFAF+ F   E++D    A 
Sbjct: 108 LGVFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYF---ENVDDAKEAK 164

Query: 193 EHTINNKKVDPKKAK 237
           E   N  ++D ++ +
Sbjct: 165 ERA-NGMELDGRRIR 178



 Score = 44.0 bits (99), Expect = 5e-04
 Identities = 24/71 (33%), Positives = 41/71 (57%)
 Frame = +3

Query: 258 VGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKR 437
           V GLS   ++ ++R  FS++G I +V + +D+   + +GF F+ FE+   V+D  K  K 
Sbjct: 110 VFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFEN---VDD-AKEAKE 165

Query: 438 TIGGKEVDVKR 470
              G E+D +R
Sbjct: 166 RANGMELDGRR 176


>M60858-1|AAA59954.1|  707|Homo sapiens nucleolin protein.
          Length = 707

 Score = 49.2 bits (112), Expect = 1e-05
 Identities = 29/79 (36%), Positives = 42/79 (53%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           LFV GLS +TT++ L++ F   G + +  + TD  TG S+GF F+ F + E   + M  G
Sbjct: 574 LFVKGLSEDTTEETLKESFD--GSVRA-RIVTDRETGSSKGFGFVDFNSEEDAKEAMEDG 630

Query: 193 EHTINNKKVDPKKAKARHG 249
           E   N   +D  K K   G
Sbjct: 631 EIDGNKVTLDWAKPKGEGG 649


>BC105582-1|AAI05583.1|  173|Homo sapiens RBMX2 protein protein.
          Length = 173

 Score = 49.2 bits (112), Expect = 1e-05
 Identities = 21/52 (40%), Positives = 34/52 (65%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPES 168
           +F+GGL +E T+ ++   F  YGEI +IN+  D  TG+S+GF F+ ++   S
Sbjct: 38  IFLGGLPYELTEGDIICVFSQYGEIVNINLVRDKKTGKSKGFCFLCYEDQRS 89



 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 18/50 (36%), Positives = 33/50 (66%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQ 404
           F+GGL  E+++ +I   FS++G I+ + +  DK   + KGFCF+ +E ++
Sbjct: 39  FLGGLPYELTEGDIICVFSQYGEIVNINLVRDKKTGKSKGFCFLCYEDQR 88


>BC033750-1|AAH33750.1|  322|Homo sapiens RNA binding motif protein,
           X-linked 2 protein.
          Length = 322

 Score = 49.2 bits (112), Expect = 1e-05
 Identities = 21/52 (40%), Positives = 34/52 (65%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPES 168
           +F+GGL +E T+ ++   F  YGEI +IN+  D  TG+S+GF F+ ++   S
Sbjct: 38  IFLGGLPYELTEGDIICVFSQYGEIVNINLVRDKKTGKSKGFCFLCYEDQRS 89



 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 18/50 (36%), Positives = 33/50 (66%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQ 404
           F+GGL  E+++ +I   FS++G I+ + +  DK   + KGFCF+ +E ++
Sbjct: 39  FLGGLPYELTEGDIICVFSQYGEIVNINLVRDKKTGKSKGFCFLCYEDQR 88


>BC003676-1|AAH03676.1|  163|Homo sapiens Unknown (protein for
           IMAGE:3686686) protein.
          Length = 163

 Score = 49.2 bits (112), Expect = 1e-05
 Identities = 21/52 (40%), Positives = 34/52 (65%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPES 168
           +F+GGL +E T+ ++   F  YGEI +IN+  D  TG+S+GF F+ ++   S
Sbjct: 38  IFLGGLPYELTEGDIICVFSQYGEIVNINLVRDKKTGKSKGFCFLCYEDQRS 89



 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 18/50 (36%), Positives = 33/50 (66%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQ 404
           F+GGL  E+++ +I   FS++G I+ + +  DK   + KGFCF+ +E ++
Sbjct: 39  FLGGLPYELTEGDIICVFSQYGEIVNINLVRDKKTGKSKGFCFLCYEDQR 88


>AL050405-1|CAB43745.1|  322|Homo sapiens hypothetical protein
           protein.
          Length = 322

 Score = 49.2 bits (112), Expect = 1e-05
 Identities = 21/52 (40%), Positives = 34/52 (65%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPES 168
           +F+GGL +E T+ ++   F  YGEI +IN+  D  TG+S+GF F+ ++   S
Sbjct: 38  IFLGGLPYELTEGDIICVFSQYGEIVNINLVRDKKTGKSKGFCFLCYEDQRS 89



 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 18/50 (36%), Positives = 33/50 (66%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQ 404
           F+GGL  E+++ +I   FS++G I+ + +  DK   + KGFCF+ +E ++
Sbjct: 39  FLGGLPYELTEGDIICVFSQYGEIVNINLVRDKKTGKSKGFCFLCYEDQR 88


>AL035423-8|CAI42444.1|  322|Homo sapiens RNA binding motif protein,
           X-linked 2 protein.
          Length = 322

 Score = 49.2 bits (112), Expect = 1e-05
 Identities = 21/52 (40%), Positives = 34/52 (65%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPES 168
           +F+GGL +E T+ ++   F  YGEI +IN+  D  TG+S+GF F+ ++   S
Sbjct: 38  IFLGGLPYELTEGDIICVFSQYGEIVNINLVRDKKTGKSKGFCFLCYEDQRS 89



 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 18/50 (36%), Positives = 33/50 (66%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQ 404
           F+GGL  E+++ +I   FS++G I+ + +  DK   + KGFCF+ +E ++
Sbjct: 39  FLGGLPYELTEGDIICVFSQYGEIVNINLVRDKKTGKSKGFCFLCYEDQR 88


>AF151837-1|AAD34074.1|  351|Homo sapiens CGI-79 protein protein.
          Length = 351

 Score = 49.2 bits (112), Expect = 1e-05
 Identities = 21/52 (40%), Positives = 34/52 (65%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPES 168
           +F+GGL +E T+ ++   F  YGEI +IN+  D  TG+S+GF F+ ++   S
Sbjct: 38  IFLGGLPYELTEGDIICVFSQYGEIVNINLVRDKKTGKSKGFCFLCYEDQRS 89



 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 18/50 (36%), Positives = 33/50 (66%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQ 404
           F+GGL  E+++ +I   FS++G I+ + +  DK   + KGFCF+ +E ++
Sbjct: 39  FLGGLPYELTEGDIICVFSQYGEIVNINLVRDKKTGKSKGFCFLCYEDQR 88


>BC015944-1|AAH15944.1|  214|Homo sapiens TIA1 protein protein.
          Length = 214

 Score = 48.8 bits (111), Expect = 2e-05
 Identities = 25/81 (30%), Positives = 45/81 (55%), Gaps = 1/81 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESE-QVVNDLLKTP 431
           FVG LS EI+ ++I+  F+ FG I +  +  D    + KG+ F++F ++    N + +  
Sbjct: 109 FVGDLSPEITTEDIKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQMG 168

Query: 432 KRTIGGKEVDVKRATPKPDGP 494
            + +GG+++    AT KP  P
Sbjct: 169 GQWLGGRQIRTNWATRKPPAP 189



 Score = 42.7 bits (96), Expect = 0.001
 Identities = 19/50 (38%), Positives = 29/50 (58%)
 Frame = +1

Query: 4   HEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVF 153
           H  +FVG LS E T ++++  F  +G I    V  D  TG+S+G+ F+ F
Sbjct: 105 HFHVFVGDLSPEITTEDIKAAFAPFGRISDARVVKDMATGKSKGYGFVSF 154



 Score = 36.7 bits (81), Expect = 0.069
 Identities = 25/75 (33%), Positives = 34/75 (45%), Gaps = 1/75 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF-ESEQVVNDLLKTP 431
           +VG LS ++++  I   FS+ G     +M  D   N    +CF+ F E       L    
Sbjct: 10  YVGNLSRDVTEALILQLFSQIGPCKNCKMIMDTAGND--PYCFVEFHEHRHAAAALAAMN 67

Query: 432 KRTIGGKEVDVKRAT 476
            R I GKEV V  AT
Sbjct: 68  GRKIMGKEVKVNWAT 82


>BC013889-1|AAH13889.1|  759|Homo sapiens RNA binding motif protein
           28 protein.
          Length = 759

 Score = 48.8 bits (111), Expect = 2e-05
 Identities = 33/127 (25%), Positives = 64/127 (50%), Gaps = 2/127 (1%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM--A 186
           +F+  LS+++ ++EL +    +GE++ + +   P+T  S+G AF  F   E+  K +  A
Sbjct: 337 VFIRNLSFDSEEEELGELLQQFGELKYVRIVLHPDTEHSKGCAFAQFMTQEAAQKCLLAA 396

Query: 187 AGEHTINNKKVDPKKAKARHGKILSEDSAVKSQMMKSETSSVNLELS*KWRCPLTKQRTK 366
           + E+     K+D ++ K        E + +++  +K  T + NL L+   R  L +  TK
Sbjct: 397 SPENEAGGLKLDGRQLKVDLAVTRDEAAKLQTTKVKKPTGTRNLYLA---REGLIRAGTK 453

Query: 367 ERASVSS 387
               VS+
Sbjct: 454 AAEGVSA 460



 Score = 40.7 bits (91), Expect = 0.004
 Identities = 24/76 (31%), Positives = 41/76 (53%), Gaps = 1/76 (1%)
 Frame = +3

Query: 258 VGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLK-TPK 434
           +  LS + S+D+++  F++FG +LEV +P  K   + +GF F+ F++       LK    
Sbjct: 118 IRNLSFKCSEDDLKTVFAQFGAVLEVNIP-RKPDGKMRGFGFVQFKNLLEAGKALKGMNM 176

Query: 435 RTIGGKEVDVKRATPK 482
           + I G+ V V  A  K
Sbjct: 177 KEIKGRTVAVDWAVAK 192



 Score = 33.5 bits (73), Expect = 0.64
 Identities = 15/57 (26%), Positives = 27/57 (47%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 183
           LFVG L      ++L + F   G ++   V T+  +   RGF ++ F   E + + +
Sbjct: 6   LFVGRLPPSARSEQLEELFSQVGPVKQCFVVTEKGSKACRGFGYVTFSMLEDVQRAL 62



 Score = 31.5 bits (68), Expect = 2.6
 Identities = 20/76 (26%), Positives = 35/76 (46%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVG L      +++   FS+ G + +  +  +K     +GF ++TF   + V   LK   
Sbjct: 7   FVGRLPPSARSEQLEELFSQVGPVKQCFVVTEKGSKACRGFGYVTFSMLEDVQRALK-EI 65

Query: 435 RTIGGKEVDVKRATPK 482
            T  G +++V  A  K
Sbjct: 66  TTFEGCKINVTVAKKK 81


>AK222716-1|BAD96436.1|  759|Homo sapiens RNA binding motif protein
           28 variant protein.
          Length = 759

 Score = 48.8 bits (111), Expect = 2e-05
 Identities = 33/127 (25%), Positives = 64/127 (50%), Gaps = 2/127 (1%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM--A 186
           +F+  LS+++ ++EL +    +GE++ + +   P+T  S+G AF  F   E+  K +  A
Sbjct: 337 VFIRNLSFDSEEEELGELLQQFGELKYVRIVLHPDTEHSKGCAFAQFMTQEAAQKCLLAA 396

Query: 187 AGEHTINNKKVDPKKAKARHGKILSEDSAVKSQMMKSETSSVNLELS*KWRCPLTKQRTK 366
           + E+     K+D ++ K        E + +++  +K  T + NL L+   R  L +  TK
Sbjct: 397 SPENEAGGLKLDGRQLKVDLAVTRDEAAKLQTTKVKKPTGTRNLYLA---REGLIRAGTK 453

Query: 367 ERASVSS 387
               VS+
Sbjct: 454 AAEGVSA 460



 Score = 40.7 bits (91), Expect = 0.004
 Identities = 24/76 (31%), Positives = 41/76 (53%), Gaps = 1/76 (1%)
 Frame = +3

Query: 258 VGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLK-TPK 434
           +  LS + S+D+++  F++FG +LEV +P  K   + +GF F+ F++       LK    
Sbjct: 118 IRNLSFKCSEDDLKTVFAQFGAVLEVNIP-RKPDGKMRGFGFVQFKNLLEAGKALKGMNM 176

Query: 435 RTIGGKEVDVKRATPK 482
           + I G+ V V  A  K
Sbjct: 177 KEIKGRTVAVDWAVAK 192



 Score = 32.7 bits (71), Expect = 1.1
 Identities = 15/57 (26%), Positives = 27/57 (47%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 183
           LFVG L      ++L + F   G ++   V T+  +   RGF ++ F   E + + +
Sbjct: 6   LFVGRLPPSARSEQLGELFSQVGPVKQCFVVTEKGSKACRGFGYVTFSMLEDVQRAL 62



 Score = 30.7 bits (66), Expect = 4.5
 Identities = 20/76 (26%), Positives = 35/76 (46%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVG L      +++   FS+ G + +  +  +K     +GF ++TF   + V   LK   
Sbjct: 7   FVGRLPPSARSEQLGELFSQVGPVKQCFVVTEKGSKACRGFGYVTFSMLEDVQRALK-EI 65

Query: 435 RTIGGKEVDVKRATPK 482
            T  G +++V  A  K
Sbjct: 66  TTFEGCKINVTVAKKK 81


>AK001239-1|BAA91575.1|  759|Homo sapiens protein ( Homo sapiens
           cDNA FLJ10377 fis, clone NT2RM2001989, weakly similar to
           NUCLEOLAR PROTEIN NOP4. ).
          Length = 759

 Score = 48.8 bits (111), Expect = 2e-05
 Identities = 33/127 (25%), Positives = 64/127 (50%), Gaps = 2/127 (1%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM--A 186
           +F+  LS+++ ++EL +    +GE++ + +   P+T  S+G AF  F   E+  K +  A
Sbjct: 337 VFIRNLSFDSEEEELGELLQQFGELKYVRIVLHPDTEHSKGCAFAQFMTQEAAQKCLLAA 396

Query: 187 AGEHTINNKKVDPKKAKARHGKILSEDSAVKSQMMKSETSSVNLELS*KWRCPLTKQRTK 366
           + E+     K+D ++ K        E + +++  +K  T + NL L+   R  L +  TK
Sbjct: 397 SPENEAGGLKLDGRQLKVDLAVTRDEAAKLQTTKVKKPTGTRNLYLA---REGLIRAGTK 453

Query: 367 ERASVSS 387
               VS+
Sbjct: 454 AAEGVSA 460



 Score = 40.7 bits (91), Expect = 0.004
 Identities = 24/76 (31%), Positives = 41/76 (53%), Gaps = 1/76 (1%)
 Frame = +3

Query: 258 VGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLK-TPK 434
           +  LS + S+D+++  F++FG +LEV +P  K   + +GF F+ F++       LK    
Sbjct: 118 IRNLSFKCSEDDLKTVFAQFGAVLEVNIP-RKPDGKMRGFGFVQFKNLLEAGKALKGMNM 176

Query: 435 RTIGGKEVDVKRATPK 482
           + I G+ V V  A  K
Sbjct: 177 KEIKGRTVAVDWAVAK 192



 Score = 33.5 bits (73), Expect = 0.64
 Identities = 15/57 (26%), Positives = 27/57 (47%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 183
           LFVG L      ++L + F   G ++   V T+  +   RGF ++ F   E + + +
Sbjct: 6   LFVGRLPPSARSEQLEELFSQVGPVKQCFVVTEKGSKACRGFGYVTFSMLEDVQRAL 62



 Score = 31.5 bits (68), Expect = 2.6
 Identities = 20/76 (26%), Positives = 35/76 (46%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVG L      +++   FS+ G + +  +  +K     +GF ++TF   + V   LK   
Sbjct: 7   FVGRLPPSARSEQLEELFSQVGPVKQCFVVTEKGSKACRGFGYVTFSMLEDVQRALK-EI 65

Query: 435 RTIGGKEVDVKRATPK 482
            T  G +++V  A  K
Sbjct: 66  TTFEGCKINVTVAKKK 81


>AC016700-3|AAX93193.1|  386|Homo sapiens unknown protein.
          Length = 386

 Score = 48.8 bits (111), Expect = 2e-05
 Identities = 25/81 (30%), Positives = 45/81 (55%), Gaps = 1/81 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESE-QVVNDLLKTP 431
           FVG LS EI+ ++I+  F+ FG I +  +  D    + KG+ F++F ++    N + +  
Sbjct: 109 FVGDLSPEITTEDIKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQMG 168

Query: 432 KRTIGGKEVDVKRATPKPDGP 494
            + +GG+++    AT KP  P
Sbjct: 169 GQWLGGRQIRTNWATRKPPAP 189



 Score = 42.7 bits (96), Expect = 0.001
 Identities = 19/50 (38%), Positives = 29/50 (58%)
 Frame = +1

Query: 4   HEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVF 153
           H  +FVG LS E T ++++  F  +G I    V  D  TG+S+G+ F+ F
Sbjct: 105 HFHVFVGDLSPEITTEDIKAAFAPFGRISDARVVKDMATGKSKGYGFVSF 154



 Score = 36.7 bits (81), Expect = 0.069
 Identities = 25/75 (33%), Positives = 34/75 (45%), Gaps = 1/75 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF-ESEQVVNDLLKTP 431
           +VG LS ++++  I   FS+ G     +M  D   N    +CF+ F E       L    
Sbjct: 10  YVGNLSRDVTEALILQLFSQIGPCKNCKMIMDTAGND--PYCFVEFHEHRHAAAALAAMN 67

Query: 432 KRTIGGKEVDVKRAT 476
            R I GKEV V  AT
Sbjct: 68  GRKIMGKEVKVNWAT 82


>AB209211-1|BAD92448.1|  464|Homo sapiens TIA1 protein variant
           protein.
          Length = 464

 Score = 48.8 bits (111), Expect = 2e-05
 Identities = 25/81 (30%), Positives = 45/81 (55%), Gaps = 1/81 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESE-QVVNDLLKTP 431
           FVG LS EI+ ++I+  F+ FG I +  +  D    + KG+ F++F ++    N + +  
Sbjct: 147 FVGDLSPEITTEDIKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQMG 206

Query: 432 KRTIGGKEVDVKRATPKPDGP 494
            + +GG+++    AT KP  P
Sbjct: 207 GQWLGGRQIRTNWATRKPPAP 227



 Score = 42.7 bits (96), Expect = 0.001
 Identities = 19/50 (38%), Positives = 29/50 (58%)
 Frame = +1

Query: 4   HEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVF 153
           H  +FVG LS E T ++++  F  +G I    V  D  TG+S+G+ F+ F
Sbjct: 143 HFHVFVGDLSPEITTEDIKAAFAPFGRISDARVVKDMATGKSKGYGFVSF 192



 Score = 36.7 bits (81), Expect = 0.069
 Identities = 25/75 (33%), Positives = 34/75 (45%), Gaps = 1/75 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF-ESEQVVNDLLKTP 431
           +VG LS ++++  I   FS+ G     +M  D   N    +CF+ F E       L    
Sbjct: 48  YVGNLSRDVTEALILQLFSQIGPCKNCKMIMDTAGND--PYCFVEFHEHRHAAAALAAMN 105

Query: 432 KRTIGGKEVDVKRAT 476
            R I GKEV V  AT
Sbjct: 106 GRKIMGKEVKVNWAT 120


>BC010939-1|AAH10939.1|  306|Homo sapiens poly(A) binding protein,
           nuclear 1 protein.
          Length = 306

 Score = 47.6 bits (108), Expect = 4e-05
 Identities = 23/101 (22%), Positives = 45/101 (44%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           ++VG + +  T +EL  HF   G +  + +  D  +G  +GFA+I F   ES+   +A  
Sbjct: 174 IYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALD 233

Query: 193 EHTINNKKVDPKKAKARHGKILSEDSAVKSQMMKSETSSVN 315
           E     +++     +     I + D        ++ T++ N
Sbjct: 234 ESLFRGRQIKVIPKRTNRPGISTTDRGFPRARYRARTTNYN 274



 Score = 33.9 bits (74), Expect = 0.49
 Identities = 19/78 (24%), Positives = 36/78 (46%), Gaps = 1/78 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           +VG +    + +E+   F   G++  V +  DK     KGF +I F  ++ V   L   +
Sbjct: 175 YVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDE 234

Query: 435 RTIGGKEVDV-KRATPKP 485
               G+++ V  + T +P
Sbjct: 235 SLFRGRQIKVIPKRTNRP 252


>AF026029-1|AAC39596.1|  306|Homo sapiens poly(A) binding protein II
           protein.
          Length = 306

 Score = 47.6 bits (108), Expect = 4e-05
 Identities = 23/101 (22%), Positives = 45/101 (44%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           ++VG + +  T +EL  HF   G +  + +  D  +G  +GFA+I F   ES+   +A  
Sbjct: 174 IYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALD 233

Query: 193 EHTINNKKVDPKKAKARHGKILSEDSAVKSQMMKSETSSVN 315
           E     +++     +     I + D        ++ T++ N
Sbjct: 234 ESLFRGRQIKVIPKRTNRPGISTTDRGFPRARYRARTTNYN 274



 Score = 33.9 bits (74), Expect = 0.49
 Identities = 19/78 (24%), Positives = 36/78 (46%), Gaps = 1/78 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           +VG +    + +E+   F   G++  V +  DK     KGF +I F  ++ V   L   +
Sbjct: 175 YVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDE 234

Query: 435 RTIGGKEVDV-KRATPKP 485
               G+++ V  + T +P
Sbjct: 235 SLFRGRQIKVIPKRTNRP 252


>U51586-1|AAB41656.1|  541|Homo sapiens siah binding protein 1
           protein.
          Length = 541

 Score = 47.2 bits (107), Expect = 5e-05
 Identities = 22/73 (30%), Positives = 38/73 (52%), Gaps = 1/73 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           +VG +  E+ +D IR  F+ FG I  ++M +D    + KGF F+ +E  +     L+   
Sbjct: 114 YVGSIYYELGEDTIRQAFAPFGPIKSIDMSWDSVTMKHKGFAFVEYEVPEAAQLALEQMN 173

Query: 435 RT-IGGKEVDVKR 470
              +GG+ + V R
Sbjct: 174 SVMLGGRNIKVGR 186



 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 23/78 (29%), Positives = 40/78 (51%), Gaps = 1/78 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           +V  +  ++SDD+I++ F  FG I    +  D T  + KG+ FI +E  Q   D + +  
Sbjct: 211 YVASVHQDLSDDDIKSVFEAFGKIKSCTLARDPTTGKHKGYGFIEYEKAQSSQDAVSSMN 270

Query: 435 R-TIGGKEVDVKRATPKP 485
              +GG+ + V +A   P
Sbjct: 271 LFDLGGQYLRVGKAVTPP 288



 Score = 43.6 bits (98), Expect = 6e-04
 Identities = 17/53 (32%), Positives = 34/53 (64%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPES 168
           +++VG + +E  +  +R  F  +G I+SI++  D  T + +GFAF+ ++ PE+
Sbjct: 112 RVYVGSIYYELGEDTIRQAFAPFGPIKSIDMSWDSVTMKHKGFAFVEYEVPEA 164



 Score = 43.6 bits (98), Expect = 6e-04
 Identities = 19/58 (32%), Positives = 36/58 (62%), Gaps = 1/58 (1%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVF-KAPESIDKV 180
           +++V  +  + +D +++  F A+G+I+S  +  DP TG+ +G+ FI + KA  S D V
Sbjct: 209 RIYVASVHQDLSDDDIKSVFEAFGKIKSCTLARDPTTGKHKGYGFIEYEKAQSSQDAV 266


>CR457143-1|CAG33424.1|  559|Homo sapiens SIAHBP1 protein.
          Length = 559

 Score = 47.2 bits (107), Expect = 5e-05
 Identities = 22/73 (30%), Positives = 38/73 (52%), Gaps = 1/73 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           +VG +  E+ +D IR  F+ FG I  ++M +D    + KGF F+ +E  +     L+   
Sbjct: 132 YVGSIYYELGEDTIRQAFAPFGPIKSIDMSWDSVTMKHKGFAFVEYEVPEAAQLALEQMN 191

Query: 435 RT-IGGKEVDVKR 470
              +GG+ + V R
Sbjct: 192 SVMLGGRNIKVGR 204



 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 23/78 (29%), Positives = 40/78 (51%), Gaps = 1/78 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           +V  +  ++SDD+I++ F  FG I    +  D T  + KG+ FI +E  Q   D + +  
Sbjct: 229 YVASVHQDLSDDDIKSVFEAFGKIKSCTLARDPTTGKHKGYGFIEYEKAQSSQDAVSSMN 288

Query: 435 R-TIGGKEVDVKRATPKP 485
              +GG+ + V +A   P
Sbjct: 289 LFDLGGQYLRVGKAVTPP 306



 Score = 43.6 bits (98), Expect = 6e-04
 Identities = 17/53 (32%), Positives = 34/53 (64%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPES 168
           +++VG + +E  +  +R  F  +G I+SI++  D  T + +GFAF+ ++ PE+
Sbjct: 130 RVYVGSIYYELGEDTIRQAFAPFGPIKSIDMSWDSVTMKHKGFAFVEYEVPEA 182



 Score = 43.6 bits (98), Expect = 6e-04
 Identities = 19/58 (32%), Positives = 36/58 (62%), Gaps = 1/58 (1%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVF-KAPESIDKV 180
           +++V  +  + +D +++  F A+G+I+S  +  DP TG+ +G+ FI + KA  S D V
Sbjct: 227 RIYVASVHQDLSDDDIKSVFEAFGKIKSCTLARDPTTGKHKGYGFIEYEKAQSSQDAV 284


>BC011979-1|AAH11979.1|  516|Homo sapiens SIAHBP1 protein protein.
          Length = 516

 Score = 47.2 bits (107), Expect = 5e-05
 Identities = 22/73 (30%), Positives = 38/73 (52%), Gaps = 1/73 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           +VG +  E+ +D IR  F+ FG I  ++M +D    + KGF F+ +E  +     L+   
Sbjct: 89  YVGSIYYELGEDTIRQAFAPFGPIKSIDMSWDSVTMKHKGFAFVEYEVPEAAQLALEQMN 148

Query: 435 RT-IGGKEVDVKR 470
              +GG+ + V R
Sbjct: 149 SVMLGGRNIKVGR 161



 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 23/78 (29%), Positives = 40/78 (51%), Gaps = 1/78 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           +V  +  ++SDD+I++ F  FG I    +  D T  + KG+ FI +E  Q   D + +  
Sbjct: 186 YVASVHQDLSDDDIKSVFEAFGKIKSCTLARDPTTGKHKGYGFIEYEKAQSSQDAVSSMN 245

Query: 435 R-TIGGKEVDVKRATPKP 485
              +GG+ + V +A   P
Sbjct: 246 LFDLGGQYLRVGKAVTPP 263



 Score = 43.6 bits (98), Expect = 6e-04
 Identities = 17/53 (32%), Positives = 34/53 (64%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPES 168
           +++VG + +E  +  +R  F  +G I+SI++  D  T + +GFAF+ ++ PE+
Sbjct: 87  RVYVGSIYYELGEDTIRQAFAPFGPIKSIDMSWDSVTMKHKGFAFVEYEVPEA 139



 Score = 43.6 bits (98), Expect = 6e-04
 Identities = 19/58 (32%), Positives = 36/58 (62%), Gaps = 1/58 (1%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVF-KAPESIDKV 180
           +++V  +  + +D +++  F A+G+I+S  +  DP TG+ +G+ FI + KA  S D V
Sbjct: 184 RIYVASVHQDLSDDDIKSVFEAFGKIKSCTLARDPTTGKHKGYGFIEYEKAQSSQDAV 241


>BC011265-1|AAH11265.1|  516|Homo sapiens SIAHBP1 protein protein.
          Length = 516

 Score = 47.2 bits (107), Expect = 5e-05
 Identities = 22/73 (30%), Positives = 38/73 (52%), Gaps = 1/73 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           +VG +  E+ +D IR  F+ FG I  ++M +D    + KGF F+ +E  +     L+   
Sbjct: 89  YVGSIYYELGEDTIRQAFAPFGPIKSIDMSWDSVTMKHKGFAFVEYEVPEAAQLALEQMN 148

Query: 435 RT-IGGKEVDVKR 470
              +GG+ + V R
Sbjct: 149 SVMLGGRNIKVGR 161



 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 23/78 (29%), Positives = 40/78 (51%), Gaps = 1/78 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           +V  +  ++SDD+I++ F  FG I    +  D T  + KG+ FI +E  Q   D + +  
Sbjct: 186 YVASVHQDLSDDDIKSVFEAFGKIKSCTLARDPTTGKHKGYGFIEYEKAQSSQDAVSSMN 245

Query: 435 R-TIGGKEVDVKRATPKP 485
              +GG+ + V +A   P
Sbjct: 246 LFDLGGQYLRVGKAVTPP 263



 Score = 43.6 bits (98), Expect = 6e-04
 Identities = 17/53 (32%), Positives = 34/53 (64%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPES 168
           +++VG + +E  +  +R  F  +G I+SI++  D  T + +GFAF+ ++ PE+
Sbjct: 87  RVYVGSIYYELGEDTIRQAFAPFGPIKSIDMSWDSVTMKHKGFAFVEYEVPEA 139



 Score = 43.6 bits (98), Expect = 6e-04
 Identities = 19/58 (32%), Positives = 36/58 (62%), Gaps = 1/58 (1%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVF-KAPESIDKV 180
           +++V  +  + +D +++  F A+G+I+S  +  DP TG+ +G+ FI + KA  S D V
Sbjct: 184 RIYVASVHQDLSDDDIKSVFEAFGKIKSCTLARDPTTGKHKGYGFIEYEKAQSSQDAV 241


>BC009734-1|AAH09734.1|  499|Homo sapiens SIAHBP1 protein protein.
          Length = 499

 Score = 47.2 bits (107), Expect = 5e-05
 Identities = 22/73 (30%), Positives = 38/73 (52%), Gaps = 1/73 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           +VG +  E+ +D IR  F+ FG I  ++M +D    + KGF F+ +E  +     L+   
Sbjct: 72  YVGSIYYELGEDTIRQAFAPFGPIKSIDMSWDSVTMKHKGFAFVEYEVPEAAQLALEQMN 131

Query: 435 RT-IGGKEVDVKR 470
              +GG+ + V R
Sbjct: 132 SVMLGGRNIKVGR 144



 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 23/78 (29%), Positives = 40/78 (51%), Gaps = 1/78 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           +V  +  ++SDD+I++ F  FG I    +  D T  + KG+ FI +E  Q   D + +  
Sbjct: 169 YVASVHQDLSDDDIKSVFEAFGKIKSCTLARDPTTGKHKGYGFIEYEKAQSSQDAVSSMN 228

Query: 435 R-TIGGKEVDVKRATPKP 485
              +GG+ + V +A   P
Sbjct: 229 LFDLGGQYLRVGKAVTPP 246



 Score = 43.6 bits (98), Expect = 6e-04
 Identities = 17/53 (32%), Positives = 34/53 (64%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPES 168
           +++VG + +E  +  +R  F  +G I+SI++  D  T + +GFAF+ ++ PE+
Sbjct: 70  RVYVGSIYYELGEDTIRQAFAPFGPIKSIDMSWDSVTMKHKGFAFVEYEVPEA 122



 Score = 43.6 bits (98), Expect = 6e-04
 Identities = 19/58 (32%), Positives = 36/58 (62%), Gaps = 1/58 (1%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVF-KAPESIDKV 180
           +++V  +  + +D +++  F A+G+I+S  +  DP TG+ +G+ FI + KA  S D V
Sbjct: 167 RIYVASVHQDLSDDDIKSVFEAFGKIKSCTLARDPTTGKHKGYGFIEYEKAQSSQDAV 224


>BC008875-1|AAH08875.1|  542|Homo sapiens fuse-binding
           protein-interacting repressor protein.
          Length = 542

 Score = 47.2 bits (107), Expect = 5e-05
 Identities = 22/73 (30%), Positives = 38/73 (52%), Gaps = 1/73 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           +VG +  E+ +D IR  F+ FG I  ++M +D    + KGF F+ +E  +     L+   
Sbjct: 115 YVGSIYYELGEDTIRQAFAPFGPIKSIDMSWDSVTMKHKGFAFVEYEVPEAAQLALEQMN 174

Query: 435 RT-IGGKEVDVKR 470
              +GG+ + V R
Sbjct: 175 SVMLGGRNIKVGR 187



 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 23/78 (29%), Positives = 40/78 (51%), Gaps = 1/78 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           +V  +  ++SDD+I++ F  FG I    +  D T  + KG+ FI +E  Q   D + +  
Sbjct: 212 YVASVHQDLSDDDIKSVFEAFGKIKSCTLARDPTTGKHKGYGFIEYEKAQSSQDAVSSMN 271

Query: 435 R-TIGGKEVDVKRATPKP 485
              +GG+ + V +A   P
Sbjct: 272 LFDLGGQYLRVGKAVTPP 289



 Score = 43.6 bits (98), Expect = 6e-04
 Identities = 17/53 (32%), Positives = 34/53 (64%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPES 168
           +++VG + +E  +  +R  F  +G I+SI++  D  T + +GFAF+ ++ PE+
Sbjct: 113 RVYVGSIYYELGEDTIRQAFAPFGPIKSIDMSWDSVTMKHKGFAFVEYEVPEA 165



 Score = 43.6 bits (98), Expect = 6e-04
 Identities = 19/58 (32%), Positives = 36/58 (62%), Gaps = 1/58 (1%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVF-KAPESIDKV 180
           +++V  +  + +D +++  F A+G+I+S  +  DP TG+ +G+ FI + KA  S D V
Sbjct: 210 RIYVASVHQDLSDDDIKSVFEAFGKIKSCTLARDPTTGKHKGYGFIEYEKAQSSQDAV 267


>AF217197-1|AAF27522.2|  542|Homo sapiens FBP-interacting repressor
           protein.
          Length = 542

 Score = 47.2 bits (107), Expect = 5e-05
 Identities = 22/73 (30%), Positives = 38/73 (52%), Gaps = 1/73 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           +VG +  E+ +D IR  F+ FG I  ++M +D    + KGF F+ +E  +     L+   
Sbjct: 115 YVGSIYYELGEDTIRQAFAPFGPIKSIDMSWDSVTMKHKGFAFVEYEVPEAAQLALEQMN 174

Query: 435 RT-IGGKEVDVKR 470
              +GG+ + V R
Sbjct: 175 SVMLGGRNIKVGR 187



 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 23/78 (29%), Positives = 40/78 (51%), Gaps = 1/78 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           +V  +  ++SDD+I++ F  FG I    +  D T  + KG+ FI +E  Q   D + +  
Sbjct: 212 YVASVHQDLSDDDIKSVFEAFGKIKSCTLARDPTTGKHKGYGFIEYEKAQSSQDAVSSMN 271

Query: 435 R-TIGGKEVDVKRATPKP 485
              +GG+ + V +A   P
Sbjct: 272 LFDLGGQYLRVGKAVTPP 289



 Score = 43.6 bits (98), Expect = 6e-04
 Identities = 17/53 (32%), Positives = 34/53 (64%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPES 168
           +++VG + +E  +  +R  F  +G I+SI++  D  T + +GFAF+ ++ PE+
Sbjct: 113 RVYVGSIYYELGEDTIRQAFAPFGPIKSIDMSWDSVTMKHKGFAFVEYEVPEA 165



 Score = 43.6 bits (98), Expect = 6e-04
 Identities = 19/58 (32%), Positives = 36/58 (62%), Gaps = 1/58 (1%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVF-KAPESIDKV 180
           +++V  +  + +D +++  F A+G+I+S  +  DP TG+ +G+ FI + KA  S D V
Sbjct: 210 RIYVASVHQDLSDDDIKSVFEAFGKIKSCTLARDPTTGKHKGYGFIEYEKAQSSQDAV 267


>AF190744-1|AAF05605.1|  556|Homo sapiens poly-U binding splicing
           factor PUF60 protein.
          Length = 556

 Score = 47.2 bits (107), Expect = 5e-05
 Identities = 22/73 (30%), Positives = 38/73 (52%), Gaps = 1/73 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           +VG +  E+ +D IR  F+ FG I  ++M +D    + KGF F+ +E  +     L+   
Sbjct: 129 YVGSIYYELGEDTIRQAFAPFGPIKSIDMSWDSVTMKHKGFAFVEYEVPEAAQLALEQMN 188

Query: 435 RT-IGGKEVDVKR 470
              +GG+ + V R
Sbjct: 189 SVMLGGRNIKVGR 201



 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 23/78 (29%), Positives = 40/78 (51%), Gaps = 1/78 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           +V  +  ++SDD+I++ F  FG I    +  D T  + KG+ FI +E  Q   D + +  
Sbjct: 226 YVASVHQDLSDDDIKSVFEAFGKIKSCTLARDPTTGKHKGYGFIEYEKAQSSQDAVSSMN 285

Query: 435 R-TIGGKEVDVKRATPKP 485
              +GG+ + V +A   P
Sbjct: 286 LFDLGGQYLRVGKAVTPP 303



 Score = 43.6 bits (98), Expect = 6e-04
 Identities = 17/53 (32%), Positives = 34/53 (64%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPES 168
           +++VG + +E  +  +R  F  +G I+SI++  D  T + +GFAF+ ++ PE+
Sbjct: 127 RVYVGSIYYELGEDTIRQAFAPFGPIKSIDMSWDSVTMKHKGFAFVEYEVPEA 179



 Score = 43.6 bits (98), Expect = 6e-04
 Identities = 19/58 (32%), Positives = 36/58 (62%), Gaps = 1/58 (1%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVF-KAPESIDKV 180
           +++V  +  + +D +++  F A+G+I+S  +  DP TG+ +G+ FI + KA  S D V
Sbjct: 224 RIYVASVHQDLSDDDIKSVFEAFGKIKSCTLARDPTTGKHKGYGFIEYEKAQSSQDAV 281


>AF114818-1|AAF23589.1|  559|Homo sapiens Ro
           ribonucleoprotein-binding protein 1 protein.
          Length = 559

 Score = 47.2 bits (107), Expect = 5e-05
 Identities = 22/73 (30%), Positives = 38/73 (52%), Gaps = 1/73 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           +VG +  E+ +D IR  F+ FG I  ++M +D    + KGF F+ +E  +     L+   
Sbjct: 132 YVGSIYYELGEDTIRQAFAPFGPIKSIDMSWDSVTMKHKGFAFVEYEVPEAAQLALEQMN 191

Query: 435 RT-IGGKEVDVKR 470
              +GG+ + V R
Sbjct: 192 SVMLGGRNIKVGR 204



 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 23/78 (29%), Positives = 40/78 (51%), Gaps = 1/78 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           +V  +  ++SDD+I++ F  FG I    +  D T  + KG+ FI +E  Q   D + +  
Sbjct: 229 YVASVHQDLSDDDIKSVFEAFGKIKSCTLARDPTTGKHKGYGFIEYEKAQSSQDAVSSMN 288

Query: 435 R-TIGGKEVDVKRATPKP 485
              +GG+ + V +A   P
Sbjct: 289 LFDLGGQYLRVGKAVTPP 306



 Score = 43.6 bits (98), Expect = 6e-04
 Identities = 17/53 (32%), Positives = 34/53 (64%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPES 168
           +++VG + +E  +  +R  F  +G I+SI++  D  T + +GFAF+ ++ PE+
Sbjct: 130 RVYVGSIYYELGEDTIRQAFAPFGPIKSIDMSWDSVTMKHKGFAFVEYEVPEA 182



 Score = 43.6 bits (98), Expect = 6e-04
 Identities = 19/58 (32%), Positives = 36/58 (62%), Gaps = 1/58 (1%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVF-KAPESIDKV 180
           +++V  +  + +D +++  F A+G+I+S  +  DP TG+ +G+ FI + KA  S D V
Sbjct: 227 RIYVASVHQDLSDDDIKSVFEAFGKIKSCTLARDPTTGKHKGYGFIEYEKAQSSQDAV 284


>BC024208-1|AAH24208.1|  423|Homo sapiens RNA binding motif protein
           23 protein.
          Length = 423

 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 21/52 (40%), Positives = 33/52 (63%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPE 165
           +L+VG L +  T+  LR  F  +G+I++I +  D +TGRS+G+ FI F   E
Sbjct: 248 RLYVGSLHFNITEDMLRGIFEPFGKIDNIVLMKDSDTGRSKGYGFITFSDSE 299



 Score = 41.1 bits (92), Expect = 0.003
 Identities = 25/80 (31%), Positives = 39/80 (48%), Gaps = 1/80 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF-ESEQVVNDLLKTP 431
           +VG L   I++D +R  F  FG I  + +  D    + KG+ FITF +SE     L +  
Sbjct: 250 YVGSLHFNITEDMLRGIFEPFGKIDNIVLMKDSDTGRSKGYGFITFSDSECARRALEQLN 309

Query: 432 KRTIGGKEVDVKRATPKPDG 491
              + G+ + V   T + DG
Sbjct: 310 GFELAGRPMRVGHVTERLDG 329


>BC002566-1|AAH02566.1|  424|Homo sapiens RNA binding motif protein
           23 protein.
          Length = 424

 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 21/52 (40%), Positives = 33/52 (63%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPE 165
           +L+VG L +  T+  LR  F  +G+I++I +  D +TGRS+G+ FI F   E
Sbjct: 248 RLYVGSLHFNITEDMLRGIFEPFGKIDNIVLMKDSDTGRSKGYGFITFSDSE 299



 Score = 41.1 bits (92), Expect = 0.003
 Identities = 25/80 (31%), Positives = 39/80 (48%), Gaps = 1/80 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF-ESEQVVNDLLKTP 431
           +VG L   I++D +R  F  FG I  + +  D    + KG+ FITF +SE     L +  
Sbjct: 250 YVGSLHFNITEDMLRGIFEPFGKIDNIVLMKDSDTGRSKGYGFITFSDSECARRALEQLN 309

Query: 432 KRTIGGKEVDVKRATPKPDG 491
              + G+ + V   T + DG
Sbjct: 310 GFELAGRPMRVGHVTERLDG 329


>AK001344-1|BAA91638.1|  406|Homo sapiens protein ( Homo sapiens
           cDNA FLJ10482 fis, clone NT2RP2000153, weakly similar to
           GAR2 PROTEIN. ).
          Length = 406

 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 21/52 (40%), Positives = 33/52 (63%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPE 165
           +L+VG L +  T+  LR  F  +G+I++I +  D +TGRS+G+ FI F   E
Sbjct: 230 RLYVGSLHFNITEDMLRGIFEPFGKIDNIVLMKDSDTGRSKGYGFITFSDSE 281



 Score = 41.1 bits (92), Expect = 0.003
 Identities = 25/80 (31%), Positives = 39/80 (48%), Gaps = 1/80 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF-ESEQVVNDLLKTP 431
           +VG L   I++D +R  F  FG I  + +  D    + KG+ FITF +SE     L +  
Sbjct: 232 YVGSLHFNITEDMLRGIFEPFGKIDNIVLMKDSDTGRSKGYGFITFSDSECARRALEQLN 291

Query: 432 KRTIGGKEVDVKRATPKPDG 491
              + G+ + V   T + DG
Sbjct: 292 GFELAGRPMRVGHVTERLDG 311


>AF275678-1|AAG24388.1|  418|Homo sapiens PP239 protein protein.
          Length = 418

 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 21/52 (40%), Positives = 33/52 (63%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPE 165
           +L+VG L +  T+  LR  F  +G+I++I +  D +TGRS+G+ FI F   E
Sbjct: 242 RLYVGSLHFNITEDMLRGIFEPFGKIDNIVLMKDSDTGRSKGYGFITFSDSE 293



 Score = 41.1 bits (92), Expect = 0.003
 Identities = 25/80 (31%), Positives = 39/80 (48%), Gaps = 1/80 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF-ESEQVVNDLLKTP 431
           +VG L   I++D +R  F  FG I  + +  D    + KG+ FITF +SE     L +  
Sbjct: 244 YVGSLHFNITEDMLRGIFEPFGKIDNIVLMKDSDTGRSKGYGFITFSDSECARRALEQLN 303

Query: 432 KRTIGGKEVDVKRATPKPDG 491
              + G+ + V   T + DG
Sbjct: 304 GFELAGRPMRVGHVTERLDG 323


>AF087905-1|AAP97203.1|  425|Homo sapiens splicing factor SF2
           protein.
          Length = 425

 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 21/52 (40%), Positives = 33/52 (63%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPE 165
           +L+VG L +  T+  LR  F  +G+I++I +  D +TGRS+G+ FI F   E
Sbjct: 248 RLYVGSLHFNITEDMLRGIFEPFGKIDNIVLMKDSDTGRSKGYGFITFSDSE 299



 Score = 39.5 bits (88), Expect = 0.010
 Identities = 23/81 (28%), Positives = 38/81 (46%), Gaps = 2/81 (2%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           +VG L   I++D +R  F  FG I  + +  D    + KG+ FITF   +       T +
Sbjct: 250 YVGSLHFNITEDMLRGIFEPFGKIDNIVLMKDSDTGRSKGYGFITFSDSECARRACGTVE 309

Query: 435 --RTIGGKEVDVKRATPKPDG 491
              ++ G+ + V   T + DG
Sbjct: 310 WGLSLLGRPMRVGHVTERLDG 330


>L35013-1|AAA60300.1|  424|Homo sapiens spliceosomal protein
           protein.
          Length = 424

 Score = 46.4 bits (105), Expect = 9e-05
 Identities = 25/68 (36%), Positives = 41/68 (60%), Gaps = 3/68 (4%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEI-ESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           +F+G L  E  +K L D F A+G I ++  +  DP+TG S+G+AFI F + ++ D  + A
Sbjct: 102 IFIGNLDPEIDEKLLYDTFSAFGVILQTPKIMRDPDTGNSKGYAFINFASFDASDAAIEA 161

Query: 190 --GEHTIN 207
             G++  N
Sbjct: 162 MNGQYLCN 169



 Score = 43.2 bits (97), Expect = 8e-04
 Identities = 21/75 (28%), Positives = 40/75 (53%), Gaps = 1/75 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           +VGGL  ++S+  +   F + G ++   MP D+   Q +G+ F+ F SE+  +  +K   
Sbjct: 16  YVGGLDEKVSEPLLWELFLQAGPVVNTHMPKDRVTGQHQGYGFVEFLSEEDADYAIKIMN 75

Query: 435 R-TIGGKEVDVKRAT 476
              + GK + V +A+
Sbjct: 76  MIKLYGKPIRVNKAS 90



 Score = 34.7 bits (76), Expect = 0.28
 Identities = 18/49 (36%), Positives = 26/49 (53%), Gaps = 1/49 (2%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEV-EMPFDKTKNQRKGFCFITFES 398
           F+G L  EI +  + + FS FG IL+  ++  D      KG+ FI F S
Sbjct: 103 FIGNLDPEIDEKLLYDTFSAFGVILQTPKIMRDPDTGNSKGYAFINFAS 151



 Score = 32.3 bits (70), Expect = 1.5
 Identities = 22/83 (26%), Positives = 40/83 (48%), Gaps = 1/83 (1%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESID-KVMAA 189
           ++VGGL  + ++  L + F   G + + ++  D  TG+ +G+ F+ F + E  D  +   
Sbjct: 15  VYVGGLDEKVSEPLLWELFLQAGPVVNTHMPKDRVTGQHQGYGFVEFLSEEDADYAIKIM 74

Query: 190 GEHTINNKKVDPKKAKARHGKIL 258
               +  K +   KA A H K L
Sbjct: 75  NMIKLYGKPIRVNKASA-HNKNL 96


>DQ160195-1|AAZ93379.1|  314|Homo sapiens cyclophilin-33B protein.
          Length = 314

 Score = 46.4 bits (105), Expect = 9e-05
 Identities = 22/76 (28%), Positives = 39/76 (51%), Gaps = 1/76 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFE-SEQVVNDLLKTP 431
           +VGGL+ E+ D  +   F  FG I ++++P D    + +GF F+ FE +E     +    
Sbjct: 9   YVGGLAEEVDDKVLHAAFIPFGDITDIQIPLDYETEKHRGFAFVEFELAEDAAAAIDNMN 68

Query: 432 KRTIGGKEVDVKRATP 479
           +  + G+ + V  A P
Sbjct: 69  ESELFGRTIRVNLAKP 84



 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 22/51 (43%), Positives = 30/51 (58%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPE 165
           L+VGGL+ E  DK L   F  +G+I  I +  D  T + RGFAF+ F+  E
Sbjct: 8   LYVGGLAEEVDDKVLHAAFIPFGDITDIQIPLDYETEKHRGFAFVEFELAE 58


>BC107736-1|AAI07737.1|  301|Homo sapiens peptidylprolyl isomerase E
           (cyclophilin E) protein.
          Length = 301

 Score = 46.4 bits (105), Expect = 9e-05
 Identities = 22/76 (28%), Positives = 39/76 (51%), Gaps = 1/76 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFE-SEQVVNDLLKTP 431
           +VGGL+ E+ D  +   F  FG I ++++P D    + +GF F+ FE +E     +    
Sbjct: 9   YVGGLAEEVDDKVLHAAFIPFGDITDIQIPLDYETEKHRGFAFVEFELAEDAAAAIDNMN 68

Query: 432 KRTIGGKEVDVKRATP 479
           +  + G+ + V  A P
Sbjct: 69  ESELFGRTIRVNLAKP 84



 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 22/51 (43%), Positives = 30/51 (58%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPE 165
           L+VGGL+ E  DK L   F  +G+I  I +  D  T + RGFAF+ F+  E
Sbjct: 8   LYVGGLAEEVDDKVLHAAFIPFGDITDIQIPLDYETEKHRGFAFVEFELAE 58


>BC090883-1|AAH90883.1|  424|Homo sapiens splicing factor 3b,
           subunit 4, 49kDa protein.
          Length = 424

 Score = 46.4 bits (105), Expect = 9e-05
 Identities = 25/68 (36%), Positives = 41/68 (60%), Gaps = 3/68 (4%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEI-ESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           +F+G L  E  +K L D F A+G I ++  +  DP+TG S+G+AFI F + ++ D  + A
Sbjct: 102 IFIGNLDPEIDEKLLYDTFSAFGVILQTPKIMRDPDTGNSKGYAFINFASFDASDAAIEA 161

Query: 190 --GEHTIN 207
             G++  N
Sbjct: 162 MNGQYLCN 169



 Score = 43.2 bits (97), Expect = 8e-04
 Identities = 21/75 (28%), Positives = 40/75 (53%), Gaps = 1/75 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           +VGGL  ++S+  +   F + G ++   MP D+   Q +G+ F+ F SE+  +  +K   
Sbjct: 16  YVGGLDEKVSEPLLWELFLQAGPVVNTHMPKDRVTGQHQGYGFVEFLSEEDADYAIKIMN 75

Query: 435 R-TIGGKEVDVKRAT 476
              + GK + V +A+
Sbjct: 76  MIKLYGKPIRVNKAS 90



 Score = 34.7 bits (76), Expect = 0.28
 Identities = 18/49 (36%), Positives = 26/49 (53%), Gaps = 1/49 (2%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEV-EMPFDKTKNQRKGFCFITFES 398
           F+G L  EI +  + + FS FG IL+  ++  D      KG+ FI F S
Sbjct: 103 FIGNLDPEIDEKLLYDTFSAFGVILQTPKIMRDPDTGNSKGYAFINFAS 151



 Score = 32.3 bits (70), Expect = 1.5
 Identities = 22/83 (26%), Positives = 40/83 (48%), Gaps = 1/83 (1%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESID-KVMAA 189
           ++VGGL  + ++  L + F   G + + ++  D  TG+ +G+ F+ F + E  D  +   
Sbjct: 15  VYVGGLDEKVSEPLLWELFLQAGPVVNTHMPKDRVTGQHQGYGFVEFLSEEDADYAIKIM 74

Query: 190 GEHTINNKKVDPKKAKARHGKIL 258
               +  K +   KA A H K L
Sbjct: 75  NMIKLYGKPIRVNKASA-HNKNL 96


>BC013886-1|AAH13886.1|  424|Homo sapiens splicing factor 3b,
           subunit 4, 49kDa protein.
          Length = 424

 Score = 46.4 bits (105), Expect = 9e-05
 Identities = 25/68 (36%), Positives = 41/68 (60%), Gaps = 3/68 (4%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEI-ESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           +F+G L  E  +K L D F A+G I ++  +  DP+TG S+G+AFI F + ++ D  + A
Sbjct: 102 IFIGNLDPEIDEKLLYDTFSAFGVILQTPKIMRDPDTGNSKGYAFINFASFDASDAAIEA 161

Query: 190 --GEHTIN 207
             G++  N
Sbjct: 162 MNGQYLCN 169



 Score = 43.2 bits (97), Expect = 8e-04
 Identities = 21/75 (28%), Positives = 40/75 (53%), Gaps = 1/75 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           +VGGL  ++S+  +   F + G ++   MP D+   Q +G+ F+ F SE+  +  +K   
Sbjct: 16  YVGGLDEKVSEPLLWELFLQAGPVVNTHMPKDRVTGQHQGYGFVEFLSEEDADYAIKIMN 75

Query: 435 R-TIGGKEVDVKRAT 476
              + GK + V +A+
Sbjct: 76  MIKLYGKPIRVNKAS 90



 Score = 34.7 bits (76), Expect = 0.28
 Identities = 18/49 (36%), Positives = 26/49 (53%), Gaps = 1/49 (2%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEV-EMPFDKTKNQRKGFCFITFES 398
           F+G L  EI +  + + FS FG IL+  ++  D      KG+ FI F S
Sbjct: 103 FIGNLDPEIDEKLLYDTFSAFGVILQTPKIMRDPDTGNSKGYAFINFAS 151



 Score = 32.3 bits (70), Expect = 1.5
 Identities = 22/83 (26%), Positives = 40/83 (48%), Gaps = 1/83 (1%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESID-KVMAA 189
           ++VGGL  + ++  L + F   G + + ++  D  TG+ +G+ F+ F + E  D  +   
Sbjct: 15  VYVGGLDEKVSEPLLWELFLQAGPVVNTHMPKDRVTGQHQGYGFVEFLSEEDADYAIKIM 74

Query: 190 GEHTINNKKVDPKKAKARHGKIL 258
               +  K +   KA A H K L
Sbjct: 75  NMIKLYGKPIRVNKASA-HNKNL 96


>BC008451-1|AAH08451.1|  301|Homo sapiens peptidylprolyl isomerase E
           (cyclophilin E) protein.
          Length = 301

 Score = 46.4 bits (105), Expect = 9e-05
 Identities = 22/76 (28%), Positives = 39/76 (51%), Gaps = 1/76 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFE-SEQVVNDLLKTP 431
           +VGGL+ E+ D  +   F  FG I ++++P D    + +GF F+ FE +E     +    
Sbjct: 9   YVGGLAEEVDDKVLHAAFIPFGDITDIQIPLDYETEKHRGFAFVEFELAEDAAAAIDNMN 68

Query: 432 KRTIGGKEVDVKRATP 479
           +  + G+ + V  A P
Sbjct: 69  ESELFGRTIRVNLAKP 84



 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 22/51 (43%), Positives = 30/51 (58%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPE 165
           L+VGGL+ E  DK L   F  +G+I  I +  D  T + RGFAF+ F+  E
Sbjct: 8   LYVGGLAEEVDDKVLHAAFIPFGDITDIQIPLDYETEKHRGFAFVEFELAE 58


>BC004898-1|AAH04898.1|  301|Homo sapiens peptidylprolyl isomerase E
           (cyclophilin E) protein.
          Length = 301

 Score = 46.4 bits (105), Expect = 9e-05
 Identities = 22/76 (28%), Positives = 39/76 (51%), Gaps = 1/76 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFE-SEQVVNDLLKTP 431
           +VGGL+ E+ D  +   F  FG I ++++P D    + +GF F+ FE +E     +    
Sbjct: 9   YVGGLAEEVDDKVLHAAFIPFGDITDIQIPLDYETEKHRGFAFVEFELAEDAAAAIDNMN 68

Query: 432 KRTIGGKEVDVKRATP 479
           +  + G+ + V  A P
Sbjct: 69  ESELFGRTIRVNLAKP 84



 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 22/51 (43%), Positives = 30/51 (58%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPE 165
           L+VGGL+ E  DK L   F  +G+I  I +  D  T + RGFAF+ F+  E
Sbjct: 8   LYVGGLAEEVDDKVLHAAFIPFGDITDIQIPLDYETEKHRGFAFVEFELAE 58


>BC004273-1|AAH04273.1|  424|Homo sapiens splicing factor 3b,
           subunit 4, 49kDa protein.
          Length = 424

 Score = 46.4 bits (105), Expect = 9e-05
 Identities = 25/68 (36%), Positives = 41/68 (60%), Gaps = 3/68 (4%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEI-ESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           +F+G L  E  +K L D F A+G I ++  +  DP+TG S+G+AFI F + ++ D  + A
Sbjct: 102 IFIGNLDPEIDEKLLYDTFSAFGVILQTPKIMRDPDTGNSKGYAFINFASFDASDAAIEA 161

Query: 190 --GEHTIN 207
             G++  N
Sbjct: 162 MNGQYLCN 169



 Score = 43.2 bits (97), Expect = 8e-04
 Identities = 21/75 (28%), Positives = 40/75 (53%), Gaps = 1/75 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           +VGGL  ++S+  +   F + G ++   MP D+   Q +G+ F+ F SE+  +  +K   
Sbjct: 16  YVGGLDEKVSEPLLWELFLQAGPVVNTHMPKDRVTGQHQGYGFVEFLSEEDADYAIKIMN 75

Query: 435 R-TIGGKEVDVKRAT 476
              + GK + V +A+
Sbjct: 76  MIKLYGKPIRVNKAS 90



 Score = 34.7 bits (76), Expect = 0.28
 Identities = 18/49 (36%), Positives = 26/49 (53%), Gaps = 1/49 (2%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEV-EMPFDKTKNQRKGFCFITFES 398
           F+G L  EI +  + + FS FG IL+  ++  D      KG+ FI F S
Sbjct: 103 FIGNLDPEIDEKLLYDTFSAFGVILQTPKIMRDPDTGNSKGYAFINFAS 151



 Score = 32.3 bits (70), Expect = 1.5
 Identities = 22/83 (26%), Positives = 40/83 (48%), Gaps = 1/83 (1%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESID-KVMAA 189
           ++VGGL  + ++  L + F   G + + ++  D  TG+ +G+ F+ F + E  D  +   
Sbjct: 15  VYVGGLDEKVSEPLLWELFLQAGPVVNTHMPKDRVTGQHQGYGFVEFLSEEDADYAIKIM 74

Query: 190 GEHTINNKKVDPKKAKARHGKIL 258
               +  K +   KA A H K L
Sbjct: 75  NMIKLYGKPIRVNKASA-HNKNL 96


>AL591493-2|CAI12554.1|  424|Homo sapiens splicing factor 3b,
           subunit 4, 49kDa protein.
          Length = 424

 Score = 46.4 bits (105), Expect = 9e-05
 Identities = 25/68 (36%), Positives = 41/68 (60%), Gaps = 3/68 (4%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEI-ESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           +F+G L  E  +K L D F A+G I ++  +  DP+TG S+G+AFI F + ++ D  + A
Sbjct: 102 IFIGNLDPEIDEKLLYDTFSAFGVILQTPKIMRDPDTGNSKGYAFINFASFDASDAAIEA 161

Query: 190 --GEHTIN 207
             G++  N
Sbjct: 162 MNGQYLCN 169



 Score = 43.2 bits (97), Expect = 8e-04
 Identities = 21/75 (28%), Positives = 40/75 (53%), Gaps = 1/75 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           +VGGL  ++S+  +   F + G ++   MP D+   Q +G+ F+ F SE+  +  +K   
Sbjct: 16  YVGGLDEKVSEPLLWELFLQAGPVVNTHMPKDRVTGQHQGYGFVEFLSEEDADYAIKIMN 75

Query: 435 R-TIGGKEVDVKRAT 476
              + GK + V +A+
Sbjct: 76  MIKLYGKPIRVNKAS 90



 Score = 34.7 bits (76), Expect = 0.28
 Identities = 18/49 (36%), Positives = 26/49 (53%), Gaps = 1/49 (2%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEV-EMPFDKTKNQRKGFCFITFES 398
           F+G L  EI +  + + FS FG IL+  ++  D      KG+ FI F S
Sbjct: 103 FIGNLDPEIDEKLLYDTFSAFGVILQTPKIMRDPDTGNSKGYAFINFAS 151



 Score = 32.3 bits (70), Expect = 1.5
 Identities = 22/83 (26%), Positives = 40/83 (48%), Gaps = 1/83 (1%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESID-KVMAA 189
           ++VGGL  + ++  L + F   G + + ++  D  TG+ +G+ F+ F + E  D  +   
Sbjct: 15  VYVGGLDEKVSEPLLWELFLQAGPVVNTHMPKDRVTGQHQGYGFVEFLSEEDADYAIKIM 74

Query: 190 GEHTINNKKVDPKKAKARHGKIL 258
               +  K +   KA A H K L
Sbjct: 75  NMIKLYGKPIRVNKASA-HNKNL 96


>AL591493-1|CAI12553.1|  190|Homo sapiens splicing factor 3b,
           subunit 4, 49kDa protein.
          Length = 190

 Score = 46.4 bits (105), Expect = 9e-05
 Identities = 25/68 (36%), Positives = 41/68 (60%), Gaps = 3/68 (4%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEI-ESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           +F+G L  E  +K L D F A+G I ++  +  DP+TG S+G+AFI F + ++ D  + A
Sbjct: 59  IFIGNLDPEIDEKLLYDTFSAFGVILQTPKIMRDPDTGNSKGYAFINFASFDASDAAIEA 118

Query: 190 --GEHTIN 207
             G++  N
Sbjct: 119 MNGQYLCN 126



 Score = 34.7 bits (76), Expect = 0.28
 Identities = 18/49 (36%), Positives = 26/49 (53%), Gaps = 1/49 (2%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEV-EMPFDKTKNQRKGFCFITFES 398
           F+G L  EI +  + + FS FG IL+  ++  D      KG+ FI F S
Sbjct: 60  FIGNLDPEIDEKLLYDTFSAFGVILQTPKIMRDPDTGNSKGYAFINFAS 108


>AL590487-2|CAI12648.1|  424|Homo sapiens splicing factor 3b,
           subunit 4, 49kDa protein.
          Length = 424

 Score = 46.4 bits (105), Expect = 9e-05
 Identities = 25/68 (36%), Positives = 41/68 (60%), Gaps = 3/68 (4%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEI-ESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           +F+G L  E  +K L D F A+G I ++  +  DP+TG S+G+AFI F + ++ D  + A
Sbjct: 102 IFIGNLDPEIDEKLLYDTFSAFGVILQTPKIMRDPDTGNSKGYAFINFASFDASDAAIEA 161

Query: 190 --GEHTIN 207
             G++  N
Sbjct: 162 MNGQYLCN 169



 Score = 43.2 bits (97), Expect = 8e-04
 Identities = 21/75 (28%), Positives = 40/75 (53%), Gaps = 1/75 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           +VGGL  ++S+  +   F + G ++   MP D+   Q +G+ F+ F SE+  +  +K   
Sbjct: 16  YVGGLDEKVSEPLLWELFLQAGPVVNTHMPKDRVTGQHQGYGFVEFLSEEDADYAIKIMN 75

Query: 435 R-TIGGKEVDVKRAT 476
              + GK + V +A+
Sbjct: 76  MIKLYGKPIRVNKAS 90



 Score = 34.7 bits (76), Expect = 0.28
 Identities = 18/49 (36%), Positives = 26/49 (53%), Gaps = 1/49 (2%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEV-EMPFDKTKNQRKGFCFITFES 398
           F+G L  EI +  + + FS FG IL+  ++  D      KG+ FI F S
Sbjct: 103 FIGNLDPEIDEKLLYDTFSAFGVILQTPKIMRDPDTGNSKGYAFINFAS 151



 Score = 32.3 bits (70), Expect = 1.5
 Identities = 22/83 (26%), Positives = 40/83 (48%), Gaps = 1/83 (1%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESID-KVMAA 189
           ++VGGL  + ++  L + F   G + + ++  D  TG+ +G+ F+ F + E  D  +   
Sbjct: 15  VYVGGLDEKVSEPLLWELFLQAGPVVNTHMPKDRVTGQHQGYGFVEFLSEEDADYAIKIM 74

Query: 190 GEHTINNKKVDPKKAKARHGKIL 258
               +  K +   KA A H K L
Sbjct: 75  NMIKLYGKPIRVNKASA-HNKNL 96


>AL590487-1|CAI12647.1|  190|Homo sapiens splicing factor 3b,
           subunit 4, 49kDa protein.
          Length = 190

 Score = 46.4 bits (105), Expect = 9e-05
 Identities = 25/68 (36%), Positives = 41/68 (60%), Gaps = 3/68 (4%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEI-ESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           +F+G L  E  +K L D F A+G I ++  +  DP+TG S+G+AFI F + ++ D  + A
Sbjct: 59  IFIGNLDPEIDEKLLYDTFSAFGVILQTPKIMRDPDTGNSKGYAFINFASFDASDAAIEA 118

Query: 190 --GEHTIN 207
             G++  N
Sbjct: 119 MNGQYLCN 126



 Score = 34.7 bits (76), Expect = 0.28
 Identities = 18/49 (36%), Positives = 26/49 (53%), Gaps = 1/49 (2%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEV-EMPFDKTKNQRKGFCFITFES 398
           F+G L  EI +  + + FS FG IL+  ++  D      KG+ FI F S
Sbjct: 60  FIGNLDPEIDEKLLYDTFSAFGVILQTPKIMRDPDTGNSKGYAFINFAS 108


>AL049824-4|CAI19350.1|  301|Homo sapiens peptidylprolyl isomerase E
           (cyclophilin E) protein.
          Length = 301

 Score = 46.4 bits (105), Expect = 9e-05
 Identities = 22/76 (28%), Positives = 39/76 (51%), Gaps = 1/76 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFE-SEQVVNDLLKTP 431
           +VGGL+ E+ D  +   F  FG I ++++P D    + +GF F+ FE +E     +    
Sbjct: 9   YVGGLAEEVDDKVLHAAFIPFGDITDIQIPLDYETEKHRGFAFVEFELAEDAAAAIDNMN 68

Query: 432 KRTIGGKEVDVKRATP 479
           +  + G+ + V  A P
Sbjct: 69  ESELFGRTIRVNLAKP 84



 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 22/51 (43%), Positives = 30/51 (58%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPE 165
           L+VGGL+ E  DK L   F  +G+I  I +  D  T + RGFAF+ F+  E
Sbjct: 8   LYVGGLAEEVDDKVLHAAFIPFGDITDIQIPLDYETEKHRGFAFVEFELAE 58


>AL049824-2|CAI19348.1|  296|Homo sapiens peptidylprolyl isomerase E
           (cyclophilin E) protein.
          Length = 296

 Score = 46.4 bits (105), Expect = 9e-05
 Identities = 22/76 (28%), Positives = 39/76 (51%), Gaps = 1/76 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFE-SEQVVNDLLKTP 431
           +VGGL+ E+ D  +   F  FG I ++++P D    + +GF F+ FE +E     +    
Sbjct: 9   YVGGLAEEVDDKVLHAAFIPFGDITDIQIPLDYETEKHRGFAFVEFELAEDAAAAIDNMN 68

Query: 432 KRTIGGKEVDVKRATP 479
           +  + G+ + V  A P
Sbjct: 69  ESELFGRTIRVNLAKP 84



 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 22/51 (43%), Positives = 30/51 (58%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPE 165
           L+VGGL+ E  DK L   F  +G+I  I +  D  T + RGFAF+ F+  E
Sbjct: 8   LYVGGLAEEVDDKVLHAAFIPFGDITDIQIPLDYETEKHRGFAFVEFELAE 58


>AL049824-1|CAI19347.1|  314|Homo sapiens peptidylprolyl isomerase E
           (cyclophilin E) protein.
          Length = 314

 Score = 46.4 bits (105), Expect = 9e-05
 Identities = 22/76 (28%), Positives = 39/76 (51%), Gaps = 1/76 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFE-SEQVVNDLLKTP 431
           +VGGL+ E+ D  +   F  FG I ++++P D    + +GF F+ FE +E     +    
Sbjct: 9   YVGGLAEEVDDKVLHAAFIPFGDITDIQIPLDYETEKHRGFAFVEFELAEDAAAAIDNMN 68

Query: 432 KRTIGGKEVDVKRATP 479
           +  + G+ + V  A P
Sbjct: 69  ESELFGRTIRVNLAKP 84



 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 22/51 (43%), Positives = 30/51 (58%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPE 165
           L+VGGL+ E  DK L   F  +G+I  I +  D  T + RGFAF+ F+  E
Sbjct: 8   LYVGGLAEEVDDKVLHAAFIPFGDITDIQIPLDYETEKHRGFAFVEFELAE 58


>AL035404-8|CAI19579.1|  301|Homo sapiens peptidylprolyl isomerase E
           (cyclophilin E) protein.
          Length = 301

 Score = 46.4 bits (105), Expect = 9e-05
 Identities = 22/76 (28%), Positives = 39/76 (51%), Gaps = 1/76 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFE-SEQVVNDLLKTP 431
           +VGGL+ E+ D  +   F  FG I ++++P D    + +GF F+ FE +E     +    
Sbjct: 9   YVGGLAEEVDDKVLHAAFIPFGDITDIQIPLDYETEKHRGFAFVEFELAEDAAAAIDNMN 68

Query: 432 KRTIGGKEVDVKRATP 479
           +  + G+ + V  A P
Sbjct: 69  ESELFGRTIRVNLAKP 84



 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 22/51 (43%), Positives = 30/51 (58%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPE 165
           L+VGGL+ E  DK L   F  +G+I  I +  D  T + RGFAF+ F+  E
Sbjct: 8   LYVGGLAEEVDDKVLHAAFIPFGDITDIQIPLDYETEKHRGFAFVEFELAE 58


>AL035404-6|CAI19577.1|  296|Homo sapiens peptidylprolyl isomerase E
           (cyclophilin E) protein.
          Length = 296

 Score = 46.4 bits (105), Expect = 9e-05
 Identities = 22/76 (28%), Positives = 39/76 (51%), Gaps = 1/76 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFE-SEQVVNDLLKTP 431
           +VGGL+ E+ D  +   F  FG I ++++P D    + +GF F+ FE +E     +    
Sbjct: 9   YVGGLAEEVDDKVLHAAFIPFGDITDIQIPLDYETEKHRGFAFVEFELAEDAAAAIDNMN 68

Query: 432 KRTIGGKEVDVKRATP 479
           +  + G+ + V  A P
Sbjct: 69  ESELFGRTIRVNLAKP 84



 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 22/51 (43%), Positives = 30/51 (58%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPE 165
           L+VGGL+ E  DK L   F  +G+I  I +  D  T + RGFAF+ F+  E
Sbjct: 8   LYVGGLAEEVDDKVLHAAFIPFGDITDIQIPLDYETEKHRGFAFVEFELAE 58


>AL035404-5|CAI19576.1|  314|Homo sapiens peptidylprolyl isomerase E
           (cyclophilin E) protein.
          Length = 314

 Score = 46.4 bits (105), Expect = 9e-05
 Identities = 22/76 (28%), Positives = 39/76 (51%), Gaps = 1/76 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFE-SEQVVNDLLKTP 431
           +VGGL+ E+ D  +   F  FG I ++++P D    + +GF F+ FE +E     +    
Sbjct: 9   YVGGLAEEVDDKVLHAAFIPFGDITDIQIPLDYETEKHRGFAFVEFELAEDAAAAIDNMN 68

Query: 432 KRTIGGKEVDVKRATP 479
           +  + G+ + V  A P
Sbjct: 69  ESELFGRTIRVNLAKP 84



 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 22/51 (43%), Positives = 30/51 (58%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPE 165
           L+VGGL+ E  DK L   F  +G+I  I +  D  T + RGFAF+ F+  E
Sbjct: 8   LYVGGLAEEVDDKVLHAAFIPFGDITDIQIPLDYETEKHRGFAFVEFELAE 58


>AL033527-11|CAI19410.1|  296|Homo sapiens peptidylprolyl isomerase
           E (cyclophilin E) protein.
          Length = 296

 Score = 46.4 bits (105), Expect = 9e-05
 Identities = 22/76 (28%), Positives = 39/76 (51%), Gaps = 1/76 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFE-SEQVVNDLLKTP 431
           +VGGL+ E+ D  +   F  FG I ++++P D    + +GF F+ FE +E     +    
Sbjct: 9   YVGGLAEEVDDKVLHAAFIPFGDITDIQIPLDYETEKHRGFAFVEFELAEDAAAAIDNMN 68

Query: 432 KRTIGGKEVDVKRATP 479
           +  + G+ + V  A P
Sbjct: 69  ESELFGRTIRVNLAKP 84



 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 22/51 (43%), Positives = 30/51 (58%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPE 165
           L+VGGL+ E  DK L   F  +G+I  I +  D  T + RGFAF+ F+  E
Sbjct: 8   LYVGGLAEEVDDKVLHAAFIPFGDITDIQIPLDYETEKHRGFAFVEFELAE 58


>AL033527-10|CAI19409.1|  314|Homo sapiens peptidylprolyl isomerase
           E (cyclophilin E) protein.
          Length = 314

 Score = 46.4 bits (105), Expect = 9e-05
 Identities = 22/76 (28%), Positives = 39/76 (51%), Gaps = 1/76 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFE-SEQVVNDLLKTP 431
           +VGGL+ E+ D  +   F  FG I ++++P D    + +GF F+ FE +E     +    
Sbjct: 9   YVGGLAEEVDDKVLHAAFIPFGDITDIQIPLDYETEKHRGFAFVEFELAEDAAAAIDNMN 68

Query: 432 KRTIGGKEVDVKRATP 479
           +  + G+ + V  A P
Sbjct: 69  ESELFGRTIRVNLAKP 84



 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 22/51 (43%), Positives = 30/51 (58%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPE 165
           L+VGGL+ E  DK L   F  +G+I  I +  D  T + RGFAF+ F+  E
Sbjct: 8   LYVGGLAEEVDDKVLHAAFIPFGDITDIQIPLDYETEKHRGFAFVEFELAE 58


>AK223322-1|BAD97042.1|  424|Homo sapiens splicing factor 3b,
           subunit 4 variant protein.
          Length = 424

 Score = 46.4 bits (105), Expect = 9e-05
 Identities = 25/68 (36%), Positives = 41/68 (60%), Gaps = 3/68 (4%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEI-ESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           +F+G L  E  +K L D F A+G I ++  +  DP+TG S+G+AFI F + ++ D  + A
Sbjct: 102 IFIGNLDPEIDEKLLYDTFSAFGVILQTPKIMRDPDTGNSKGYAFINFASFDASDAAIEA 161

Query: 190 --GEHTIN 207
             G++  N
Sbjct: 162 MNGQYLCN 169



 Score = 42.7 bits (96), Expect = 0.001
 Identities = 21/75 (28%), Positives = 40/75 (53%), Gaps = 1/75 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           +VGGL  ++S+  +   F + G ++   MP D+   Q +G+ F+ F SE+  +  +K   
Sbjct: 16  YVGGLDEKVSEPLLWELFLQAGPVVNTHMPKDRVTGQHQGYGFVEFLSEEDADYAIKIMD 75

Query: 435 R-TIGGKEVDVKRAT 476
              + GK + V +A+
Sbjct: 76  MIKLYGKPIRVNKAS 90



 Score = 34.7 bits (76), Expect = 0.28
 Identities = 18/49 (36%), Positives = 26/49 (53%), Gaps = 1/49 (2%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEV-EMPFDKTKNQRKGFCFITFES 398
           F+G L  EI +  + + FS FG IL+  ++  D      KG+ FI F S
Sbjct: 103 FIGNLDPEIDEKLLYDTFSAFGVILQTPKIMRDPDTGNSKGYAFINFAS 151



 Score = 32.3 bits (70), Expect = 1.5
 Identities = 22/83 (26%), Positives = 41/83 (49%), Gaps = 1/83 (1%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           ++VGGL  + ++  L + F   G + + ++  D  TG+ +G+ F+ F + E  D  +   
Sbjct: 15  VYVGGLDEKVSEPLLWELFLQAGPVVNTHMPKDRVTGQHQGYGFVEFLSEEDADYAIKIM 74

Query: 193 EH-TINNKKVDPKKAKARHGKIL 258
           +   +  K +   KA A H K L
Sbjct: 75  DMIKLYGKPIRVNKASA-HNKNL 96


>AF104013-1|AAD19907.1|  296|Homo sapiens peptidyl-prolyl cis-trans
           isomerase E protein.
          Length = 296

 Score = 46.4 bits (105), Expect = 9e-05
 Identities = 22/76 (28%), Positives = 39/76 (51%), Gaps = 1/76 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFE-SEQVVNDLLKTP 431
           +VGGL+ E+ D  +   F  FG I ++++P D    + +GF F+ FE +E     +    
Sbjct: 9   YVGGLAEEVDDKVLHAAFIPFGDITDIQIPLDYETEKHRGFAFVEFELAEDAAAAIDNMN 68

Query: 432 KRTIGGKEVDVKRATP 479
           +  + G+ + V  A P
Sbjct: 69  ESELFGRTIRVNLAKP 84



 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 22/51 (43%), Positives = 30/51 (58%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPE 165
           L+VGGL+ E  DK L   F  +G+I  I +  D  T + RGFAF+ F+  E
Sbjct: 8   LYVGGLAEEVDDKVLHAAFIPFGDITDIQIPLDYETEKHRGFAFVEFELAE 58


>AF104012-1|AAD19906.1|  301|Homo sapiens peptidyl-prolyl cis-trans
           isomerase E protein.
          Length = 301

 Score = 46.4 bits (105), Expect = 9e-05
 Identities = 22/76 (28%), Positives = 39/76 (51%), Gaps = 1/76 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFE-SEQVVNDLLKTP 431
           +VGGL+ E+ D  +   F  FG I ++++P D    + +GF F+ FE +E     +    
Sbjct: 9   YVGGLAEEVDDKVLHAAFIPFGDITDIQIPLDYETEKHRGFAFVEFELAEDAAAAIDNMN 68

Query: 432 KRTIGGKEVDVKRATP 479
           +  + G+ + V  A P
Sbjct: 69  ESELFGRTIRVNLAKP 84



 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 22/51 (43%), Positives = 30/51 (58%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPE 165
           L+VGGL+ E  DK L   F  +G+I  I +  D  T + RGFAF+ F+  E
Sbjct: 8   LYVGGLAEEVDDKVLHAAFIPFGDITDIQIPLDYETEKHRGFAFVEFELAE 58


>AF042386-1|AAC00007.1|  296|Homo sapiens cyclophilin-33B protein.
          Length = 296

 Score = 46.4 bits (105), Expect = 9e-05
 Identities = 22/76 (28%), Positives = 39/76 (51%), Gaps = 1/76 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFE-SEQVVNDLLKTP 431
           +VGGL+ E+ D  +   F  FG I ++++P D    + +GF F+ FE +E     +    
Sbjct: 9   YVGGLAEEVDDKVLHAAFIPFGDITDIQIPLDYETEKHRGFAFVEFELAEDAAAAIDNMN 68

Query: 432 KRTIGGKEVDVKRATP 479
           +  + G+ + V  A P
Sbjct: 69  ESELFGRTIRVNLAKP 84



 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 22/51 (43%), Positives = 30/51 (58%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPE 165
           L+VGGL+ E  DK L   F  +G+I  I +  D  T + RGFAF+ F+  E
Sbjct: 8   LYVGGLAEEVDDKVLHAAFIPFGDITDIQIPLDYETEKHRGFAFVEFELAE 58


>AF042385-1|AAC00006.1|  301|Homo sapiens cyclophilin-33A protein.
          Length = 301

 Score = 46.4 bits (105), Expect = 9e-05
 Identities = 22/76 (28%), Positives = 39/76 (51%), Gaps = 1/76 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFE-SEQVVNDLLKTP 431
           +VGGL+ E+ D  +   F  FG I ++++P D    + +GF F+ FE +E     +    
Sbjct: 9   YVGGLAEEVDDKVLHAAFIPFGDITDIQIPLDYETEKHRGFAFVEFELAEDAAAAIDNMN 68

Query: 432 KRTIGGKEVDVKRATP 479
           +  + G+ + V  A P
Sbjct: 69  ESELFGRTIRVNLAKP 84



 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 22/51 (43%), Positives = 30/51 (58%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPE 165
           L+VGGL+ E  DK L   F  +G+I  I +  D  T + RGFAF+ F+  E
Sbjct: 8   LYVGGLAEEVDDKVLHAAFIPFGDITDIQIPLDYETEKHRGFAFVEFELAE 58


>U29943-1|AAA70417.1|  346|Homo sapiens Hel-N2 protein.
          Length = 346

 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 25/80 (31%), Positives = 42/80 (52%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           L V  L    T +EL+  FG+ GEIES  +  D  TG+S G+ F+ +  P+  +K +   
Sbjct: 41  LIVNYLPQNMTQEELKSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAI--- 97

Query: 193 EHTINNKKVDPKKAKARHGK 252
            +T+N  ++  K  K  + +
Sbjct: 98  -NTLNGLRLQTKTIKVSYAR 116



 Score = 40.7 bits (91), Expect = 0.004
 Identities = 28/99 (28%), Positives = 40/99 (40%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           R   L+V GL    T KEL   F  YG I +  +  D  TG SRG  FI F      ++ 
Sbjct: 123 RDANLYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGISRGVGFIRFDKRIEAEEA 182

Query: 181 MAAGEHTINNKKVDPKKAKARHGKILSEDSAVKSQMMKS 297
           +            +P   K  +      + A+ SQ+ +S
Sbjct: 183 IKGLNGQKPPGATEPITVKFANNPSQKTNQAILSQLYQS 221



 Score = 32.7 bits (71), Expect = 1.1
 Identities = 14/45 (31%), Positives = 25/45 (55%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFI 147
           +FV  L+ +  +  L   FG +G + ++ V  D NT + +GF F+
Sbjct: 265 IFVYNLAPDADESILWQMFGPFGAVTNVKVIRDFNTNKCKGFGFV 309



 Score = 32.3 bits (70), Expect = 1.5
 Identities = 16/50 (32%), Positives = 25/50 (50%)
 Frame = +3

Query: 240 TTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFIT 389
           T W  FV  L+ +  +  +   F  FG +  V++  D   N+ KGF F+T
Sbjct: 261 TGWCIFVYNLAPDADESILWQMFGPFGAVTNVKVIRDFNTNKCKGFGFVT 310


>U12431-1|AAA69698.1|  359|Homo sapiens ELAV-like neuronal protein 1
           protein.
          Length = 359

 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 25/80 (31%), Positives = 42/80 (52%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           L V  L    T +EL+  FG+ GEIES  +  D  TG+S G+ F+ +  P+  +K +   
Sbjct: 41  LIVNYLPQNMTQEELKSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAI--- 97

Query: 193 EHTINNKKVDPKKAKARHGK 252
            +T+N  ++  K  K  + +
Sbjct: 98  -NTLNGLRLQTKTIKVSYAR 116



 Score = 40.7 bits (91), Expect = 0.004
 Identities = 28/99 (28%), Positives = 40/99 (40%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           R   L+V GL    T KEL   F  YG I +  +  D  TG SRG  FI F      ++ 
Sbjct: 123 RDANLYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGISRGVGFIRFDKRIEAEEA 182

Query: 181 MAAGEHTINNKKVDPKKAKARHGKILSEDSAVKSQMMKS 297
           +            +P   K  +      + A+ SQ+ +S
Sbjct: 183 IKGLNGQKPPGATEPITVKFANNPSQKTNQAILSQLYQS 221



 Score = 32.7 bits (71), Expect = 1.1
 Identities = 14/45 (31%), Positives = 25/45 (55%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFI 147
           +FV  L+ +  +  L   FG +G + ++ V  D NT + +GF F+
Sbjct: 278 IFVYNLAPDADESILWQMFGPFGAVTNVKVIRDFNTNKCKGFGFV 322



 Score = 32.3 bits (70), Expect = 1.5
 Identities = 16/50 (32%), Positives = 25/50 (50%)
 Frame = +3

Query: 240 TTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFIT 389
           T W  FV  L+ +  +  +   F  FG +  V++  D   N+ KGF F+T
Sbjct: 274 TGWCIFVYNLAPDADESILWQMFGPFGAVTNVKVIRDFNTNKCKGFGFVT 323


>D26158-1|BAA21838.1|  350|Homo sapiens PLE21 protein protein.
          Length = 350

 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 25/80 (31%), Positives = 39/80 (48%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           L V  L    T  E +  FG+ G+IES  +  D  TG+S G+ F+ +  P   DK +   
Sbjct: 32  LIVNYLPQNMTQDEFKSLFGSIGDIESCKLVRDKITGQSLGYGFVNYSDPNDADKAI--- 88

Query: 193 EHTINNKKVDPKKAKARHGK 252
            +T+N  K+  K  K  + +
Sbjct: 89  -NTLNGLKLQTKTIKVSYAR 107



 Score = 37.9 bits (84), Expect = 0.030
 Identities = 20/51 (39%), Positives = 25/51 (49%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVF 153
           R   L+V GL    + KE+   F  YG I +  +  D  TG SRG  FI F
Sbjct: 114 RDANLYVSGLPKTMSQKEMEQLFSQYGRIITSRILVDQVTGVSRGVGFIRF 164



 Score = 33.5 bits (73), Expect = 0.64
 Identities = 18/48 (37%), Positives = 24/48 (50%)
 Frame = +3

Query: 246 WEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFIT 389
           W  FV  LS E     +   F  FG +  V++  D T N+ KGF F+T
Sbjct: 267 WCIFVYNLSPEPDQSVLWQLFGPFGAVTNVKVIRDFTTNKCKGFGFMT 314



 Score = 30.7 bits (66), Expect = 4.5
 Identities = 15/45 (33%), Positives = 23/45 (51%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFI 147
           +FV  LS E     L   FG +G + ++ V  D  T + +GF F+
Sbjct: 269 IFVYNLSPEPDQSVLWQLFGPFGAVTNVKVIRDFTTNKCKGFGFM 313


>BC030692-1|AAH30692.1|  346|Homo sapiens ELAVL2 protein protein.
          Length = 346

 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 25/80 (31%), Positives = 42/80 (52%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           L V  L    T +EL+  FG+ GEIES  +  D  TG+S G+ F+ +  P+  +K +   
Sbjct: 41  LIVNYLPQNMTQEELKSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAI--- 97

Query: 193 EHTINNKKVDPKKAKARHGK 252
            +T+N  ++  K  K  + +
Sbjct: 98  -NTLNGLRLQTKTIKVSYAR 116



 Score = 40.7 bits (91), Expect = 0.004
 Identities = 28/99 (28%), Positives = 40/99 (40%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           R   L+V GL    T KEL   F  YG I +  +  D  TG SRG  FI F      ++ 
Sbjct: 123 RDANLYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGISRGVGFIRFDKRIEAEEA 182

Query: 181 MAAGEHTINNKKVDPKKAKARHGKILSEDSAVKSQMMKS 297
           +            +P   K  +      + A+ SQ+ +S
Sbjct: 183 IKGLNGQKPPGATEPITVKFANNPSQKTNQAILSQLYQS 221



 Score = 32.7 bits (71), Expect = 1.1
 Identities = 14/45 (31%), Positives = 25/45 (55%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFI 147
           +FV  L+ +  +  L   FG +G + ++ V  D NT + +GF F+
Sbjct: 265 IFVYNLAPDADESILWQMFGPFGAVTNVKVIRDFNTNKCKGFGFV 309



 Score = 32.3 bits (70), Expect = 1.5
 Identities = 16/50 (32%), Positives = 25/50 (50%)
 Frame = +3

Query: 240 TTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFIT 389
           T W  FV  L+ +  +  +   F  FG +  V++  D   N+ KGF F+T
Sbjct: 261 TGWCIFVYNLAPDADESILWQMFGPFGAVTNVKVIRDFNTNKCKGFGFVT 310


>BC014144-1|AAH14144.1|  367|Homo sapiens ELAVL3 protein protein.
          Length = 367

 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 25/80 (31%), Positives = 39/80 (48%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           L V  L    T  E +  FG+ G+IES  +  D  TG+S G+ F+ +  P   DK +   
Sbjct: 41  LIVNYLPQNMTQDEFKSLFGSIGDIESCKLVRDKITGQSLGYGFVNYSDPNDADKAI--- 97

Query: 193 EHTINNKKVDPKKAKARHGK 252
            +T+N  K+  K  K  + +
Sbjct: 98  -NTLNGLKLQTKTIKVSYAR 116



 Score = 37.9 bits (84), Expect = 0.030
 Identities = 20/51 (39%), Positives = 25/51 (49%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVF 153
           R   L+V GL    + KE+   F  YG I +  +  D  TG SRG  FI F
Sbjct: 123 RDANLYVSGLPKTMSQKEMEQLFSQYGRIITSRILVDQVTGVSRGVGFIRF 173



 Score = 35.9 bits (79), Expect = 0.12
 Identities = 18/48 (37%), Positives = 25/48 (52%)
 Frame = +3

Query: 246 WEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFIT 389
           W  FV  LS E  +  +   F  FG +  V++  D T N+ KGF F+T
Sbjct: 284 WCIFVYNLSPEADESVLWQLFGPFGAVTNVKVIRDFTTNKCKGFGFVT 331



 Score = 32.7 bits (71), Expect = 1.1
 Identities = 15/45 (33%), Positives = 24/45 (53%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFI 147
           +FV  LS E  +  L   FG +G + ++ V  D  T + +GF F+
Sbjct: 286 IFVYNLSPEADESVLWQLFGPFGAVTNVKVIRDFTTNKCKGFGFV 330


>AL161628-4|CAI13378.1|  387|Homo sapiens ELAV (embryonic lethal,
           abnormal vision, Drosophila)-like 2 (Hu antigen B)
           protein.
          Length = 387

 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 25/80 (31%), Positives = 42/80 (52%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           L V  L    T +EL+  FG+ GEIES  +  D  TG+S G+ F+ +  P+  +K +   
Sbjct: 69  LIVNYLPQNMTQEELKSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAI--- 125

Query: 193 EHTINNKKVDPKKAKARHGK 252
            +T+N  ++  K  K  + +
Sbjct: 126 -NTLNGLRLQTKTIKVSYAR 144



 Score = 40.7 bits (91), Expect = 0.004
 Identities = 28/99 (28%), Positives = 40/99 (40%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           R   L+V GL    T KEL   F  YG I +  +  D  TG SRG  FI F      ++ 
Sbjct: 151 RDANLYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGISRGVGFIRFDKRIEAEEA 210

Query: 181 MAAGEHTINNKKVDPKKAKARHGKILSEDSAVKSQMMKS 297
           +            +P   K  +      + A+ SQ+ +S
Sbjct: 211 IKGLNGQKPPGATEPITVKFANNPSQKTNQAILSQLYQS 249



 Score = 32.7 bits (71), Expect = 1.1
 Identities = 14/45 (31%), Positives = 25/45 (55%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFI 147
           +FV  L+ +  +  L   FG +G + ++ V  D NT + +GF F+
Sbjct: 306 IFVYNLAPDADESILWQMFGPFGAVTNVKVIRDFNTNKCKGFGFV 350



 Score = 32.3 bits (70), Expect = 1.5
 Identities = 16/50 (32%), Positives = 25/50 (50%)
 Frame = +3

Query: 240 TTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFIT 389
           T W  FV  L+ +  +  +   F  FG +  V++  D   N+ KGF F+T
Sbjct: 302 TGWCIFVYNLAPDADESILWQMFGPFGAVTNVKVIRDFNTNKCKGFGFVT 351


>AL161628-3|CAI13377.1|  189|Homo sapiens ELAV (embryonic lethal,
           abnormal vision, Drosophila)-like 2 (Hu antigen B)
           protein.
          Length = 189

 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 25/80 (31%), Positives = 42/80 (52%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           L V  L    T +EL+  FG+ GEIES  +  D  TG+S G+ F+ +  P+  +K +   
Sbjct: 41  LIVNYLPQNMTQEELKSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAI--- 97

Query: 193 EHTINNKKVDPKKAKARHGK 252
            +T+N  ++  K  K  + +
Sbjct: 98  -NTLNGLRLQTKTIKVSYAR 116



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 22/51 (43%), Positives = 25/51 (49%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVF 153
           R   L+V GL    T KEL   F  YG I +  +  D  TG SRG  FI F
Sbjct: 123 RDANLYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGISRGVGFIRF 173


>AL161628-2|CAC22160.1|  359|Homo sapiens ELAV (embryonic lethal,
           abnormal vision, Drosophila)-like 2 (Hu antigen B)
           protein.
          Length = 359

 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 25/80 (31%), Positives = 42/80 (52%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           L V  L    T +EL+  FG+ GEIES  +  D  TG+S G+ F+ +  P+  +K +   
Sbjct: 41  LIVNYLPQNMTQEELKSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAI--- 97

Query: 193 EHTINNKKVDPKKAKARHGK 252
            +T+N  ++  K  K  + +
Sbjct: 98  -NTLNGLRLQTKTIKVSYAR 116



 Score = 40.7 bits (91), Expect = 0.004
 Identities = 28/99 (28%), Positives = 40/99 (40%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           R   L+V GL    T KEL   F  YG I +  +  D  TG SRG  FI F      ++ 
Sbjct: 123 RDANLYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGISRGVGFIRFDKRIEAEEA 182

Query: 181 MAAGEHTINNKKVDPKKAKARHGKILSEDSAVKSQMMKS 297
           +            +P   K  +      + A+ SQ+ +S
Sbjct: 183 IKGLNGQKPPGATEPITVKFANNPSQKTNQAILSQLYQS 221



 Score = 32.7 bits (71), Expect = 1.1
 Identities = 14/45 (31%), Positives = 25/45 (55%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFI 147
           +FV  L+ +  +  L   FG +G + ++ V  D NT + +GF F+
Sbjct: 278 IFVYNLAPDADESILWQMFGPFGAVTNVKVIRDFNTNKCKGFGFV 322



 Score = 32.3 bits (70), Expect = 1.5
 Identities = 16/50 (32%), Positives = 25/50 (50%)
 Frame = +3

Query: 240 TTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFIT 389
           T W  FV  L+ +  +  +   F  FG +  V++  D   N+ KGF F+T
Sbjct: 274 TGWCIFVYNLAPDADESILWQMFGPFGAVTNVKVIRDFNTNKCKGFGFVT 323


>AL161628-1|CAI13376.1|  346|Homo sapiens ELAV (embryonic lethal,
           abnormal vision, Drosophila)-like 2 (Hu antigen B)
           protein.
          Length = 346

 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 25/80 (31%), Positives = 42/80 (52%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           L V  L    T +EL+  FG+ GEIES  +  D  TG+S G+ F+ +  P+  +K +   
Sbjct: 41  LIVNYLPQNMTQEELKSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAI--- 97

Query: 193 EHTINNKKVDPKKAKARHGK 252
            +T+N  ++  K  K  + +
Sbjct: 98  -NTLNGLRLQTKTIKVSYAR 116



 Score = 40.7 bits (91), Expect = 0.004
 Identities = 28/99 (28%), Positives = 40/99 (40%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           R   L+V GL    T KEL   F  YG I +  +  D  TG SRG  FI F      ++ 
Sbjct: 123 RDANLYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGISRGVGFIRFDKRIEAEEA 182

Query: 181 MAAGEHTINNKKVDPKKAKARHGKILSEDSAVKSQMMKS 297
           +            +P   K  +      + A+ SQ+ +S
Sbjct: 183 IKGLNGQKPPGATEPITVKFANNPSQKTNQAILSQLYQS 221



 Score = 32.7 bits (71), Expect = 1.1
 Identities = 14/45 (31%), Positives = 25/45 (55%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFI 147
           +FV  L+ +  +  L   FG +G + ++ V  D NT + +GF F+
Sbjct: 265 IFVYNLAPDADESILWQMFGPFGAVTNVKVIRDFNTNKCKGFGFV 309



 Score = 32.3 bits (70), Expect = 1.5
 Identities = 16/50 (32%), Positives = 25/50 (50%)
 Frame = +3

Query: 240 TTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFIT 389
           T W  FV  L+ +  +  +   F  FG +  V++  D   N+ KGF F+T
Sbjct: 261 TGWCIFVYNLAPDADESILWQMFGPFGAVTNVKVIRDFNTNKCKGFGFVT 310


>AB209294-1|BAD92531.1|  367|Homo sapiens ELAV (embryonic lethal,
           abnormal vision, Drosophila)-like 2 (Hu antigen B) vari
           protein.
          Length = 367

 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 25/80 (31%), Positives = 42/80 (52%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           L V  L    T +EL+  FG+ GEIES  +  D  TG+S G+ F+ +  P+  +K +   
Sbjct: 49  LIVNYLPQNMTQEELKSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAI--- 105

Query: 193 EHTINNKKVDPKKAKARHGK 252
            +T+N  ++  K  K  + +
Sbjct: 106 -NTLNGLRLQTKTIKVSYAR 124



 Score = 40.7 bits (91), Expect = 0.004
 Identities = 28/99 (28%), Positives = 40/99 (40%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           R   L+V GL    T KEL   F  YG I +  +  D  TG SRG  FI F      ++ 
Sbjct: 131 RDANLYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGISRGVGFIRFDKRIEAEEA 190

Query: 181 MAAGEHTINNKKVDPKKAKARHGKILSEDSAVKSQMMKS 297
           +            +P   K  +      + A+ SQ+ +S
Sbjct: 191 IKGLNGQKPPGATEPITVKFANNPSQKTNQAILSQLYQS 229



 Score = 32.7 bits (71), Expect = 1.1
 Identities = 14/45 (31%), Positives = 25/45 (55%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFI 147
           +FV  L+ +  +  L   FG +G + ++ V  D NT + +GF F+
Sbjct: 286 IFVYNLAPDADESILWQMFGPFGAVTNVKVIRDFNTNKCKGFGFV 330



 Score = 32.3 bits (70), Expect = 1.5
 Identities = 16/50 (32%), Positives = 25/50 (50%)
 Frame = +3

Query: 240 TTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFIT 389
           T W  FV  L+ +  +  +   F  FG +  V++  D   N+ KGF F+T
Sbjct: 282 TGWCIFVYNLAPDADESILWQMFGPFGAVTNVKVIRDFNTNKCKGFGFVT 331


>M62843-1|AAA58396.1|  380|Homo sapiens brain protein protein.
          Length = 380

 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 25/80 (31%), Positives = 41/80 (51%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           L V  L    T +E R  FG+ GEIES  +  D  TG+S G+ F+ +  P+  +K +   
Sbjct: 48  LIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAI--- 104

Query: 193 EHTINNKKVDPKKAKARHGK 252
            +T+N  ++  K  K  + +
Sbjct: 105 -NTLNGLRLQTKTIKVSYAR 123



 Score = 41.1 bits (92), Expect = 0.003
 Identities = 28/99 (28%), Positives = 40/99 (40%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           R   L+V GL    T KEL   F  YG I +  +  D  TG SRG  FI F      ++ 
Sbjct: 130 RDANLYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFDKRIEAEEA 189

Query: 181 MAAGEHTINNKKVDPKKAKARHGKILSEDSAVKSQMMKS 297
           +        +   +P   K  +        A+ SQ+ +S
Sbjct: 190 IKGLNGQKPSGATEPITVKFANNPSQKSSQALLSQLYQS 228



 Score = 34.7 bits (76), Expect = 0.28
 Identities = 15/45 (33%), Positives = 26/45 (57%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFI 147
           +FV  LS ++ +  L   FG +G + ++ V  D NT + +GF F+
Sbjct: 299 IFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFV 343



 Score = 32.7 bits (71), Expect = 1.1
 Identities = 17/50 (34%), Positives = 25/50 (50%)
 Frame = +3

Query: 240 TTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFIT 389
           T W  FV  LS +  +  +   F  FG +  V++  D   N+ KGF F+T
Sbjct: 295 TGWCIFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVT 344


>L26405-1|AAA58677.1|  359|Homo sapiens huc protein.
          Length = 359

 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 25/80 (31%), Positives = 38/80 (47%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           L V  L    T  E +  FG+ G+IES  +  D  TGR  G+ F+ +  P   DK +   
Sbjct: 41  LIVNYLPQNMTQDEFKSLFGSIGDIESCKLVRDKITGRDLGYGFVNYPDPNDADKAI--- 97

Query: 193 EHTINNKKVDPKKAKARHGK 252
            +T+N  K+  K  K  + +
Sbjct: 98  -NTLNGLKLQTKTIKVSYAR 116



 Score = 37.9 bits (84), Expect = 0.030
 Identities = 20/51 (39%), Positives = 25/51 (49%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVF 153
           R   L+V GL    + KE+   F  YG I +  +  D  TG SRG  FI F
Sbjct: 123 RDANLYVSGLPKTMSQKEMEQLFSQYGRIITSRILVDQVTGVSRGVGFIRF 173



 Score = 35.9 bits (79), Expect = 0.12
 Identities = 18/48 (37%), Positives = 25/48 (52%)
 Frame = +3

Query: 246 WEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFIT 389
           W  FV  LS E  +  +   F  FG +  V++  D T N+ KGF F+T
Sbjct: 276 WCIFVYNLSPEADESVLWQLFGPFGAVTNVKVIRDFTTNKCKGFGFVT 323



 Score = 32.7 bits (71), Expect = 1.1
 Identities = 15/45 (33%), Positives = 24/45 (53%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFI 147
           +FV  LS E  +  L   FG +G + ++ V  D  T + +GF F+
Sbjct: 278 IFVYNLSPEADESVLWQLFGPFGAVTNVKVIRDFTTNKCKGFGFV 322


>CR541823-1|CAG46622.1|  174|Homo sapiens RBM8A protein.
          Length = 174

 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 19/57 (33%), Positives = 34/57 (59%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 183
           LFV G+  E T++++ D F  YGEI++I++  D  TG  +G+  + ++  +    VM
Sbjct: 75  LFVTGVHEEATEEDIHDKFAEYGEIKNIHLNLDRRTGYLKGYTLVEYETYKEAQAVM 131



 Score = 37.5 bits (83), Expect = 0.039
 Identities = 14/51 (27%), Positives = 29/51 (56%)
 Frame = +3

Query: 246 WEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFES 398
           W  FV G+  E ++++I + F+E+G I  + +  D+     KG+  + +E+
Sbjct: 73  WILFVTGVHEEATEEDIHDKFAEYGEIKNIHLNLDRRTGYLKGYTLVEYET 123


>BC036071-1|AAH36071.1|  366|Homo sapiens ELAVL4 protein protein.
          Length = 366

 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 25/80 (31%), Positives = 41/80 (51%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           L V  L    T +E R  FG+ GEIES  +  D  TG+S G+ F+ +  P+  +K +   
Sbjct: 48  LIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAI--- 104

Query: 193 EHTINNKKVDPKKAKARHGK 252
            +T+N  ++  K  K  + +
Sbjct: 105 -NTLNGLRLQTKTIKVSYAR 123



 Score = 38.3 bits (85), Expect = 0.023
 Identities = 27/99 (27%), Positives = 39/99 (39%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           R   L+V GL    T KEL   F  YG I +  +     TG SRG  FI F      ++ 
Sbjct: 130 RDANLYVSGLPKTMTQKELEQLFSQYGRIITSRILVGQVTGVSRGVGFIRFDKRIEAEEA 189

Query: 181 MAAGEHTINNKKVDPKKAKARHGKILSEDSAVKSQMMKS 297
           +        +   +P   K  +        A+ SQ+ +S
Sbjct: 190 IKGLNGQKPSGATEPITVKFANNPSQKSSQALLSQLYQS 228



 Score = 34.7 bits (76), Expect = 0.28
 Identities = 15/45 (33%), Positives = 26/45 (57%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFI 147
           +FV  LS ++ +  L   FG +G + ++ V  D NT + +GF F+
Sbjct: 285 IFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFV 329



 Score = 32.7 bits (71), Expect = 1.1
 Identities = 17/50 (34%), Positives = 25/50 (50%)
 Frame = +3

Query: 240 TTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFIT 389
           T W  FV  LS +  +  +   F  FG +  V++  D   N+ KGF F+T
Sbjct: 281 TGWCIFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVT 330


>AY036909-1|AAK67714.1|  360|Homo sapiens HUC protein.
          Length = 360

 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 25/80 (31%), Positives = 38/80 (47%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           L V  L    T  E +  FG+ G+IES  +  D  TGR  G+ F+ +  P   DK +   
Sbjct: 41  LIVNYLPQNMTQDEFKSLFGSIGDIESCKLVRDKITGRDLGYGFVNYPDPNDADKAI--- 97

Query: 193 EHTINNKKVDPKKAKARHGK 252
            +T+N  K+  K  K  + +
Sbjct: 98  -NTLNGLKLQTKTIKVSYAR 116



 Score = 37.9 bits (84), Expect = 0.030
 Identities = 20/51 (39%), Positives = 25/51 (49%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVF 153
           R   L+V GL    + KE+   F  YG I +  +  D  TG SRG  FI F
Sbjct: 123 RDANLYVSGLPKTMSQKEMEQLFSQYGRIITSRILVDQVTGVSRGVGFIRF 173



 Score = 35.9 bits (79), Expect = 0.12
 Identities = 18/48 (37%), Positives = 25/48 (52%)
 Frame = +3

Query: 246 WEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFIT 389
           W  FV  LS E  +  +   F  FG +  V++  D T N+ KGF F+T
Sbjct: 277 WCIFVYNLSPEADESVLWQLFGPFGAVTNVKVIRDFTTNKCKGFGFVT 324



 Score = 32.7 bits (71), Expect = 1.1
 Identities = 15/45 (33%), Positives = 24/45 (53%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFI 147
           +FV  LS E  +  L   FG +G + ++ V  D  T + +GF F+
Sbjct: 279 IFVYNLSPEADESVLWQLFGPFGAVTNVKVIRDFTTNKCKGFGFV 323


>AY033998-1|AAK57541.1|  380|Homo sapiens HUDPRO1 protein.
          Length = 380

 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 25/80 (31%), Positives = 41/80 (51%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           L V  L    T +E R  FG+ GEIES  +  D  TG+S G+ F+ +  P+  +K +   
Sbjct: 48  LIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAI--- 104

Query: 193 EHTINNKKVDPKKAKARHGK 252
            +T+N  ++  K  K  + +
Sbjct: 105 -NTLNGLRLQTKTIKVSYAR 123



 Score = 41.1 bits (92), Expect = 0.003
 Identities = 28/99 (28%), Positives = 40/99 (40%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           R   L+V GL    T KEL   F  YG I +  +  D  TG SRG  FI F      ++ 
Sbjct: 130 RDANLYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFDKRIEAEEA 189

Query: 181 MAAGEHTINNKKVDPKKAKARHGKILSEDSAVKSQMMKS 297
           +        +   +P   K  +        A+ SQ+ +S
Sbjct: 190 IKGLNGQKPSGATEPITVKFANNPSQKSSQALLSQLYQS 228



 Score = 34.7 bits (76), Expect = 0.28
 Identities = 15/45 (33%), Positives = 26/45 (57%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFI 147
           +FV  LS ++ +  L   FG +G + ++ V  D NT + +GF F+
Sbjct: 299 IFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFV 343



 Score = 32.7 bits (71), Expect = 1.1
 Identities = 17/50 (34%), Positives = 25/50 (50%)
 Frame = +3

Query: 240 TTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFIT 389
           T W  FV  LS +  +  +   F  FG +  V++  D   N+ KGF F+T
Sbjct: 295 TGWCIFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVT 344


>AY033997-1|AAK57540.1|  366|Homo sapiens HUD1 protein.
          Length = 366

 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 25/80 (31%), Positives = 41/80 (51%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           L V  L    T +E R  FG+ GEIES  +  D  TG+S G+ F+ +  P+  +K +   
Sbjct: 48  LIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAI--- 104

Query: 193 EHTINNKKVDPKKAKARHGK 252
            +T+N  ++  K  K  + +
Sbjct: 105 -NTLNGLRLQTKTIKVSYAR 123



 Score = 41.1 bits (92), Expect = 0.003
 Identities = 28/99 (28%), Positives = 40/99 (40%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           R   L+V GL    T KEL   F  YG I +  +  D  TG SRG  FI F      ++ 
Sbjct: 130 RDANLYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFDKRIEAEEA 189

Query: 181 MAAGEHTINNKKVDPKKAKARHGKILSEDSAVKSQMMKS 297
           +        +   +P   K  +        A+ SQ+ +S
Sbjct: 190 IKGLNGQKPSGATEPITVKFANNPSQKSSQALLSQLYQS 228



 Score = 34.7 bits (76), Expect = 0.28
 Identities = 15/45 (33%), Positives = 26/45 (57%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFI 147
           +FV  LS ++ +  L   FG +G + ++ V  D NT + +GF F+
Sbjct: 285 IFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFV 329



 Score = 32.7 bits (71), Expect = 1.1
 Identities = 17/50 (34%), Positives = 25/50 (50%)
 Frame = +3

Query: 240 TTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFIT 389
           T W  FV  LS +  +  +   F  FG +  V++  D   N+ KGF F+T
Sbjct: 281 TGWCIFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVT 330


>AY033996-1|AAK57539.1|  383|Homo sapiens HUD4 protein.
          Length = 383

 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 25/80 (31%), Positives = 41/80 (51%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           L V  L    T +E R  FG+ GEIES  +  D  TG+S G+ F+ +  P+  +K +   
Sbjct: 65  LIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAI--- 121

Query: 193 EHTINNKKVDPKKAKARHGK 252
            +T+N  ++  K  K  + +
Sbjct: 122 -NTLNGLRLQTKTIKVSYAR 140



 Score = 41.1 bits (92), Expect = 0.003
 Identities = 28/99 (28%), Positives = 40/99 (40%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           R   L+V GL    T KEL   F  YG I +  +  D  TG SRG  FI F      ++ 
Sbjct: 147 RDANLYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFDKRIEAEEA 206

Query: 181 MAAGEHTINNKKVDPKKAKARHGKILSEDSAVKSQMMKS 297
           +        +   +P   K  +        A+ SQ+ +S
Sbjct: 207 IKGLNGQKPSGATEPITVKFANNPSQKSSQALLSQLYQS 245



 Score = 34.7 bits (76), Expect = 0.28
 Identities = 15/45 (33%), Positives = 26/45 (57%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFI 147
           +FV  LS ++ +  L   FG +G + ++ V  D NT + +GF F+
Sbjct: 302 IFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFV 346



 Score = 32.7 bits (71), Expect = 1.1
 Identities = 17/50 (34%), Positives = 25/50 (50%)
 Frame = +3

Query: 240 TTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFIT 389
           T W  FV  LS +  +  +   F  FG +  V++  D   N+ KGF F+T
Sbjct: 298 TGWCIFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVT 347


>AY033995-1|AAK57538.1|  366|Homo sapiens HUD3 protein.
          Length = 366

 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 25/80 (31%), Positives = 41/80 (51%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           L V  L    T +E R  FG+ GEIES  +  D  TG+S G+ F+ +  P+  +K +   
Sbjct: 48  LIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAI--- 104

Query: 193 EHTINNKKVDPKKAKARHGK 252
            +T+N  ++  K  K  + +
Sbjct: 105 -NTLNGLRLQTKTIKVSYAR 123



 Score = 41.1 bits (92), Expect = 0.003
 Identities = 28/99 (28%), Positives = 40/99 (40%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           R   L+V GL    T KEL   F  YG I +  +  D  TG SRG  FI F      ++ 
Sbjct: 130 RDANLYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFDKRIEAEEA 189

Query: 181 MAAGEHTINNKKVDPKKAKARHGKILSEDSAVKSQMMKS 297
           +        +   +P   K  +        A+ SQ+ +S
Sbjct: 190 IKGLNGQKPSGATEPITVKFANNPSQKSSQALLSQLYQS 228



 Score = 34.7 bits (76), Expect = 0.28
 Identities = 15/45 (33%), Positives = 26/45 (57%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFI 147
           +FV  LS ++ +  L   FG +G + ++ V  D NT + +GF F+
Sbjct: 285 IFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFV 329



 Score = 32.7 bits (71), Expect = 1.1
 Identities = 17/50 (34%), Positives = 25/50 (50%)
 Frame = +3

Query: 240 TTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFIT 389
           T W  FV  LS +  +  +   F  FG +  V++  D   N+ KGF F+T
Sbjct: 281 TGWCIFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVT 330


>AL592182-6|CAI15792.1|  385|Homo sapiens ELAV (embryonic lethal,
           abnormal vision, Drosophila)-like 4 (Hu antigen D)
           protein.
          Length = 385

 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 25/80 (31%), Positives = 41/80 (51%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           L V  L    T +E R  FG+ GEIES  +  D  TG+S G+ F+ +  P+  +K +   
Sbjct: 53  LIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAI--- 109

Query: 193 EHTINNKKVDPKKAKARHGK 252
            +T+N  ++  K  K  + +
Sbjct: 110 -NTLNGLRLQTKTIKVSYAR 128



 Score = 41.1 bits (92), Expect = 0.003
 Identities = 28/99 (28%), Positives = 40/99 (40%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           R   L+V GL    T KEL   F  YG I +  +  D  TG SRG  FI F      ++ 
Sbjct: 135 RDANLYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFDKRIEAEEA 194

Query: 181 MAAGEHTINNKKVDPKKAKARHGKILSEDSAVKSQMMKS 297
           +        +   +P   K  +        A+ SQ+ +S
Sbjct: 195 IKGLNGQKPSGATEPITVKFANNPSQKSSQALLSQLYQS 233



 Score = 34.7 bits (76), Expect = 0.28
 Identities = 15/45 (33%), Positives = 26/45 (57%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFI 147
           +FV  LS ++ +  L   FG +G + ++ V  D NT + +GF F+
Sbjct: 304 IFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFV 348



 Score = 32.7 bits (71), Expect = 1.1
 Identities = 17/50 (34%), Positives = 25/50 (50%)
 Frame = +3

Query: 240 TTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFIT 389
           T W  FV  LS +  +  +   F  FG +  V++  D   N+ KGF F+T
Sbjct: 300 TGWCIFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVT 349


>AL592182-5|CAI15793.1|  371|Homo sapiens ELAV (embryonic lethal,
           abnormal vision, Drosophila)-like 4 (Hu antigen D)
           protein.
          Length = 371

 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 25/80 (31%), Positives = 41/80 (51%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           L V  L    T +E R  FG+ GEIES  +  D  TG+S G+ F+ +  P+  +K +   
Sbjct: 53  LIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAI--- 109

Query: 193 EHTINNKKVDPKKAKARHGK 252
            +T+N  ++  K  K  + +
Sbjct: 110 -NTLNGLRLQTKTIKVSYAR 128



 Score = 41.1 bits (92), Expect = 0.003
 Identities = 28/99 (28%), Positives = 40/99 (40%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           R   L+V GL    T KEL   F  YG I +  +  D  TG SRG  FI F      ++ 
Sbjct: 135 RDANLYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFDKRIEAEEA 194

Query: 181 MAAGEHTINNKKVDPKKAKARHGKILSEDSAVKSQMMKS 297
           +        +   +P   K  +        A+ SQ+ +S
Sbjct: 195 IKGLNGQKPSGATEPITVKFANNPSQKSSQALLSQLYQS 233



 Score = 34.7 bits (76), Expect = 0.28
 Identities = 15/45 (33%), Positives = 26/45 (57%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFI 147
           +FV  LS ++ +  L   FG +G + ++ V  D NT + +GF F+
Sbjct: 290 IFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFV 334



 Score = 32.7 bits (71), Expect = 1.1
 Identities = 17/50 (34%), Positives = 25/50 (50%)
 Frame = +3

Query: 240 TTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFIT 389
           T W  FV  LS +  +  +   F  FG +  V++  D   N+ KGF F+T
Sbjct: 286 TGWCIFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVT 335


>AL592182-4|CAI15791.1|  380|Homo sapiens ELAV (embryonic lethal,
           abnormal vision, Drosophila)-like 4 (Hu antigen D)
           protein.
          Length = 380

 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 25/80 (31%), Positives = 41/80 (51%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           L V  L    T +E R  FG+ GEIES  +  D  TG+S G+ F+ +  P+  +K +   
Sbjct: 48  LIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAI--- 104

Query: 193 EHTINNKKVDPKKAKARHGK 252
            +T+N  ++  K  K  + +
Sbjct: 105 -NTLNGLRLQTKTIKVSYAR 123



 Score = 41.1 bits (92), Expect = 0.003
 Identities = 28/99 (28%), Positives = 40/99 (40%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           R   L+V GL    T KEL   F  YG I +  +  D  TG SRG  FI F      ++ 
Sbjct: 130 RDANLYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFDKRIEAEEA 189

Query: 181 MAAGEHTINNKKVDPKKAKARHGKILSEDSAVKSQMMKS 297
           +        +   +P   K  +        A+ SQ+ +S
Sbjct: 190 IKGLNGQKPSGATEPITVKFANNPSQKSSQALLSQLYQS 228



 Score = 34.7 bits (76), Expect = 0.28
 Identities = 15/45 (33%), Positives = 26/45 (57%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFI 147
           +FV  LS ++ +  L   FG +G + ++ V  D NT + +GF F+
Sbjct: 299 IFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFV 343



 Score = 32.7 bits (71), Expect = 1.1
 Identities = 17/50 (34%), Positives = 25/50 (50%)
 Frame = +3

Query: 240 TTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFIT 389
           T W  FV  LS +  +  +   F  FG +  V++  D   N+ KGF F+T
Sbjct: 295 TGWCIFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVT 344


>AL592182-3|CAI15790.1|  366|Homo sapiens ELAV (embryonic lethal,
           abnormal vision, Drosophila)-like 4 (Hu antigen D)
           protein.
          Length = 366

 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 25/80 (31%), Positives = 41/80 (51%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           L V  L    T +E R  FG+ GEIES  +  D  TG+S G+ F+ +  P+  +K +   
Sbjct: 48  LIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAI--- 104

Query: 193 EHTINNKKVDPKKAKARHGK 252
            +T+N  ++  K  K  + +
Sbjct: 105 -NTLNGLRLQTKTIKVSYAR 123



 Score = 41.1 bits (92), Expect = 0.003
 Identities = 28/99 (28%), Positives = 40/99 (40%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           R   L+V GL    T KEL   F  YG I +  +  D  TG SRG  FI F      ++ 
Sbjct: 130 RDANLYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFDKRIEAEEA 189

Query: 181 MAAGEHTINNKKVDPKKAKARHGKILSEDSAVKSQMMKS 297
           +        +   +P   K  +        A+ SQ+ +S
Sbjct: 190 IKGLNGQKPSGATEPITVKFANNPSQKSSQALLSQLYQS 228



 Score = 34.7 bits (76), Expect = 0.28
 Identities = 15/45 (33%), Positives = 26/45 (57%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFI 147
           +FV  LS ++ +  L   FG +G + ++ V  D NT + +GF F+
Sbjct: 285 IFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFV 329



 Score = 32.7 bits (71), Expect = 1.1
 Identities = 17/50 (34%), Positives = 25/50 (50%)
 Frame = +3

Query: 240 TTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFIT 389
           T W  FV  LS +  +  +   F  FG +  V++  D   N+ KGF F+T
Sbjct: 281 TGWCIFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVT 330


>AL592182-2|CAI15789.1|  383|Homo sapiens ELAV (embryonic lethal,
           abnormal vision, Drosophila)-like 4 (Hu antigen D)
           protein.
          Length = 383

 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 25/80 (31%), Positives = 41/80 (51%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           L V  L    T +E R  FG+ GEIES  +  D  TG+S G+ F+ +  P+  +K +   
Sbjct: 65  LIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAI--- 121

Query: 193 EHTINNKKVDPKKAKARHGK 252
            +T+N  ++  K  K  + +
Sbjct: 122 -NTLNGLRLQTKTIKVSYAR 140



 Score = 41.1 bits (92), Expect = 0.003
 Identities = 28/99 (28%), Positives = 40/99 (40%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           R   L+V GL    T KEL   F  YG I +  +  D  TG SRG  FI F      ++ 
Sbjct: 147 RDANLYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFDKRIEAEEA 206

Query: 181 MAAGEHTINNKKVDPKKAKARHGKILSEDSAVKSQMMKS 297
           +        +   +P   K  +        A+ SQ+ +S
Sbjct: 207 IKGLNGQKPSGATEPITVKFANNPSQKSSQALLSQLYQS 245



 Score = 34.7 bits (76), Expect = 0.28
 Identities = 15/45 (33%), Positives = 26/45 (57%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFI 147
           +FV  LS ++ +  L   FG +G + ++ V  D NT + +GF F+
Sbjct: 302 IFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFV 346



 Score = 32.7 bits (71), Expect = 1.1
 Identities = 17/50 (34%), Positives = 25/50 (50%)
 Frame = +3

Query: 240 TTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFIT 389
           T W  FV  LS +  +  +   F  FG +  V++  D   N+ KGF F+T
Sbjct: 298 TGWCIFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVT 347


>AL592182-1|CAI15788.1|  366|Homo sapiens ELAV (embryonic lethal,
           abnormal vision, Drosophila)-like 4 (Hu antigen D)
           protein.
          Length = 366

 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 25/80 (31%), Positives = 41/80 (51%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           L V  L    T +E R  FG+ GEIES  +  D  TG+S G+ F+ +  P+  +K +   
Sbjct: 48  LIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAI--- 104

Query: 193 EHTINNKKVDPKKAKARHGK 252
            +T+N  ++  K  K  + +
Sbjct: 105 -NTLNGLRLQTKTIKVSYAR 123



 Score = 41.1 bits (92), Expect = 0.003
 Identities = 28/99 (28%), Positives = 40/99 (40%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           R   L+V GL    T KEL   F  YG I +  +  D  TG SRG  FI F      ++ 
Sbjct: 130 RDANLYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFDKRIEAEEA 189

Query: 181 MAAGEHTINNKKVDPKKAKARHGKILSEDSAVKSQMMKS 297
           +        +   +P   K  +        A+ SQ+ +S
Sbjct: 190 IKGLNGQKPSGATEPITVKFANNPSQKSSQALLSQLYQS 228



 Score = 34.7 bits (76), Expect = 0.28
 Identities = 15/45 (33%), Positives = 26/45 (57%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFI 147
           +FV  LS ++ +  L   FG +G + ++ V  D NT + +GF F+
Sbjct: 285 IFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFV 329



 Score = 32.7 bits (71), Expect = 1.1
 Identities = 17/50 (34%), Positives = 25/50 (50%)
 Frame = +3

Query: 240 TTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFIT 389
           T W  FV  LS +  +  +   F  FG +  V++  D   N+ KGF F+T
Sbjct: 281 TGWCIFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVT 330


>AL583843-6|CAI14638.1|  385|Homo sapiens ELAV (embryonic lethal,
           abnormal vision, Drosophila)-like 4 (Hu antigen D)
           protein.
          Length = 385

 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 25/80 (31%), Positives = 41/80 (51%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           L V  L    T +E R  FG+ GEIES  +  D  TG+S G+ F+ +  P+  +K +   
Sbjct: 53  LIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAI--- 109

Query: 193 EHTINNKKVDPKKAKARHGK 252
            +T+N  ++  K  K  + +
Sbjct: 110 -NTLNGLRLQTKTIKVSYAR 128



 Score = 41.1 bits (92), Expect = 0.003
 Identities = 28/99 (28%), Positives = 40/99 (40%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           R   L+V GL    T KEL   F  YG I +  +  D  TG SRG  FI F      ++ 
Sbjct: 135 RDANLYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFDKRIEAEEA 194

Query: 181 MAAGEHTINNKKVDPKKAKARHGKILSEDSAVKSQMMKS 297
           +        +   +P   K  +        A+ SQ+ +S
Sbjct: 195 IKGLNGQKPSGATEPITVKFANNPSQKSSQALLSQLYQS 233



 Score = 34.7 bits (76), Expect = 0.28
 Identities = 15/45 (33%), Positives = 26/45 (57%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFI 147
           +FV  LS ++ +  L   FG +G + ++ V  D NT + +GF F+
Sbjct: 304 IFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFV 348



 Score = 32.7 bits (71), Expect = 1.1
 Identities = 17/50 (34%), Positives = 25/50 (50%)
 Frame = +3

Query: 240 TTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFIT 389
           T W  FV  LS +  +  +   F  FG +  V++  D   N+ KGF F+T
Sbjct: 300 TGWCIFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVT 349


>AL583843-5|CAI14639.1|  371|Homo sapiens ELAV (embryonic lethal,
           abnormal vision, Drosophila)-like 4 (Hu antigen D)
           protein.
          Length = 371

 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 25/80 (31%), Positives = 41/80 (51%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           L V  L    T +E R  FG+ GEIES  +  D  TG+S G+ F+ +  P+  +K +   
Sbjct: 53  LIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAI--- 109

Query: 193 EHTINNKKVDPKKAKARHGK 252
            +T+N  ++  K  K  + +
Sbjct: 110 -NTLNGLRLQTKTIKVSYAR 128



 Score = 41.1 bits (92), Expect = 0.003
 Identities = 28/99 (28%), Positives = 40/99 (40%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           R   L+V GL    T KEL   F  YG I +  +  D  TG SRG  FI F      ++ 
Sbjct: 135 RDANLYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFDKRIEAEEA 194

Query: 181 MAAGEHTINNKKVDPKKAKARHGKILSEDSAVKSQMMKS 297
           +        +   +P   K  +        A+ SQ+ +S
Sbjct: 195 IKGLNGQKPSGATEPITVKFANNPSQKSSQALLSQLYQS 233



 Score = 34.7 bits (76), Expect = 0.28
 Identities = 15/45 (33%), Positives = 26/45 (57%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFI 147
           +FV  LS ++ +  L   FG +G + ++ V  D NT + +GF F+
Sbjct: 290 IFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFV 334



 Score = 32.7 bits (71), Expect = 1.1
 Identities = 17/50 (34%), Positives = 25/50 (50%)
 Frame = +3

Query: 240 TTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFIT 389
           T W  FV  LS +  +  +   F  FG +  V++  D   N+ KGF F+T
Sbjct: 286 TGWCIFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVT 335


>AL583843-4|CAI14637.1|  380|Homo sapiens ELAV (embryonic lethal,
           abnormal vision, Drosophila)-like 4 (Hu antigen D)
           protein.
          Length = 380

 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 25/80 (31%), Positives = 41/80 (51%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           L V  L    T +E R  FG+ GEIES  +  D  TG+S G+ F+ +  P+  +K +   
Sbjct: 48  LIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAI--- 104

Query: 193 EHTINNKKVDPKKAKARHGK 252
            +T+N  ++  K  K  + +
Sbjct: 105 -NTLNGLRLQTKTIKVSYAR 123



 Score = 41.1 bits (92), Expect = 0.003
 Identities = 28/99 (28%), Positives = 40/99 (40%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           R   L+V GL    T KEL   F  YG I +  +  D  TG SRG  FI F      ++ 
Sbjct: 130 RDANLYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFDKRIEAEEA 189

Query: 181 MAAGEHTINNKKVDPKKAKARHGKILSEDSAVKSQMMKS 297
           +        +   +P   K  +        A+ SQ+ +S
Sbjct: 190 IKGLNGQKPSGATEPITVKFANNPSQKSSQALLSQLYQS 228



 Score = 34.7 bits (76), Expect = 0.28
 Identities = 15/45 (33%), Positives = 26/45 (57%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFI 147
           +FV  LS ++ +  L   FG +G + ++ V  D NT + +GF F+
Sbjct: 299 IFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFV 343



 Score = 32.7 bits (71), Expect = 1.1
 Identities = 17/50 (34%), Positives = 25/50 (50%)
 Frame = +3

Query: 240 TTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFIT 389
           T W  FV  LS +  +  +   F  FG +  V++  D   N+ KGF F+T
Sbjct: 295 TGWCIFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVT 344


>AL583843-3|CAI14636.1|  366|Homo sapiens ELAV (embryonic lethal,
           abnormal vision, Drosophila)-like 4 (Hu antigen D)
           protein.
          Length = 366

 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 25/80 (31%), Positives = 41/80 (51%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           L V  L    T +E R  FG+ GEIES  +  D  TG+S G+ F+ +  P+  +K +   
Sbjct: 48  LIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAI--- 104

Query: 193 EHTINNKKVDPKKAKARHGK 252
            +T+N  ++  K  K  + +
Sbjct: 105 -NTLNGLRLQTKTIKVSYAR 123



 Score = 41.1 bits (92), Expect = 0.003
 Identities = 28/99 (28%), Positives = 40/99 (40%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           R   L+V GL    T KEL   F  YG I +  +  D  TG SRG  FI F      ++ 
Sbjct: 130 RDANLYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFDKRIEAEEA 189

Query: 181 MAAGEHTINNKKVDPKKAKARHGKILSEDSAVKSQMMKS 297
           +        +   +P   K  +        A+ SQ+ +S
Sbjct: 190 IKGLNGQKPSGATEPITVKFANNPSQKSSQALLSQLYQS 228



 Score = 34.7 bits (76), Expect = 0.28
 Identities = 15/45 (33%), Positives = 26/45 (57%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFI 147
           +FV  LS ++ +  L   FG +G + ++ V  D NT + +GF F+
Sbjct: 285 IFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFV 329



 Score = 32.7 bits (71), Expect = 1.1
 Identities = 17/50 (34%), Positives = 25/50 (50%)
 Frame = +3

Query: 240 TTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFIT 389
           T W  FV  LS +  +  +   F  FG +  V++  D   N+ KGF F+T
Sbjct: 281 TGWCIFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVT 330


>AL583843-2|CAI14635.1|  383|Homo sapiens ELAV (embryonic lethal,
           abnormal vision, Drosophila)-like 4 (Hu antigen D)
           protein.
          Length = 383

 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 25/80 (31%), Positives = 41/80 (51%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           L V  L    T +E R  FG+ GEIES  +  D  TG+S G+ F+ +  P+  +K +   
Sbjct: 65  LIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAI--- 121

Query: 193 EHTINNKKVDPKKAKARHGK 252
            +T+N  ++  K  K  + +
Sbjct: 122 -NTLNGLRLQTKTIKVSYAR 140



 Score = 41.1 bits (92), Expect = 0.003
 Identities = 28/99 (28%), Positives = 40/99 (40%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           R   L+V GL    T KEL   F  YG I +  +  D  TG SRG  FI F      ++ 
Sbjct: 147 RDANLYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFDKRIEAEEA 206

Query: 181 MAAGEHTINNKKVDPKKAKARHGKILSEDSAVKSQMMKS 297
           +        +   +P   K  +        A+ SQ+ +S
Sbjct: 207 IKGLNGQKPSGATEPITVKFANNPSQKSSQALLSQLYQS 245



 Score = 34.7 bits (76), Expect = 0.28
 Identities = 15/45 (33%), Positives = 26/45 (57%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFI 147
           +FV  LS ++ +  L   FG +G + ++ V  D NT + +GF F+
Sbjct: 302 IFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFV 346



 Score = 32.7 bits (71), Expect = 1.1
 Identities = 17/50 (34%), Positives = 25/50 (50%)
 Frame = +3

Query: 240 TTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFIT 389
           T W  FV  LS +  +  +   F  FG +  V++  D   N+ KGF F+T
Sbjct: 298 TGWCIFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVT 347


>AL583843-1|CAI14634.1|  366|Homo sapiens ELAV (embryonic lethal,
           abnormal vision, Drosophila)-like 4 (Hu antigen D)
           protein.
          Length = 366

 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 25/80 (31%), Positives = 41/80 (51%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           L V  L    T +E R  FG+ GEIES  +  D  TG+S G+ F+ +  P+  +K +   
Sbjct: 48  LIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAI--- 104

Query: 193 EHTINNKKVDPKKAKARHGK 252
            +T+N  ++  K  K  + +
Sbjct: 105 -NTLNGLRLQTKTIKVSYAR 123



 Score = 41.1 bits (92), Expect = 0.003
 Identities = 28/99 (28%), Positives = 40/99 (40%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           R   L+V GL    T KEL   F  YG I +  +  D  TG SRG  FI F      ++ 
Sbjct: 130 RDANLYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFDKRIEAEEA 189

Query: 181 MAAGEHTINNKKVDPKKAKARHGKILSEDSAVKSQMMKS 297
           +        +   +P   K  +        A+ SQ+ +S
Sbjct: 190 IKGLNGQKPSGATEPITVKFANNPSQKSSQALLSQLYQS 228



 Score = 34.7 bits (76), Expect = 0.28
 Identities = 15/45 (33%), Positives = 26/45 (57%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFI 147
           +FV  LS ++ +  L   FG +G + ++ V  D NT + +GF F+
Sbjct: 285 IFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFV 329



 Score = 32.7 bits (71), Expect = 1.1
 Identities = 17/50 (34%), Positives = 25/50 (50%)
 Frame = +3

Query: 240 TTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFIT 389
           T W  FV  LS +  +  +   F  FG +  V++  D   N+ KGF F+T
Sbjct: 281 TGWCIFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVT 330


>X84841-1|CAA59278.1|  437|Homo sapiens 68 kDa (U1)
           ribonucleoprotein protein.
          Length = 437

 Score = 44.8 bits (101), Expect = 3e-04
 Identities = 23/73 (31%), Positives = 44/73 (60%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           LFV  ++++TT+ +LR  F  YG I+ I++     +G+ RG+AFI ++    +    +A 
Sbjct: 105 LFVARVNYDTTESKLRREFEVYGPIKRIHMVYSKRSGKPRGYAFIEYEHERDMH---SAY 161

Query: 193 EHTINNKKVDPKK 231
           +H  + KK+D ++
Sbjct: 162 KHA-DGKKIDGRR 173


>X06812-1|CAA29961.1|  301|Homo sapiens protein ( Human mRNA for
           hU1-70K snRNP protein (RNP8). ).
          Length = 301

 Score = 44.8 bits (101), Expect = 3e-04
 Identities = 23/73 (31%), Positives = 44/73 (60%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           LFV  ++++TT+ +LR  F  YG I+ I++     +G+ RG+AFI ++    +    +A 
Sbjct: 56  LFVARVNYDTTESKLRREFEVYGPIKRIHMVYSKRSGKPRGYAFIEYEHERDMH---SAY 112

Query: 193 EHTINNKKVDPKK 231
           +H  + KK+D ++
Sbjct: 113 KHA-DGKKIDGRR 124


>X04654-1|CAA28352.1|  614|Homo sapiens protein ( Human mRNA for U1
           RNA-associated 70K protein. ).
          Length = 614

 Score = 44.8 bits (101), Expect = 3e-04
 Identities = 23/73 (31%), Positives = 44/73 (60%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           LFV  ++++TT+ +LR  F  YG I+ I++     +G+ RG+AFI ++    +    +A 
Sbjct: 282 LFVARVNYDTTESKLRREFEVYGPIKRIHMVYSKRSGKPRGYAFIEYEHERDMH---SAY 338

Query: 193 EHTINNKKVDPKK 231
           +H  + KK+D ++
Sbjct: 339 KHA-DGKKIDGRR 350


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 82,284,856
Number of Sequences: 237096
Number of extensions: 1638549
Number of successful extensions: 9319
Number of sequences better than 10.0: 500
Number of HSP's better than 10.0 without gapping: 8067
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 9253
length of database: 76,859,062
effective HSP length: 87
effective length of database: 56,231,710
effective search space used: 6972732040
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -