SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20079
         (698 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CR542223-1|CAG47019.1|  113|Homo sapiens GC20 protein.                 81   5e-15
BC006996-1|AAH06996.1|  113|Homo sapiens eukaryotic translation ...    81   5e-15
AK223448-1|BAD97168.1|  113|Homo sapiens translation factor sui1...    81   5e-15
AF263452-1|AAF79182.1|  113|Homo sapiens translational factor eI...    81   5e-15
AF064607-1|AAC17112.1|  113|Homo sapiens GC20 protein protein.         81   5e-15
L26247-1|AAA60602.1|  113|Homo sapiens sui1iso1 protein.               79   2e-14
CR457051-1|CAG33332.1|  113|Homo sapiens SUI1 protein.                 79   2e-14
BT006645-1|AAP35291.1|  113|Homo sapiens putative translation in...    79   2e-14
BC008710-1|AAH08710.1|  113|Homo sapiens eukaryotic translation ...    79   2e-14
BC005118-1|AAH05118.1|  113|Homo sapiens eukaryotic translation ...    79   2e-14
AJ012375-1|CAD66615.1|  113|Homo sapiens SUI1 protein protein.         79   2e-14
AF100737-1|AAD19900.1|  113|Homo sapiens putative translation in...    79   2e-14
AF083441-1|AAD52028.1|  113|Homo sapiens SUI1 isolog protein.          79   2e-14
AF490966-1|AAO11890.1|  138|Homo sapiens immunoglobulin lambda l...    30   6.9  

>CR542223-1|CAG47019.1|  113|Homo sapiens GC20 protein.
          Length = 113

 Score = 80.6 bits (190), Expect = 5e-15
 Identities = 34/43 (79%), Positives = 40/43 (93%)
 Frame = +3

Query: 339 GTVVEHPEYGEVLQLQGDQRENICQWLTKSGLVKPEQLKVHGF 467
           GTV+EHPEYGEV+QLQGDQR+NICQ+L + G+VK EQLKVHGF
Sbjct: 71  GTVIEHPEYGEVIQLQGDQRKNICQFLLEVGIVKEEQLKVHGF 113



 Score = 45.6 bits (103), Expect = 2e-04
 Identities = 21/40 (52%), Positives = 28/40 (70%), Gaps = 2/40 (5%)
 Frame = +2

Query: 143 SIQNLNTFDPFADAIKSSE--DDVQDGLVHVRIQQRNGRR 256
           +IQNL +FDPFADA K  +      +  +H+RIQQRNGR+
Sbjct: 3   TIQNLQSFDPFADATKGDDLLPAGTEDYIHIRIQQRNGRK 42



 Score = 44.4 bits (100), Expect = 4e-04
 Identities = 18/27 (66%), Positives = 24/27 (88%)
 Frame = +1

Query: 256 TLTTVQGLSSEYDLKKIVRACKKEFAC 336
           TLTTVQG++ +YD KK+V+A KK+FAC
Sbjct: 43  TLTTVQGIADDYDKKKLVKAFKKKFAC 69


>BC006996-1|AAH06996.1|  113|Homo sapiens eukaryotic translation
           initiation factor 1B protein.
          Length = 113

 Score = 80.6 bits (190), Expect = 5e-15
 Identities = 34/43 (79%), Positives = 40/43 (93%)
 Frame = +3

Query: 339 GTVVEHPEYGEVLQLQGDQRENICQWLTKSGLVKPEQLKVHGF 467
           GTV+EHPEYGEV+QLQGDQR+NICQ+L + G+VK EQLKVHGF
Sbjct: 71  GTVIEHPEYGEVIQLQGDQRKNICQFLLEVGIVKEEQLKVHGF 113



 Score = 45.6 bits (103), Expect = 2e-04
 Identities = 21/40 (52%), Positives = 28/40 (70%), Gaps = 2/40 (5%)
 Frame = +2

Query: 143 SIQNLNTFDPFADAIKSSE--DDVQDGLVHVRIQQRNGRR 256
           +IQNL +FDPFADA K  +      +  +H+RIQQRNGR+
Sbjct: 3   TIQNLQSFDPFADATKGDDLLPAGTEDYIHIRIQQRNGRK 42



 Score = 44.4 bits (100), Expect = 4e-04
 Identities = 18/27 (66%), Positives = 24/27 (88%)
 Frame = +1

Query: 256 TLTTVQGLSSEYDLKKIVRACKKEFAC 336
           TLTTVQG++ +YD KK+V+A KK+FAC
Sbjct: 43  TLTTVQGIADDYDKKKLVKAFKKKFAC 69


>AK223448-1|BAD97168.1|  113|Homo sapiens translation factor sui1
           homolog protein.
          Length = 113

 Score = 80.6 bits (190), Expect = 5e-15
 Identities = 34/43 (79%), Positives = 40/43 (93%)
 Frame = +3

Query: 339 GTVVEHPEYGEVLQLQGDQRENICQWLTKSGLVKPEQLKVHGF 467
           GTV+EHPEYGEV+QLQGDQR+NICQ+L + G+VK EQLKVHGF
Sbjct: 71  GTVIEHPEYGEVIQLQGDQRKNICQFLLEVGIVKEEQLKVHGF 113



 Score = 45.6 bits (103), Expect = 2e-04
 Identities = 21/40 (52%), Positives = 28/40 (70%), Gaps = 2/40 (5%)
 Frame = +2

Query: 143 SIQNLNTFDPFADAIKSSE--DDVQDGLVHVRIQQRNGRR 256
           +IQNL +FDPFADA K  +      +  +H+RIQQRNGR+
Sbjct: 3   TIQNLQSFDPFADATKGDDLLPAGTEDYIHIRIQQRNGRK 42



 Score = 42.7 bits (96), Expect = 0.001
 Identities = 17/27 (62%), Positives = 24/27 (88%)
 Frame = +1

Query: 256 TLTTVQGLSSEYDLKKIVRACKKEFAC 336
           TLTTVQG++ +YD +K+V+A KK+FAC
Sbjct: 43  TLTTVQGIADDYDKEKLVKAFKKKFAC 69


>AF263452-1|AAF79182.1|  113|Homo sapiens translational factor eIF-1
           protein.
          Length = 113

 Score = 80.6 bits (190), Expect = 5e-15
 Identities = 34/43 (79%), Positives = 40/43 (93%)
 Frame = +3

Query: 339 GTVVEHPEYGEVLQLQGDQRENICQWLTKSGLVKPEQLKVHGF 467
           GTV+EHPEYGEV+QLQGDQR+NICQ+L + G+VK EQLKVHGF
Sbjct: 71  GTVIEHPEYGEVIQLQGDQRKNICQFLLEVGIVKEEQLKVHGF 113



 Score = 45.6 bits (103), Expect = 2e-04
 Identities = 21/40 (52%), Positives = 28/40 (70%), Gaps = 2/40 (5%)
 Frame = +2

Query: 143 SIQNLNTFDPFADAIKSSE--DDVQDGLVHVRIQQRNGRR 256
           +IQNL +FDPFADA K  +      +  +H+RIQQRNGR+
Sbjct: 3   TIQNLQSFDPFADATKGDDLLPAGTEDYIHIRIQQRNGRK 42



 Score = 44.4 bits (100), Expect = 4e-04
 Identities = 18/27 (66%), Positives = 24/27 (88%)
 Frame = +1

Query: 256 TLTTVQGLSSEYDLKKIVRACKKEFAC 336
           TLTTVQG++ +YD KK+V+A KK+FAC
Sbjct: 43  TLTTVQGIADDYDKKKLVKAFKKKFAC 69


>AF064607-1|AAC17112.1|  113|Homo sapiens GC20 protein protein.
          Length = 113

 Score = 80.6 bits (190), Expect = 5e-15
 Identities = 34/43 (79%), Positives = 40/43 (93%)
 Frame = +3

Query: 339 GTVVEHPEYGEVLQLQGDQRENICQWLTKSGLVKPEQLKVHGF 467
           GTV+EHPEYGEV+QLQGDQR+NICQ+L + G+VK EQLKVHGF
Sbjct: 71  GTVIEHPEYGEVIQLQGDQRKNICQFLLEVGIVKEEQLKVHGF 113



 Score = 44.4 bits (100), Expect = 4e-04
 Identities = 23/39 (58%), Positives = 29/39 (74%), Gaps = 3/39 (7%)
 Frame = +2

Query: 143 SIQNLNTFDPFADAIKSSEDDVQDGL---VHVRIQQRNG 250
           +IQNL +FDPFADA K  +D +  GL   +H+RIQQRNG
Sbjct: 3   TIQNLQSFDPFADATK-GDDLLPAGLEDYIHIRIQQRNG 40



 Score = 44.4 bits (100), Expect = 4e-04
 Identities = 18/27 (66%), Positives = 24/27 (88%)
 Frame = +1

Query: 256 TLTTVQGLSSEYDLKKIVRACKKEFAC 336
           TLTTVQG++ +YD KK+V+A KK+FAC
Sbjct: 43  TLTTVQGIADDYDKKKLVKAFKKKFAC 69


>L26247-1|AAA60602.1|  113|Homo sapiens sui1iso1 protein.
          Length = 113

 Score = 79.0 bits (186), Expect = 2e-14
 Identities = 33/43 (76%), Positives = 39/43 (90%)
 Frame = +3

Query: 339 GTVVEHPEYGEVLQLQGDQRENICQWLTKSGLVKPEQLKVHGF 467
           GTV+EHPEYGEV+QLQGDQR+NICQ+L + GL K +QLKVHGF
Sbjct: 71  GTVIEHPEYGEVIQLQGDQRKNICQFLVEIGLAKDDQLKVHGF 113



 Score = 45.6 bits (103), Expect = 2e-04
 Identities = 21/40 (52%), Positives = 29/40 (72%), Gaps = 2/40 (5%)
 Frame = +2

Query: 143 SIQNLNTFDPFADAIKSSE--DDVQDGLVHVRIQQRNGRR 256
           +IQNL++FDPFADA K  +      +  +H+RIQQRNGR+
Sbjct: 3   AIQNLHSFDPFADASKGDDLLPAGTEDYIHIRIQQRNGRK 42



 Score = 44.4 bits (100), Expect = 4e-04
 Identities = 18/27 (66%), Positives = 24/27 (88%)
 Frame = +1

Query: 256 TLTTVQGLSSEYDLKKIVRACKKEFAC 336
           TLTTVQG++ +YD KK+V+A KK+FAC
Sbjct: 43  TLTTVQGIADDYDKKKLVKAFKKKFAC 69


>CR457051-1|CAG33332.1|  113|Homo sapiens SUI1 protein.
          Length = 113

 Score = 79.0 bits (186), Expect = 2e-14
 Identities = 33/43 (76%), Positives = 39/43 (90%)
 Frame = +3

Query: 339 GTVVEHPEYGEVLQLQGDQRENICQWLTKSGLVKPEQLKVHGF 467
           GTV+EHPEYGEV+QLQGDQR+NICQ+L + GL K +QLKVHGF
Sbjct: 71  GTVIEHPEYGEVIQLQGDQRKNICQFLVEIGLAKDDQLKVHGF 113



 Score = 45.6 bits (103), Expect = 2e-04
 Identities = 21/40 (52%), Positives = 29/40 (72%), Gaps = 2/40 (5%)
 Frame = +2

Query: 143 SIQNLNTFDPFADAIKSSE--DDVQDGLVHVRIQQRNGRR 256
           +IQNL++FDPFADA K  +      +  +H+RIQQRNGR+
Sbjct: 3   AIQNLHSFDPFADASKGDDLLPAGTEDYIHIRIQQRNGRK 42



 Score = 44.4 bits (100), Expect = 4e-04
 Identities = 18/27 (66%), Positives = 24/27 (88%)
 Frame = +1

Query: 256 TLTTVQGLSSEYDLKKIVRACKKEFAC 336
           TLTTVQG++ +YD KK+V+A KK+FAC
Sbjct: 43  TLTTVQGIADDYDKKKLVKAFKKKFAC 69


>BT006645-1|AAP35291.1|  113|Homo sapiens putative translation
           initiation factor protein.
          Length = 113

 Score = 79.0 bits (186), Expect = 2e-14
 Identities = 33/43 (76%), Positives = 39/43 (90%)
 Frame = +3

Query: 339 GTVVEHPEYGEVLQLQGDQRENICQWLTKSGLVKPEQLKVHGF 467
           GTV+EHPEYGEV+QLQGDQR+NICQ+L + GL K +QLKVHGF
Sbjct: 71  GTVIEHPEYGEVIQLQGDQRKNICQFLVEIGLAKDDQLKVHGF 113



 Score = 45.6 bits (103), Expect = 2e-04
 Identities = 21/40 (52%), Positives = 29/40 (72%), Gaps = 2/40 (5%)
 Frame = +2

Query: 143 SIQNLNTFDPFADAIKSSE--DDVQDGLVHVRIQQRNGRR 256
           +IQNL++FDPFADA K  +      +  +H+RIQQRNGR+
Sbjct: 3   AIQNLHSFDPFADASKGDDLLPAGTEDYIHIRIQQRNGRK 42



 Score = 44.4 bits (100), Expect = 4e-04
 Identities = 18/27 (66%), Positives = 24/27 (88%)
 Frame = +1

Query: 256 TLTTVQGLSSEYDLKKIVRACKKEFAC 336
           TLTTVQG++ +YD KK+V+A KK+FAC
Sbjct: 43  TLTTVQGIADDYDKKKLVKAFKKKFAC 69


>BC008710-1|AAH08710.1|  113|Homo sapiens eukaryotic translation
           initiation factor 1 protein.
          Length = 113

 Score = 79.0 bits (186), Expect = 2e-14
 Identities = 33/43 (76%), Positives = 39/43 (90%)
 Frame = +3

Query: 339 GTVVEHPEYGEVLQLQGDQRENICQWLTKSGLVKPEQLKVHGF 467
           GTV+EHPEYGEV+QLQGDQR+NICQ+L + GL K +QLKVHGF
Sbjct: 71  GTVIEHPEYGEVIQLQGDQRKNICQFLVEIGLAKDDQLKVHGF 113



 Score = 45.6 bits (103), Expect = 2e-04
 Identities = 21/40 (52%), Positives = 29/40 (72%), Gaps = 2/40 (5%)
 Frame = +2

Query: 143 SIQNLNTFDPFADAIKSSE--DDVQDGLVHVRIQQRNGRR 256
           +IQNL++FDPFADA K  +      +  +H+RIQQRNGR+
Sbjct: 3   AIQNLHSFDPFADASKGDDLLPAGTEDYIHIRIQQRNGRK 42



 Score = 44.4 bits (100), Expect = 4e-04
 Identities = 18/27 (66%), Positives = 24/27 (88%)
 Frame = +1

Query: 256 TLTTVQGLSSEYDLKKIVRACKKEFAC 336
           TLTTVQG++ +YD KK+V+A KK+FAC
Sbjct: 43  TLTTVQGIADDYDKKKLVKAFKKKFAC 69


>BC005118-1|AAH05118.1|  113|Homo sapiens eukaryotic translation
           initiation factor 1 protein.
          Length = 113

 Score = 79.0 bits (186), Expect = 2e-14
 Identities = 33/43 (76%), Positives = 39/43 (90%)
 Frame = +3

Query: 339 GTVVEHPEYGEVLQLQGDQRENICQWLTKSGLVKPEQLKVHGF 467
           GTV+EHPEYGEV+QLQGDQR+NICQ+L + GL K +QLKVHGF
Sbjct: 71  GTVIEHPEYGEVIQLQGDQRKNICQFLVEIGLAKDDQLKVHGF 113



 Score = 45.6 bits (103), Expect = 2e-04
 Identities = 21/40 (52%), Positives = 29/40 (72%), Gaps = 2/40 (5%)
 Frame = +2

Query: 143 SIQNLNTFDPFADAIKSSE--DDVQDGLVHVRIQQRNGRR 256
           +IQNL++FDPFADA K  +      +  +H+RIQQRNGR+
Sbjct: 3   AIQNLHSFDPFADASKGDDLLPAGTEDYIHIRIQQRNGRK 42



 Score = 44.4 bits (100), Expect = 4e-04
 Identities = 18/27 (66%), Positives = 24/27 (88%)
 Frame = +1

Query: 256 TLTTVQGLSSEYDLKKIVRACKKEFAC 336
           TLTTVQG++ +YD KK+V+A KK+FAC
Sbjct: 43  TLTTVQGIADDYDKKKLVKAFKKKFAC 69


>AJ012375-1|CAD66615.1|  113|Homo sapiens SUI1 protein protein.
          Length = 113

 Score = 79.0 bits (186), Expect = 2e-14
 Identities = 33/43 (76%), Positives = 39/43 (90%)
 Frame = +3

Query: 339 GTVVEHPEYGEVLQLQGDQRENICQWLTKSGLVKPEQLKVHGF 467
           GTV+EHPEYGEV+QLQGDQR+NICQ+L + GL K +QLKVHGF
Sbjct: 71  GTVIEHPEYGEVIQLQGDQRKNICQFLVEIGLAKDDQLKVHGF 113



 Score = 45.6 bits (103), Expect = 2e-04
 Identities = 21/40 (52%), Positives = 29/40 (72%), Gaps = 2/40 (5%)
 Frame = +2

Query: 143 SIQNLNTFDPFADAIKSSE--DDVQDGLVHVRIQQRNGRR 256
           +IQNL++FDPFADA K  +      +  +H+RIQQRNGR+
Sbjct: 3   AIQNLHSFDPFADASKGDDLLPAGTEDYIHIRIQQRNGRK 42



 Score = 44.4 bits (100), Expect = 4e-04
 Identities = 18/27 (66%), Positives = 24/27 (88%)
 Frame = +1

Query: 256 TLTTVQGLSSEYDLKKIVRACKKEFAC 336
           TLTTVQG++ +YD KK+V+A KK+FAC
Sbjct: 43  TLTTVQGIADDYDKKKLVKAFKKKFAC 69


>AF100737-1|AAD19900.1|  113|Homo sapiens putative translation
           initiation factor A121/Sui1 protein.
          Length = 113

 Score = 79.0 bits (186), Expect = 2e-14
 Identities = 33/43 (76%), Positives = 39/43 (90%)
 Frame = +3

Query: 339 GTVVEHPEYGEVLQLQGDQRENICQWLTKSGLVKPEQLKVHGF 467
           GTV+EHPEYGEV+QLQGDQR+NICQ+L + GL K +QLKVHGF
Sbjct: 71  GTVIEHPEYGEVIQLQGDQRKNICQFLVEIGLAKDDQLKVHGF 113



 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 22/40 (55%), Positives = 29/40 (72%), Gaps = 2/40 (5%)
 Frame = +2

Query: 143 SIQNLNTFDPFADAIKSSE--DDVQDGLVHVRIQQRNGRR 256
           +IQNL++FDPFADA K  +      +  VH+RIQQRNGR+
Sbjct: 3   AIQNLHSFDPFADASKGDDLLPAGTEDYVHIRIQQRNGRK 42



 Score = 42.3 bits (95), Expect = 0.002
 Identities = 17/27 (62%), Positives = 23/27 (85%)
 Frame = +1

Query: 256 TLTTVQGLSSEYDLKKIVRACKKEFAC 336
           TLTTVQG++ +YD KK+V+  KK+FAC
Sbjct: 43  TLTTVQGIADDYDKKKLVKPFKKKFAC 69


>AF083441-1|AAD52028.1|  113|Homo sapiens SUI1 isolog protein.
          Length = 113

 Score = 79.0 bits (186), Expect = 2e-14
 Identities = 33/43 (76%), Positives = 39/43 (90%)
 Frame = +3

Query: 339 GTVVEHPEYGEVLQLQGDQRENICQWLTKSGLVKPEQLKVHGF 467
           GTV+EHPEYGEV+QLQGDQR+NICQ+L + GL K +QLKVHGF
Sbjct: 71  GTVIEHPEYGEVIQLQGDQRKNICQFLVEIGLAKDDQLKVHGF 113



 Score = 45.6 bits (103), Expect = 2e-04
 Identities = 21/40 (52%), Positives = 29/40 (72%), Gaps = 2/40 (5%)
 Frame = +2

Query: 143 SIQNLNTFDPFADAIKSSE--DDVQDGLVHVRIQQRNGRR 256
           +IQNL++FDPFADA K  +      +  +H+RIQQRNGR+
Sbjct: 3   AIQNLHSFDPFADASKGDDLLPAGTEDYIHIRIQQRNGRK 42



 Score = 44.4 bits (100), Expect = 4e-04
 Identities = 18/27 (66%), Positives = 24/27 (88%)
 Frame = +1

Query: 256 TLTTVQGLSSEYDLKKIVRACKKEFAC 336
           TLTTVQG++ +YD KK+V+A KK+FAC
Sbjct: 43  TLTTVQGIADDYDKKKLVKAFKKKFAC 69


>AF490966-1|AAO11890.1|  138|Homo sapiens immunoglobulin lambda
           light chain variable region protein.
          Length = 138

 Score = 30.3 bits (65), Expect = 6.9
 Identities = 17/49 (34%), Positives = 23/49 (46%)
 Frame = -2

Query: 412 WQIFSRWSP*SCSTSPYSGCSTTVPCTRTPSCMPARSSSGHIPRKGLAP 266
           W  F    P S S SP  G + T+PCTR+   + +     +  R G AP
Sbjct: 11  WASFMLTQPHSVSESP--GKTVTIPCTRSSGSIASNFVQWYQQRPGSAP 57


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 96,572,815
Number of Sequences: 237096
Number of extensions: 1936961
Number of successful extensions: 4850
Number of sequences better than 10.0: 14
Number of HSP's better than 10.0 without gapping: 4484
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4827
length of database: 76,859,062
effective HSP length: 88
effective length of database: 55,994,614
effective search space used: 8063224416
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -