SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20080
         (709 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z97054-12|CAI42656.1| 3407|Homo sapiens upstream regulatory elem...    30   7.1  
Z97054-10|CAI42654.1| 4374|Homo sapiens upstream regulatory elem...    30   7.1  
Z94044-4|CAI42354.1| 4374|Homo sapiens upstream regulatory eleme...    30   7.1  
DQ097177-1|AAY98258.1| 4374|Homo sapiens Mcl-1 ubiquitin ligase ...    30   7.1  
AY929612-1|AAX24125.1| 4374|Homo sapiens LASU1 protein.                30   7.1  
AY772009-1|AAV90838.1| 4374|Homo sapiens ARF-binding protein 1 p...    30   7.1  
AL592046-4|CAI39581.1| 3407|Homo sapiens upstream regulatory ele...    30   7.1  
AL592046-3|CAI39580.1| 4374|Homo sapiens upstream regulatory ele...    30   7.1  
AB071605-1|BAC06833.1| 3360|Homo sapiens HECT domain protein LAS...    30   7.1  
AB046798-1|BAB13404.1| 1202|Homo sapiens KIAA1578 protein protein.     30   7.1  
AB002310-1|BAA20771.2| 3192|Homo sapiens KIAA0312 protein.             30   7.1  

>Z97054-12|CAI42656.1| 3407|Homo sapiens upstream regulatory element
           binding protein 1 (UREB1) protein.
          Length = 3407

 Score = 30.3 bits (65), Expect = 7.1
 Identities = 17/52 (32%), Positives = 28/52 (53%)
 Frame = -1

Query: 196 DKTSSTRITHVCGNVLVQLNTVDIAVVLFRSCVTIPGIFLKIYTFTIVLNKC 41
           +K +S   T + G +L+Q  T D+  VL R+CV++ G+ +   T    L  C
Sbjct: 765 EKETSLEETKI-GEILIQGLTEDMVTVLIRACVSMLGVPVDPDTLHATLRLC 815


>Z97054-10|CAI42654.1| 4374|Homo sapiens upstream regulatory element
            binding protein 1 (UREB1) protein.
          Length = 4374

 Score = 30.3 bits (65), Expect = 7.1
 Identities = 17/52 (32%), Positives = 28/52 (53%)
 Frame = -1

Query: 196  DKTSSTRITHVCGNVLVQLNTVDIAVVLFRSCVTIPGIFLKIYTFTIVLNKC 41
            +K +S   T + G +L+Q  T D+  VL R+CV++ G+ +   T    L  C
Sbjct: 1732 EKETSLEETKI-GEILIQGLTEDMVTVLIRACVSMLGVPVDPDTLHATLRLC 1782


>Z94044-4|CAI42354.1| 4374|Homo sapiens upstream regulatory element
            binding protein 1 (UREB1) protein.
          Length = 4374

 Score = 30.3 bits (65), Expect = 7.1
 Identities = 17/52 (32%), Positives = 28/52 (53%)
 Frame = -1

Query: 196  DKTSSTRITHVCGNVLVQLNTVDIAVVLFRSCVTIPGIFLKIYTFTIVLNKC 41
            +K +S   T + G +L+Q  T D+  VL R+CV++ G+ +   T    L  C
Sbjct: 1732 EKETSLEETKI-GEILIQGLTEDMVTVLIRACVSMLGVPVDPDTLHATLRLC 1782


>DQ097177-1|AAY98258.1| 4374|Homo sapiens Mcl-1 ubiquitin ligase
            protein.
          Length = 4374

 Score = 30.3 bits (65), Expect = 7.1
 Identities = 17/52 (32%), Positives = 28/52 (53%)
 Frame = -1

Query: 196  DKTSSTRITHVCGNVLVQLNTVDIAVVLFRSCVTIPGIFLKIYTFTIVLNKC 41
            +K +S   T + G +L+Q  T D+  VL R+CV++ G+ +   T    L  C
Sbjct: 1732 EKETSLEETKI-GEILIQGLTEDMVTVLIRACVSMLGVPVDPDTLHATLRLC 1782


>AY929612-1|AAX24125.1| 4374|Homo sapiens LASU1 protein.
          Length = 4374

 Score = 30.3 bits (65), Expect = 7.1
 Identities = 17/52 (32%), Positives = 28/52 (53%)
 Frame = -1

Query: 196  DKTSSTRITHVCGNVLVQLNTVDIAVVLFRSCVTIPGIFLKIYTFTIVLNKC 41
            +K +S   T + G +L+Q  T D+  VL R+CV++ G+ +   T    L  C
Sbjct: 1732 EKETSLEETKI-GEILIQGLTEDMVTVLIRACVSMLGVPVDPDTLHATLRLC 1782


>AY772009-1|AAV90838.1| 4374|Homo sapiens ARF-binding protein 1
            protein.
          Length = 4374

 Score = 30.3 bits (65), Expect = 7.1
 Identities = 17/52 (32%), Positives = 28/52 (53%)
 Frame = -1

Query: 196  DKTSSTRITHVCGNVLVQLNTVDIAVVLFRSCVTIPGIFLKIYTFTIVLNKC 41
            +K +S   T + G +L+Q  T D+  VL R+CV++ G+ +   T    L  C
Sbjct: 1732 EKETSLEETKI-GEILIQGLTEDMVTVLIRACVSMLGVPVDPDTLHATLRLC 1782


>AL592046-4|CAI39581.1| 3407|Homo sapiens upstream regulatory
           element binding protein 1 (UREB1) protein.
          Length = 3407

 Score = 30.3 bits (65), Expect = 7.1
 Identities = 17/52 (32%), Positives = 28/52 (53%)
 Frame = -1

Query: 196 DKTSSTRITHVCGNVLVQLNTVDIAVVLFRSCVTIPGIFLKIYTFTIVLNKC 41
           +K +S   T + G +L+Q  T D+  VL R+CV++ G+ +   T    L  C
Sbjct: 765 EKETSLEETKI-GEILIQGLTEDMVTVLIRACVSMLGVPVDPDTLHATLRLC 815


>AL592046-3|CAI39580.1| 4374|Homo sapiens upstream regulatory element
            binding protein 1 (UREB1) protein.
          Length = 4374

 Score = 30.3 bits (65), Expect = 7.1
 Identities = 17/52 (32%), Positives = 28/52 (53%)
 Frame = -1

Query: 196  DKTSSTRITHVCGNVLVQLNTVDIAVVLFRSCVTIPGIFLKIYTFTIVLNKC 41
            +K +S   T + G +L+Q  T D+  VL R+CV++ G+ +   T    L  C
Sbjct: 1732 EKETSLEETKI-GEILIQGLTEDMVTVLIRACVSMLGVPVDPDTLHATLRLC 1782


>AB071605-1|BAC06833.1| 3360|Homo sapiens HECT domain protein LASU1
           protein.
          Length = 3360

 Score = 30.3 bits (65), Expect = 7.1
 Identities = 17/52 (32%), Positives = 28/52 (53%)
 Frame = -1

Query: 196 DKTSSTRITHVCGNVLVQLNTVDIAVVLFRSCVTIPGIFLKIYTFTIVLNKC 41
           +K +S   T + G +L+Q  T D+  VL R+CV++ G+ +   T    L  C
Sbjct: 718 EKETSLEETKI-GEILIQGLTEDMVTVLIRACVSMLGVPVDPDTLHATLRLC 768


>AB046798-1|BAB13404.1| 1202|Homo sapiens KIAA1578 protein protein.
          Length = 1202

 Score = 30.3 bits (65), Expect = 7.1
 Identities = 17/52 (32%), Positives = 28/52 (53%)
 Frame = -1

Query: 196 DKTSSTRITHVCGNVLVQLNTVDIAVVLFRSCVTIPGIFLKIYTFTIVLNKC 41
           +K +S   T + G +L+Q  T D+  VL R+CV++ G+ +   T    L  C
Sbjct: 487 EKETSLEETKI-GEILIQGLTEDMVTVLIRACVSMLGVPVDPDTLHATLRLC 537


>AB002310-1|BAA20771.2| 3192|Homo sapiens KIAA0312 protein.
          Length = 3192

 Score = 30.3 bits (65), Expect = 7.1
 Identities = 17/52 (32%), Positives = 28/52 (53%)
 Frame = -1

Query: 196 DKTSSTRITHVCGNVLVQLNTVDIAVVLFRSCVTIPGIFLKIYTFTIVLNKC 41
           +K +S   T + G +L+Q  T D+  VL R+CV++ G+ +   T    L  C
Sbjct: 567 EKETSLEETKI-GEILIQGLTEDMVTVLIRACVSMLGVPVDPDTLHATLRLC 617


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 94,194,855
Number of Sequences: 237096
Number of extensions: 1942383
Number of successful extensions: 3222
Number of sequences better than 10.0: 11
Number of HSP's better than 10.0 without gapping: 3075
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3222
length of database: 76,859,062
effective HSP length: 88
effective length of database: 55,994,614
effective search space used: 8231208258
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -