SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20078
         (633 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Y08890-1|CAA70103.1| 1097|Homo sapiens Ran_GTP binding protein 5...    87   4e-17
BC045640-1|AAH45640.1| 1115|Homo sapiens RAN binding protein 5 p...    87   4e-17
BC019309-1|AAH19309.1| 1097|Homo sapiens RANBP5 protein protein.       87   4e-17
BC001497-1|AAH01497.1| 1097|Homo sapiens RANBP5 protein protein.       87   4e-17
AL356580-2|CAI13757.1| 1097|Homo sapiens RAN binding protein 5 p...    87   4e-17
AL137120-1|CAI16520.1| 1097|Homo sapiens RAN binding protein 5 p...    87   4e-17
U72761-1|AAC51317.1| 1097|Homo sapiens karyopherin beta 3 protein.     87   5e-17
AL356580-4|CAI13759.1|  126|Homo sapiens RAN binding protein 5 p...    80   6e-15
BX537405-1|CAD97647.1| 1109|Homo sapiens hypothetical protein pr...    64   4e-10
BC098406-1|AAH98406.1| 1105|Homo sapiens RAN binding protein 6 p...    64   4e-10
AL162384-1|CAI12713.1| 1105|Homo sapiens RAN binding protein 6 p...    64   4e-10
AF039023-1|AAC14260.1| 1105|Homo sapiens Ran-GTP binding protein...    64   4e-10
AL356580-3|CAI13758.1|   76|Homo sapiens RAN binding protein 5 p...    31   2.6  
BC132812-1|AAI32813.1| 1198|Homo sapiens FNDC3A protein protein.       30   5.9  
BC070072-1|AAH70072.1|  853|Homo sapiens FNDC3A protein protein.       30   5.9  
BC060816-1|AAH60816.1|  853|Homo sapiens FNDC3A protein protein.       30   5.9  
AL137000-1|CAI39726.2| 1142|Homo sapiens fibronectin type III do...    30   5.9  
AJ749707-1|CAG44603.1| 1134|Homo sapiens human gene expressed in...    30   5.9  
AJ749706-1|CAG44602.1| 1198|Homo sapiens human gene expressed in...    30   5.9  
AB023187-1|BAA76814.2| 1151|Homo sapiens KIAA0970 protein protein.     30   5.9  
X55313-1|CAA39021.1|  455|Homo sapiens tumor necrosis factor rec...    30   7.8  
M75866-1|AAA61201.1|  455|Homo sapiens tumor necrosis factor rec...    30   7.8  
M63121-1|AAA36754.1|  455|Homo sapiens tumor necrosis factor rec...    30   7.8  
M60275-1|AAA36756.1|  453|Homo sapiens TNF receptor protein.           30   7.8  
M58286-1|AAA36753.1|  455|Homo sapiens tumor necrosis factor rec...    30   7.8  
M33294-1|AAA03210.1|  455|Homo sapiens protein ( Human tumor nec...    30   7.8  
BC010140-1|AAH10140.1|  455|Homo sapiens tumor necrosis factor r...    30   7.8  
AY131997-1|AAM77802.1|  455|Homo sapiens tumor necrosis factor r...    30   7.8  

>Y08890-1|CAA70103.1| 1097|Homo sapiens Ran_GTP binding protein 5
           protein.
          Length = 1097

 Score = 87.4 bits (207), Expect = 4e-17
 Identities = 40/82 (48%), Positives = 54/82 (65%)
 Frame = +1

Query: 10  IQNADIAEDVRQTAAVLLRRLFSAXXXXXXXXXXXXQQTVLREQLLLTLQMDLSQYLRRK 189
           I+N   AE+ RQ AAVLLRRL S+             QT ++ +LL+ +QM+    +R+K
Sbjct: 49  IRNTTAAEEARQMAAVLLRRLLSSAFDEVYPALPSDVQTAIKSELLMIIQMETQSSMRKK 108

Query: 190 VCDVVSELARNHIDDDGNNQWP 255
           VCD+ +ELARN ID+DGNNQWP
Sbjct: 109 VCDIAAELARNLIDEDGNNQWP 130



 Score = 75.8 bits (178), Expect = 1e-13
 Identities = 34/84 (40%), Positives = 54/84 (64%)
 Frame = +3

Query: 255 EFLQFMFTCASAQDPNIKEAGIRMFTSVPGVFGNRQTENLDVIKGMLISALQPNESMALR 434
           E L+F+F   S+Q+  ++EA + +F + PG+FGN+Q   LDVIK ML+  +Q  E  ++R
Sbjct: 131 EGLKFLFDSVSSQNVGLREAALHIFWNFPGIFGNQQQHYLDVIKRMLVQCMQDQEHPSIR 190

Query: 435 TQAVKAVGAFILLHDKEPIIQKHF 506
           T + +A  AFIL ++    + KHF
Sbjct: 191 TLSARATAAFILANEHNVALFKHF 214


>BC045640-1|AAH45640.1| 1115|Homo sapiens RAN binding protein 5
           protein.
          Length = 1115

 Score = 87.4 bits (207), Expect = 4e-17
 Identities = 40/82 (48%), Positives = 54/82 (65%)
 Frame = +1

Query: 10  IQNADIAEDVRQTAAVLLRRLFSAXXXXXXXXXXXXQQTVLREQLLLTLQMDLSQYLRRK 189
           I+N   AE+ RQ AAVLLRRL S+             QT ++ +LL+ +QM+    +R+K
Sbjct: 67  IRNTTAAEEARQMAAVLLRRLLSSAFDEVYPALPSDVQTAIKSELLMIIQMETQSSMRKK 126

Query: 190 VCDVVSELARNHIDDDGNNQWP 255
           VCD+ +ELARN ID+DGNNQWP
Sbjct: 127 VCDIAAELARNLIDEDGNNQWP 148



 Score = 75.8 bits (178), Expect = 1e-13
 Identities = 34/84 (40%), Positives = 54/84 (64%)
 Frame = +3

Query: 255 EFLQFMFTCASAQDPNIKEAGIRMFTSVPGVFGNRQTENLDVIKGMLISALQPNESMALR 434
           E L+F+F   S+Q+  ++EA + +F + PG+FGN+Q   LDVIK ML+  +Q  E  ++R
Sbjct: 149 EGLKFLFDSVSSQNVGLREAALHIFWNFPGIFGNQQQHYLDVIKRMLVQCMQDQEHPSIR 208

Query: 435 TQAVKAVGAFILLHDKEPIIQKHF 506
           T + +A  AFIL ++    + KHF
Sbjct: 209 TLSARATAAFILANEHNVALFKHF 232


>BC019309-1|AAH19309.1| 1097|Homo sapiens RANBP5 protein protein.
          Length = 1097

 Score = 87.4 bits (207), Expect = 4e-17
 Identities = 40/82 (48%), Positives = 54/82 (65%)
 Frame = +1

Query: 10  IQNADIAEDVRQTAAVLLRRLFSAXXXXXXXXXXXXQQTVLREQLLLTLQMDLSQYLRRK 189
           I+N   AE+ RQ AAVLLRRL S+             QT ++ +LL+ +QM+    +R+K
Sbjct: 49  IRNTTAAEEARQMAAVLLRRLLSSAFDEVYPALPSDVQTAIKSELLMIIQMETQSSMRKK 108

Query: 190 VCDVVSELARNHIDDDGNNQWP 255
           VCD+ +ELARN ID+DGNNQWP
Sbjct: 109 VCDIAAELARNLIDEDGNNQWP 130



 Score = 75.8 bits (178), Expect = 1e-13
 Identities = 34/84 (40%), Positives = 54/84 (64%)
 Frame = +3

Query: 255 EFLQFMFTCASAQDPNIKEAGIRMFTSVPGVFGNRQTENLDVIKGMLISALQPNESMALR 434
           E L+F+F   S+Q+  ++EA + +F + PG+FGN+Q   LDVIK ML+  +Q  E  ++R
Sbjct: 131 EGLKFLFDSVSSQNVGLREAALHIFWNFPGIFGNQQQHYLDVIKRMLVQCMQDQEHPSIR 190

Query: 435 TQAVKAVGAFILLHDKEPIIQKHF 506
           T + +A  AFIL ++    + KHF
Sbjct: 191 TLSARATAAFILANEHNVALFKHF 214


>BC001497-1|AAH01497.1| 1097|Homo sapiens RANBP5 protein protein.
          Length = 1097

 Score = 87.4 bits (207), Expect = 4e-17
 Identities = 40/82 (48%), Positives = 54/82 (65%)
 Frame = +1

Query: 10  IQNADIAEDVRQTAAVLLRRLFSAXXXXXXXXXXXXQQTVLREQLLLTLQMDLSQYLRRK 189
           I+N   AE+ RQ AAVLLRRL S+             QT ++ +LL+ +QM+    +R+K
Sbjct: 49  IRNTTAAEEARQMAAVLLRRLLSSAFDEVYPALPSDVQTAIKSELLMIIQMETQSSMRKK 108

Query: 190 VCDVVSELARNHIDDDGNNQWP 255
           VCD+ +ELARN ID+DGNNQWP
Sbjct: 109 VCDIAAELARNLIDEDGNNQWP 130



 Score = 75.8 bits (178), Expect = 1e-13
 Identities = 34/84 (40%), Positives = 54/84 (64%)
 Frame = +3

Query: 255 EFLQFMFTCASAQDPNIKEAGIRMFTSVPGVFGNRQTENLDVIKGMLISALQPNESMALR 434
           E L+F+F   S+Q+  ++EA + +F + PG+FGN+Q   LDVIK ML+  +Q  E  ++R
Sbjct: 131 EGLKFLFDSVSSQNVGLREAALHIFWNFPGIFGNQQQHYLDVIKRMLVQCMQDQEHPSIR 190

Query: 435 TQAVKAVGAFILLHDKEPIIQKHF 506
           T + +A  AFIL ++    + KHF
Sbjct: 191 TLSARATAAFILANEHNVALFKHF 214


>AL356580-2|CAI13757.1| 1097|Homo sapiens RAN binding protein 5
           protein.
          Length = 1097

 Score = 87.4 bits (207), Expect = 4e-17
 Identities = 40/82 (48%), Positives = 54/82 (65%)
 Frame = +1

Query: 10  IQNADIAEDVRQTAAVLLRRLFSAXXXXXXXXXXXXQQTVLREQLLLTLQMDLSQYLRRK 189
           I+N   AE+ RQ AAVLLRRL S+             QT ++ +LL+ +QM+    +R+K
Sbjct: 49  IRNTTAAEEARQMAAVLLRRLLSSAFDEVYPALPSDVQTAIKSELLMIIQMETQSSMRKK 108

Query: 190 VCDVVSELARNHIDDDGNNQWP 255
           VCD+ +ELARN ID+DGNNQWP
Sbjct: 109 VCDIAAELARNLIDEDGNNQWP 130



 Score = 75.8 bits (178), Expect = 1e-13
 Identities = 34/84 (40%), Positives = 54/84 (64%)
 Frame = +3

Query: 255 EFLQFMFTCASAQDPNIKEAGIRMFTSVPGVFGNRQTENLDVIKGMLISALQPNESMALR 434
           E L+F+F   S+Q+  ++EA + +F + PG+FGN+Q   LDVIK ML+  +Q  E  ++R
Sbjct: 131 EGLKFLFDSVSSQNVGLREAALHIFWNFPGIFGNQQQHYLDVIKRMLVQCMQDQEHPSIR 190

Query: 435 TQAVKAVGAFILLHDKEPIIQKHF 506
           T + +A  AFIL ++    + KHF
Sbjct: 191 TLSARATAAFILANEHNVALFKHF 214


>AL137120-1|CAI16520.1| 1097|Homo sapiens RAN binding protein 5
           protein.
          Length = 1097

 Score = 87.4 bits (207), Expect = 4e-17
 Identities = 40/82 (48%), Positives = 54/82 (65%)
 Frame = +1

Query: 10  IQNADIAEDVRQTAAVLLRRLFSAXXXXXXXXXXXXQQTVLREQLLLTLQMDLSQYLRRK 189
           I+N   AE+ RQ AAVLLRRL S+             QT ++ +LL+ +QM+    +R+K
Sbjct: 49  IRNTTAAEEARQMAAVLLRRLLSSAFDEVYPALPSDVQTAIKSELLMIIQMETQSSMRKK 108

Query: 190 VCDVVSELARNHIDDDGNNQWP 255
           VCD+ +ELARN ID+DGNNQWP
Sbjct: 109 VCDIAAELARNLIDEDGNNQWP 130



 Score = 75.8 bits (178), Expect = 1e-13
 Identities = 34/84 (40%), Positives = 54/84 (64%)
 Frame = +3

Query: 255 EFLQFMFTCASAQDPNIKEAGIRMFTSVPGVFGNRQTENLDVIKGMLISALQPNESMALR 434
           E L+F+F   S+Q+  ++EA + +F + PG+FGN+Q   LDVIK ML+  +Q  E  ++R
Sbjct: 131 EGLKFLFDSVSSQNVGLREAALHIFWNFPGIFGNQQQHYLDVIKRMLVQCMQDQEHPSIR 190

Query: 435 TQAVKAVGAFILLHDKEPIIQKHF 506
           T + +A  AFIL ++    + KHF
Sbjct: 191 TLSARATAAFILANEHNVALFKHF 214


>U72761-1|AAC51317.1| 1097|Homo sapiens karyopherin beta 3 protein.
          Length = 1097

 Score = 87.0 bits (206), Expect = 5e-17
 Identities = 40/82 (48%), Positives = 54/82 (65%)
 Frame = +1

Query: 10  IQNADIAEDVRQTAAVLLRRLFSAXXXXXXXXXXXXQQTVLREQLLLTLQMDLSQYLRRK 189
           I+N   AE+ RQ AAVLLRRL S+             QT ++ +LL+ +QM+    +R+K
Sbjct: 49  IRNTTAAEEARQMAAVLLRRLLSSAFDEVYPALPSDVQTAIKSELLMIIQMETQXSMRKK 108

Query: 190 VCDVVSELARNHIDDDGNNQWP 255
           VCD+ +ELARN ID+DGNNQWP
Sbjct: 109 VCDIAAELARNLIDEDGNNQWP 130



 Score = 75.8 bits (178), Expect = 1e-13
 Identities = 34/84 (40%), Positives = 54/84 (64%)
 Frame = +3

Query: 255 EFLQFMFTCASAQDPNIKEAGIRMFTSVPGVFGNRQTENLDVIKGMLISALQPNESMALR 434
           E L+F+F   S+Q+  ++EA + +F + PG+FGN+Q   LDVIK ML+  +Q  E  ++R
Sbjct: 131 EGLKFLFDSVSSQNVGLREAALHIFWNFPGIFGNQQQHYLDVIKRMLVQCMQDQEHPSIR 190

Query: 435 TQAVKAVGAFILLHDKEPIIQKHF 506
           T + +A  AFIL ++    + KHF
Sbjct: 191 TLSARATAAFILANEHNVALFKHF 214


>AL356580-4|CAI13759.1|  126|Homo sapiens RAN binding protein 5
           protein.
          Length = 126

 Score = 80.2 bits (189), Expect = 6e-15
 Identities = 36/74 (48%), Positives = 49/74 (66%)
 Frame = +1

Query: 34  DVRQTAAVLLRRLFSAXXXXXXXXXXXXQQTVLREQLLLTLQMDLSQYLRRKVCDVVSEL 213
           + RQ AAVLLRRL S+             QT ++ +LL+ +QM+    +R+KVCD+ +EL
Sbjct: 28  EARQMAAVLLRRLLSSAFDEVYPALPSDVQTAIKSELLMIIQMETQSSMRKKVCDIAAEL 87

Query: 214 ARNHIDDDGNNQWP 255
           ARN ID+DGNNQWP
Sbjct: 88  ARNLIDEDGNNQWP 101


>BX537405-1|CAD97647.1| 1109|Homo sapiens hypothetical protein
           protein.
          Length = 1109

 Score = 64.1 bits (149), Expect = 4e-10
 Identities = 30/82 (36%), Positives = 48/82 (58%)
 Frame = +1

Query: 10  IQNADIAEDVRQTAAVLLRRLFSAXXXXXXXXXXXXQQTVLREQLLLTLQMDLSQYLRRK 189
           ++N     +VRQ AA LLRRL S+             Q  ++ +L+L ++++    +R+K
Sbjct: 61  VRNRRAGYEVRQMAAALLRRLLSSGFEEVYPNLPADVQRDVKIELILAVKLETHASMRKK 120

Query: 190 VCDVVSELARNHIDDDGNNQWP 255
           +CD+ + LARN ID+DG N WP
Sbjct: 121 LCDIFAVLARNLIDEDGTNHWP 142



 Score = 54.0 bits (124), Expect = 4e-07
 Identities = 25/84 (29%), Positives = 47/84 (55%)
 Frame = +3

Query: 255 EFLQFMFTCASAQDPNIKEAGIRMFTSVPGVFGNRQTENLDVIKGMLISALQPNESMALR 434
           E L+F+     +++  + E  + +F   PG+FG ++  +LD+IK +L   +Q  E  A+R
Sbjct: 143 EGLKFLIDSIYSKNVVLWEVALHVFWHFPGIFGTQERHDLDIIKRLLDQCIQDQEHPAIR 202

Query: 435 TQAVKAVGAFILLHDKEPIIQKHF 506
           T + +A  AF+L ++    + K F
Sbjct: 203 TLSARAAAAFVLANENNIALFKDF 226


>BC098406-1|AAH98406.1| 1105|Homo sapiens RAN binding protein 6
           protein.
          Length = 1105

 Score = 64.1 bits (149), Expect = 4e-10
 Identities = 30/82 (36%), Positives = 48/82 (58%)
 Frame = +1

Query: 10  IQNADIAEDVRQTAAVLLRRLFSAXXXXXXXXXXXXQQTVLREQLLLTLQMDLSQYLRRK 189
           ++N     +VRQ AA LLRRL S+             Q  ++ +L+L ++++    +R+K
Sbjct: 57  VRNRRAGYEVRQMAAALLRRLLSSGFEEVYPNLPADVQRDVKIELILAVKLETHASMRKK 116

Query: 190 VCDVVSELARNHIDDDGNNQWP 255
           +CD+ + LARN ID+DG N WP
Sbjct: 117 LCDIFAVLARNLIDEDGTNHWP 138



 Score = 54.0 bits (124), Expect = 4e-07
 Identities = 25/84 (29%), Positives = 47/84 (55%)
 Frame = +3

Query: 255 EFLQFMFTCASAQDPNIKEAGIRMFTSVPGVFGNRQTENLDVIKGMLISALQPNESMALR 434
           E L+F+     +++  + E  + +F   PG+FG ++  +LD+IK +L   +Q  E  A+R
Sbjct: 139 EGLKFLIDSIYSKNVVLWEVALHVFWHFPGIFGTQERHDLDIIKRLLDQCIQDQEHPAIR 198

Query: 435 TQAVKAVGAFILLHDKEPIIQKHF 506
           T + +A  AF+L ++    + K F
Sbjct: 199 TLSARAAAAFVLANENNIALFKDF 222


>AL162384-1|CAI12713.1| 1105|Homo sapiens RAN binding protein 6
           protein.
          Length = 1105

 Score = 64.1 bits (149), Expect = 4e-10
 Identities = 30/82 (36%), Positives = 48/82 (58%)
 Frame = +1

Query: 10  IQNADIAEDVRQTAAVLLRRLFSAXXXXXXXXXXXXQQTVLREQLLLTLQMDLSQYLRRK 189
           ++N     +VRQ AA LLRRL S+             Q  ++ +L+L ++++    +R+K
Sbjct: 57  VRNRRAGYEVRQMAAALLRRLLSSGFEEVYPNLPADVQRDVKIELILAVKLETHASMRKK 116

Query: 190 VCDVVSELARNHIDDDGNNQWP 255
           +CD+ + LARN ID+DG N WP
Sbjct: 117 LCDIFAVLARNLIDEDGTNHWP 138



 Score = 54.0 bits (124), Expect = 4e-07
 Identities = 25/84 (29%), Positives = 47/84 (55%)
 Frame = +3

Query: 255 EFLQFMFTCASAQDPNIKEAGIRMFTSVPGVFGNRQTENLDVIKGMLISALQPNESMALR 434
           E L+F+     +++  + E  + +F   PG+FG ++  +LD+IK +L   +Q  E  A+R
Sbjct: 139 EGLKFLIDSIYSKNVVLWEVALHVFWHFPGIFGTQERHDLDIIKRLLDQCIQDQEHPAIR 198

Query: 435 TQAVKAVGAFILLHDKEPIIQKHF 506
           T + +A  AF+L ++    + K F
Sbjct: 199 TLSARAAAAFVLANENNIALFKDF 222


>AF039023-1|AAC14260.1| 1105|Homo sapiens Ran-GTP binding protein
           protein.
          Length = 1105

 Score = 64.1 bits (149), Expect = 4e-10
 Identities = 30/82 (36%), Positives = 48/82 (58%)
 Frame = +1

Query: 10  IQNADIAEDVRQTAAVLLRRLFSAXXXXXXXXXXXXQQTVLREQLLLTLQMDLSQYLRRK 189
           ++N     +VRQ AA LLRRL S+             Q  ++ +L+L ++++    +R+K
Sbjct: 57  VRNRRAGYEVRQMAAALLRRLLSSGFEEVYPNLPADVQRDVKIELILAVKLETHASMRKK 116

Query: 190 VCDVVSELARNHIDDDGNNQWP 255
           +CD+ + LARN ID+DG N WP
Sbjct: 117 LCDIFAVLARNLIDEDGTNHWP 138



 Score = 54.0 bits (124), Expect = 4e-07
 Identities = 25/84 (29%), Positives = 47/84 (55%)
 Frame = +3

Query: 255 EFLQFMFTCASAQDPNIKEAGIRMFTSVPGVFGNRQTENLDVIKGMLISALQPNESMALR 434
           E L+F+     +++  + E  + +F   PG+FG ++  +LD+IK +L   +Q  E  A+R
Sbjct: 139 EGLKFLIDSIYSKNVVLWEVALHVFWHFPGIFGTQERHDLDIIKRLLDQCIQDQEHPAIR 198

Query: 435 TQAVKAVGAFILLHDKEPIIQKHF 506
           T + +A  AF+L ++    + K F
Sbjct: 199 TLSARAAAAFVLANENNIALFKDF 222


>AL356580-3|CAI13758.1|   76|Homo sapiens RAN binding protein 5
           protein.
          Length = 76

 Score = 31.5 bits (68), Expect = 2.6
 Identities = 15/24 (62%), Positives = 18/24 (75%)
 Frame = +1

Query: 10  IQNADIAEDVRQTAAVLLRRLFSA 81
           I+N   AE+ RQ AAVLLRRL S+
Sbjct: 49  IRNTTAAEEARQMAAVLLRRLLSS 72


>BC132812-1|AAI32813.1| 1198|Homo sapiens FNDC3A protein protein.
          Length = 1198

 Score = 30.3 bits (65), Expect = 5.9
 Identities = 12/38 (31%), Positives = 25/38 (65%)
 Frame = +3

Query: 348  FGNRQTENLDVIKGMLISALQPNESMALRTQAVKAVGA 461
            FG++Q+  +  +   +I+ LQP+ +  +R QA+ ++GA
Sbjct: 899  FGDKQSLTVGKVTSYIINNLQPDTTYRIRIQALNSLGA 936


>BC070072-1|AAH70072.1|  853|Homo sapiens FNDC3A protein protein.
          Length = 853

 Score = 30.3 bits (65), Expect = 5.9
 Identities = 12/38 (31%), Positives = 25/38 (65%)
 Frame = +3

Query: 348 FGNRQTENLDVIKGMLISALQPNESMALRTQAVKAVGA 461
           FG++Q+  +  +   +I+ LQP+ +  +R QA+ ++GA
Sbjct: 554 FGDKQSLTVGKVTSYIINNLQPDTTYRIRIQALNSLGA 591


>BC060816-1|AAH60816.1|  853|Homo sapiens FNDC3A protein protein.
          Length = 853

 Score = 30.3 bits (65), Expect = 5.9
 Identities = 12/38 (31%), Positives = 25/38 (65%)
 Frame = +3

Query: 348 FGNRQTENLDVIKGMLISALQPNESMALRTQAVKAVGA 461
           FG++Q+  +  +   +I+ LQP+ +  +R QA+ ++GA
Sbjct: 554 FGDKQSLTVGKVTSYIINNLQPDTTYRIRIQALNSLGA 591


>AL137000-1|CAI39726.2| 1142|Homo sapiens fibronectin type III
           domain containing 3A protein.
          Length = 1142

 Score = 30.3 bits (65), Expect = 5.9
 Identities = 12/38 (31%), Positives = 25/38 (65%)
 Frame = +3

Query: 348 FGNRQTENLDVIKGMLISALQPNESMALRTQAVKAVGA 461
           FG++Q+  +  +   +I+ LQP+ +  +R QA+ ++GA
Sbjct: 843 FGDKQSLTVGKVTSYIINNLQPDTTYRIRIQALNSLGA 880


>AJ749707-1|CAG44603.1| 1134|Homo sapiens human gene expressed in
           odontoblast protein protein.
          Length = 1134

 Score = 30.3 bits (65), Expect = 5.9
 Identities = 12/38 (31%), Positives = 25/38 (65%)
 Frame = +3

Query: 348 FGNRQTENLDVIKGMLISALQPNESMALRTQAVKAVGA 461
           FG++Q+  +  +   +I+ LQP+ +  +R QA+ ++GA
Sbjct: 835 FGDKQSLTVGKVTSYIINNLQPDTTYRIRIQALNSLGA 872


>AJ749706-1|CAG44602.1| 1198|Homo sapiens human gene expressed in
            odontoblast protein protein.
          Length = 1198

 Score = 30.3 bits (65), Expect = 5.9
 Identities = 12/38 (31%), Positives = 25/38 (65%)
 Frame = +3

Query: 348  FGNRQTENLDVIKGMLISALQPNESMALRTQAVKAVGA 461
            FG++Q+  +  +   +I+ LQP+ +  +R QA+ ++GA
Sbjct: 899  FGDKQSLTVGKVTSYIINNLQPDTTYRIRIQALNSLGA 936


>AB023187-1|BAA76814.2| 1151|Homo sapiens KIAA0970 protein protein.
          Length = 1151

 Score = 30.3 bits (65), Expect = 5.9
 Identities = 12/38 (31%), Positives = 25/38 (65%)
 Frame = +3

Query: 348 FGNRQTENLDVIKGMLISALQPNESMALRTQAVKAVGA 461
           FG++Q+  +  +   +I+ LQP+ +  +R QA+ ++GA
Sbjct: 852 FGDKQSLTVGKVTSYIINNLQPDTTYRIRIQALNSLGA 889


>X55313-1|CAA39021.1|  455|Homo sapiens tumor necrosis factor
           receptor type 1 protein.
          Length = 455

 Score = 29.9 bits (64), Expect = 7.8
 Identities = 28/103 (27%), Positives = 44/103 (42%), Gaps = 11/103 (10%)
 Frame = -3

Query: 556 CFNRQNYYLHQR*KNILKCF----CMMGS--LSCSSIKAPTALTA*VRKAIDSFGCKADI 395
           C  R+N Y H   +N+ +CF    C+ G+  LSC   K  T  T      +    C +  
Sbjct: 125 CGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQE-KQNTVCTCHAGFFLRENECVSCS 183

Query: 394 N--MPFITSKFSV*RFPNTPGTD---VNILIPASLMFGSCALA 281
           N       +K  + +  N  GT+     +L+P  + FG C L+
Sbjct: 184 NCKKSLECTKLCLPQIENVKGTEDSGTTVLLPLVIFFGLCLLS 226


>M75866-1|AAA61201.1|  455|Homo sapiens tumor necrosis factor
           receptor 1 protein.
          Length = 455

 Score = 29.9 bits (64), Expect = 7.8
 Identities = 28/103 (27%), Positives = 44/103 (42%), Gaps = 11/103 (10%)
 Frame = -3

Query: 556 CFNRQNYYLHQR*KNILKCF----CMMGS--LSCSSIKAPTALTA*VRKAIDSFGCKADI 395
           C  R+N Y H   +N+ +CF    C+ G+  LSC   K  T  T      +    C +  
Sbjct: 125 CGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQE-KQNTVCTCHAGFFLRENECVSCS 183

Query: 394 N--MPFITSKFSV*RFPNTPGTD---VNILIPASLMFGSCALA 281
           N       +K  + +  N  GT+     +L+P  + FG C L+
Sbjct: 184 NCKKSLECTKLCLPQIENVKGTEDSGTTVLLPLVIFFGLCLLS 226


>M63121-1|AAA36754.1|  455|Homo sapiens tumor necrosis factor
           receptor protein.
          Length = 455

 Score = 29.9 bits (64), Expect = 7.8
 Identities = 28/103 (27%), Positives = 44/103 (42%), Gaps = 11/103 (10%)
 Frame = -3

Query: 556 CFNRQNYYLHQR*KNILKCF----CMMGS--LSCSSIKAPTALTA*VRKAIDSFGCKADI 395
           C  R+N Y H   +N+ +CF    C+ G+  LSC   K  T  T      +    C +  
Sbjct: 125 CGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQE-KQNTVCTCHAGFFLRENECVSCS 183

Query: 394 N--MPFITSKFSV*RFPNTPGTD---VNILIPASLMFGSCALA 281
           N       +K  + +  N  GT+     +L+P  + FG C L+
Sbjct: 184 NCKKSLECTKLCLPQIENVKGTEDSGTTVLLPLVIFFGLCLLS 226


>M60275-1|AAA36756.1|  453|Homo sapiens TNF receptor protein.
          Length = 453

 Score = 29.9 bits (64), Expect = 7.8
 Identities = 28/103 (27%), Positives = 44/103 (42%), Gaps = 11/103 (10%)
 Frame = -3

Query: 556 CFNRQNYYLHQR*KNILKCF----CMMGS--LSCSSIKAPTALTA*VRKAIDSFGCKADI 395
           C  R+N Y H   +N+ +CF    C+ G+  LSC   K  T  T      +    C +  
Sbjct: 125 CGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQE-KQNTVCTCHAGFFLRENECVSCS 183

Query: 394 N--MPFITSKFSV*RFPNTPGTD---VNILIPASLMFGSCALA 281
           N       +K  + +  N  GT+     +L+P  + FG C L+
Sbjct: 184 NCKKSLECTKLCLPQIENVKGTEDSGTTVLLPLVIFFGLCLLS 226


>M58286-1|AAA36753.1|  455|Homo sapiens tumor necrosis factor
           receptor protein.
          Length = 455

 Score = 29.9 bits (64), Expect = 7.8
 Identities = 28/103 (27%), Positives = 44/103 (42%), Gaps = 11/103 (10%)
 Frame = -3

Query: 556 CFNRQNYYLHQR*KNILKCF----CMMGS--LSCSSIKAPTALTA*VRKAIDSFGCKADI 395
           C  R+N Y H   +N+ +CF    C+ G+  LSC   K  T  T      +    C +  
Sbjct: 125 CGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQE-KQNTVCTCHAGFFLRENECVSCS 183

Query: 394 N--MPFITSKFSV*RFPNTPGTD---VNILIPASLMFGSCALA 281
           N       +K  + +  N  GT+     +L+P  + FG C L+
Sbjct: 184 NCKKSLECTKLCLPQIENVKGTEDSGTTVLLPLVIFFGLCLLS 226


>M33294-1|AAA03210.1|  455|Homo sapiens protein ( Human tumor
           necrosis factor receptor mRNA, complete cds. ).
          Length = 455

 Score = 29.9 bits (64), Expect = 7.8
 Identities = 28/103 (27%), Positives = 44/103 (42%), Gaps = 11/103 (10%)
 Frame = -3

Query: 556 CFNRQNYYLHQR*KNILKCF----CMMGS--LSCSSIKAPTALTA*VRKAIDSFGCKADI 395
           C  R+N Y H   +N+ +CF    C+ G+  LSC   K  T  T      +    C +  
Sbjct: 125 CGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQE-KQNTVCTCHAGFFLRENECVSCS 183

Query: 394 N--MPFITSKFSV*RFPNTPGTD---VNILIPASLMFGSCALA 281
           N       +K  + +  N  GT+     +L+P  + FG C L+
Sbjct: 184 NCKKSLECTKLCLPQIENVKGTEDSGTTVLLPLVIFFGLCLLS 226


>BC010140-1|AAH10140.1|  455|Homo sapiens tumor necrosis factor
           receptor superfamily, member 1A protein.
          Length = 455

 Score = 29.9 bits (64), Expect = 7.8
 Identities = 28/103 (27%), Positives = 44/103 (42%), Gaps = 11/103 (10%)
 Frame = -3

Query: 556 CFNRQNYYLHQR*KNILKCF----CMMGS--LSCSSIKAPTALTA*VRKAIDSFGCKADI 395
           C  R+N Y H   +N+ +CF    C+ G+  LSC   K  T  T      +    C +  
Sbjct: 125 CGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQE-KQNTVCTCHAGFFLRENECVSCS 183

Query: 394 N--MPFITSKFSV*RFPNTPGTD---VNILIPASLMFGSCALA 281
           N       +K  + +  N  GT+     +L+P  + FG C L+
Sbjct: 184 NCKKSLECTKLCLPQIENVKGTEDSGTTVLLPLVIFFGLCLLS 226


>AY131997-1|AAM77802.1|  455|Homo sapiens tumor necrosis factor
           receptor superfamily, member 1A protein.
          Length = 455

 Score = 29.9 bits (64), Expect = 7.8
 Identities = 28/103 (27%), Positives = 44/103 (42%), Gaps = 11/103 (10%)
 Frame = -3

Query: 556 CFNRQNYYLHQR*KNILKCF----CMMGS--LSCSSIKAPTALTA*VRKAIDSFGCKADI 395
           C  R+N Y H   +N+ +CF    C+ G+  LSC   K  T  T      +    C +  
Sbjct: 125 CGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQE-KQNTVCTCHAGFFLRENECVSCS 183

Query: 394 N--MPFITSKFSV*RFPNTPGTD---VNILIPASLMFGSCALA 281
           N       +K  + +  N  GT+     +L+P  + FG C L+
Sbjct: 184 NCKKSLECTKLCLPQIENVKGTEDSGTTVLLPLVIFFGLCLLS 226


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 92,697,446
Number of Sequences: 237096
Number of extensions: 1909008
Number of successful extensions: 3342
Number of sequences better than 10.0: 28
Number of HSP's better than 10.0 without gapping: 3235
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3334
length of database: 76,859,062
effective HSP length: 87
effective length of database: 56,231,710
effective search space used: 6916500330
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -