SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20076
         (660 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CR533496-1|CAG38527.1|  211|Homo sapiens BAG2 protein.                 68   3e-11
BC125039-1|AAI25040.1|  211|Homo sapiens BCL2-associated athanog...    68   3e-11
AL136311-1|CAI20515.1|  211|Homo sapiens BCL2-associated athanog...    68   3e-11
AL031321-2|CAI21565.1|  211|Homo sapiens BCL2-associated athanog...    68   3e-11
AF095192-1|AAD16121.1|  211|Homo sapiens BAG-family molecular ch...    68   3e-11
AL136311-2|CAM28243.1|  108|Homo sapiens BCL2-associated athanog...    38   0.032
AL031321-3|CAM28256.1|  108|Homo sapiens BCL2-associated athanog...    38   0.032
AK074778-1|BAC11203.1|  131|Homo sapiens protein ( Homo sapiens ...    31   3.6  
AK026448-1|BAB15487.1|  131|Homo sapiens protein ( Homo sapiens ...    31   3.6  
Z82215-4|CAB05105.1| 1960|Homo sapiens myosin, heavy chain 9, no...    30   6.4  
M31013-1|AAA36349.1| 1247|Homo sapiens protein ( Human nonmuscle...    30   6.4  
CR456526-1|CAG30412.1| 1960|Homo sapiens MYH9 protein.                 30   6.4  
AB191263-1|BAD52439.1| 1960|Homo sapiens non-muscle myosin heavy...    30   6.4  
AL713762-1|CAD28532.1|  188|Homo sapiens hypothetical protein pr...    30   8.4  
AL365496-6|CAM19867.1|  719|Homo sapiens protocadherin 15 protein.     30   8.4  
AL365496-5|CAM19868.1| 1785|Homo sapiens protocadherin 15 protein.     30   8.4  
AL365496-4|CAM19871.1|  981|Homo sapiens protocadherin 15 protein.     30   8.4  
AL365496-2|CAM19870.1|  650|Homo sapiens protocadherin 15 protein.     30   8.4  
AL360214-9|CAM21540.1|  719|Homo sapiens protocadherin 15 protein.     30   8.4  
AL360214-8|CAM21538.1| 1785|Homo sapiens protocadherin 15 protein.     30   8.4  
AL360214-7|CAM21539.1|  981|Homo sapiens protocadherin 15 protein.     30   8.4  
AL360214-5|CAM21541.1|  650|Homo sapiens protocadherin 15 protein.     30   8.4  
AL356114-9|CAM15122.1|  719|Homo sapiens protocadherin 15 protein.     30   8.4  
AL356114-8|CAM15119.1| 1785|Homo sapiens protocadherin 15 protein.     30   8.4  
AL356114-7|CAM15121.1|  981|Homo sapiens protocadherin 15 protein.     30   8.4  
AL356114-5|CAM15118.1|  650|Homo sapiens protocadherin 15 protein.     30   8.4  
AL353784-8|CAM16786.1|  719|Homo sapiens protocadherin 15 protein.     30   8.4  
AL353784-7|CAM16789.1| 1785|Homo sapiens protocadherin 15 protein.     30   8.4  
AL353784-6|CAM16788.1|  981|Homo sapiens protocadherin 15 protein.     30   8.4  
AL353784-4|CAM16790.1|  650|Homo sapiens protocadherin 15 protein.     30   8.4  
AF176313-1|AAK84170.1|  525|Homo sapiens ADAM-TS related protein...    30   8.4  

>CR533496-1|CAG38527.1|  211|Homo sapiens BAG2 protein.
          Length = 211

 Score = 68.1 bits (159), Expect = 3e-11
 Identities = 32/84 (38%), Positives = 57/84 (67%)
 Frame = +2

Query: 257 VEMRVERLRKDTVRIEEEKDSLLSTLDSIKHSELLLDISECDKDDITRYADRILSRAMTV 436
           +E+RVE LR+    +E+EK+ LL  + SI++S+ +  IS+ +++++   A+R++ R +TV
Sbjct: 35  LELRVEALREAATAVEQEKEILLEMIHSIQNSQDMRQISDGEREELNLTANRLMGRTLTV 94

Query: 437 EVTVRTDRDHQQEEALYQVNMYID 508
           EV+V T R+ QQ+E+L      ID
Sbjct: 95  EVSVETIRNPQQQESLKHATRIID 118


>BC125039-1|AAI25040.1|  211|Homo sapiens BCL2-associated athanogene
           2 protein.
          Length = 211

 Score = 68.1 bits (159), Expect = 3e-11
 Identities = 32/84 (38%), Positives = 57/84 (67%)
 Frame = +2

Query: 257 VEMRVERLRKDTVRIEEEKDSLLSTLDSIKHSELLLDISECDKDDITRYADRILSRAMTV 436
           +E+RVE LR+    +E+EK+ LL  + SI++S+ +  IS+ +++++   A+R++ R +TV
Sbjct: 35  LELRVEALREAATAVEQEKEILLEMIHSIQNSQDMRQISDGEREELNLTANRLMGRTLTV 94

Query: 437 EVTVRTDRDHQQEEALYQVNMYID 508
           EV+V T R+ QQ+E+L      ID
Sbjct: 95  EVSVETIRNPQQQESLKHATRIID 118


>AL136311-1|CAI20515.1|  211|Homo sapiens BCL2-associated athanogene
           2 protein.
          Length = 211

 Score = 68.1 bits (159), Expect = 3e-11
 Identities = 32/84 (38%), Positives = 57/84 (67%)
 Frame = +2

Query: 257 VEMRVERLRKDTVRIEEEKDSLLSTLDSIKHSELLLDISECDKDDITRYADRILSRAMTV 436
           +E+RVE LR+    +E+EK+ LL  + SI++S+ +  IS+ +++++   A+R++ R +TV
Sbjct: 35  LELRVEALREAATAVEQEKEILLEMIHSIQNSQDMRQISDGEREELNLTANRLMGRTLTV 94

Query: 437 EVTVRTDRDHQQEEALYQVNMYID 508
           EV+V T R+ QQ+E+L      ID
Sbjct: 95  EVSVETIRNPQQQESLKHATRIID 118


>AL031321-2|CAI21565.1|  211|Homo sapiens BCL2-associated athanogene
           2 protein.
          Length = 211

 Score = 68.1 bits (159), Expect = 3e-11
 Identities = 32/84 (38%), Positives = 57/84 (67%)
 Frame = +2

Query: 257 VEMRVERLRKDTVRIEEEKDSLLSTLDSIKHSELLLDISECDKDDITRYADRILSRAMTV 436
           +E+RVE LR+    +E+EK+ LL  + SI++S+ +  IS+ +++++   A+R++ R +TV
Sbjct: 35  LELRVEALREAATAVEQEKEILLEMIHSIQNSQDMRQISDGEREELNLTANRLMGRTLTV 94

Query: 437 EVTVRTDRDHQQEEALYQVNMYID 508
           EV+V T R+ QQ+E+L      ID
Sbjct: 95  EVSVETIRNPQQQESLKHATRIID 118


>AF095192-1|AAD16121.1|  211|Homo sapiens BAG-family molecular
           chaperone regulator-2 protein.
          Length = 211

 Score = 68.1 bits (159), Expect = 3e-11
 Identities = 32/84 (38%), Positives = 57/84 (67%)
 Frame = +2

Query: 257 VEMRVERLRKDTVRIEEEKDSLLSTLDSIKHSELLLDISECDKDDITRYADRILSRAMTV 436
           +E+RVE LR+    +E+EK+ LL  + SI++S+ +  IS+ +++++   A+R++ R +TV
Sbjct: 35  LELRVEALREAATAVEQEKEILLEMIHSIQNSQDMRQISDGEREELNLTANRLMGRTLTV 94

Query: 437 EVTVRTDRDHQQEEALYQVNMYID 508
           EV+V T R+ QQ+E+L      ID
Sbjct: 95  EVSVETIRNPQQQESLKHATRIID 118


>AL136311-2|CAM28243.1|  108|Homo sapiens BCL2-associated athanogene
           2 protein.
          Length = 108

 Score = 37.9 bits (84), Expect = 0.032
 Identities = 29/82 (35%), Positives = 43/82 (52%)
 Frame = +2

Query: 263 MRVERLRKDTVRIEEEKDSLLSTLDSIKHSELLLDISECDKDDITRYADRILSRAMTVEV 442
           M VE LR+    +E+EK+ LL  + SI                +T  A+R++ R +TVEV
Sbjct: 4   MWVEALREAATAVEQEKEILLEMIHSI----------------LT--ANRLMGRTLTVEV 45

Query: 443 TVRTDRDHQQEEALYQVNMYID 508
           +V T R+ QQ+E+L      ID
Sbjct: 46  SVETIRNPQQQESLKHATRIID 67


>AL031321-3|CAM28256.1|  108|Homo sapiens BCL2-associated athanogene
           2 protein.
          Length = 108

 Score = 37.9 bits (84), Expect = 0.032
 Identities = 29/82 (35%), Positives = 43/82 (52%)
 Frame = +2

Query: 263 MRVERLRKDTVRIEEEKDSLLSTLDSIKHSELLLDISECDKDDITRYADRILSRAMTVEV 442
           M VE LR+    +E+EK+ LL  + SI                +T  A+R++ R +TVEV
Sbjct: 4   MWVEALREAATAVEQEKEILLEMIHSI----------------LT--ANRLMGRTLTVEV 45

Query: 443 TVRTDRDHQQEEALYQVNMYID 508
           +V T R+ QQ+E+L      ID
Sbjct: 46  SVETIRNPQQQESLKHATRIID 67


>AK074778-1|BAC11203.1|  131|Homo sapiens protein ( Homo sapiens
           cDNA FLJ90297 fis, clone NT2RP2000447, moderately
           similar to GOLGIN-95. ).
          Length = 131

 Score = 31.1 bits (67), Expect = 3.6
 Identities = 20/52 (38%), Positives = 27/52 (51%), Gaps = 2/52 (3%)
 Frame = +1

Query: 412 HPVPGYDRRGDSAH*PRPSAGGSSVSGEHVHR*L--VMSVHNDAVSAHSRCQ 561
           HPV    ++ + A  P P +GG SV GE  HR L   M    ++ SA  +CQ
Sbjct: 38  HPVASSQKKPEVAA-PAPESGGESVFGE-THRALQGAMEKLQESTSARGQCQ 87


>AK026448-1|BAB15487.1|  131|Homo sapiens protein ( Homo sapiens
           cDNA: FLJ22795 fis, clone KAIA2543. ).
          Length = 131

 Score = 31.1 bits (67), Expect = 3.6
 Identities = 20/52 (38%), Positives = 27/52 (51%), Gaps = 2/52 (3%)
 Frame = +1

Query: 412 HPVPGYDRRGDSAH*PRPSAGGSSVSGEHVHR*L--VMSVHNDAVSAHSRCQ 561
           HPV    ++ + A  P P +GG SV GE  HR L   M    ++ SA  +CQ
Sbjct: 38  HPVASSQKKPEVAA-PAPESGGESVFGE-THRALQGAMEKLQESTSARGQCQ 87


>Z82215-4|CAB05105.1| 1960|Homo sapiens myosin, heavy chain 9,
            non-muscle protein.
          Length = 1960

 Score = 30.3 bits (65), Expect = 6.4
 Identities = 18/70 (25%), Positives = 33/70 (47%)
 Frame = +2

Query: 272  ERLRKDTVRIEEEKDSLLSTLDSIKHSELLLDISECDKDDITRYADRILSRAMTVEVTVR 451
            ++L K   R+++E D LL  LD  + S        C+ +   +  D++L+   T+     
Sbjct: 1409 DKLEKTKTRLQQELDDLLVDLDHQRQSA-------CNLEKKQKKFDQLLAEEKTISAKYA 1461

Query: 452  TDRDHQQEEA 481
             +RD  + EA
Sbjct: 1462 EERDRAEAEA 1471


>M31013-1|AAA36349.1| 1247|Homo sapiens protein ( Human nonmuscle
           myosin heavy chain (NMHC) mRNA, 3' end. ).
          Length = 1247

 Score = 30.3 bits (65), Expect = 6.4
 Identities = 18/70 (25%), Positives = 33/70 (47%)
 Frame = +2

Query: 272 ERLRKDTVRIEEEKDSLLSTLDSIKHSELLLDISECDKDDITRYADRILSRAMTVEVTVR 451
           ++L K   R+++E D LL  LD  + S        C+ +   +  D++L+   T+     
Sbjct: 696 DKLEKTKTRLQQELDDLLVDLDHQRQSA-------CNLEKKQKKFDQLLAEEKTISAKYA 748

Query: 452 TDRDHQQEEA 481
            +RD  + EA
Sbjct: 749 EERDRAEAEA 758


>CR456526-1|CAG30412.1| 1960|Homo sapiens MYH9 protein.
          Length = 1960

 Score = 30.3 bits (65), Expect = 6.4
 Identities = 18/70 (25%), Positives = 33/70 (47%)
 Frame = +2

Query: 272  ERLRKDTVRIEEEKDSLLSTLDSIKHSELLLDISECDKDDITRYADRILSRAMTVEVTVR 451
            ++L K   R+++E D LL  LD  + S        C+ +   +  D++L+   T+     
Sbjct: 1409 DKLEKTKTRLQQELDDLLVDLDHQRQSA-------CNLEKKQKKFDQLLAEEKTISAKYA 1461

Query: 452  TDRDHQQEEA 481
             +RD  + EA
Sbjct: 1462 EERDRAEAEA 1471


>AB191263-1|BAD52439.1| 1960|Homo sapiens non-muscle myosin heavy
            polypeptide 9 protein.
          Length = 1960

 Score = 30.3 bits (65), Expect = 6.4
 Identities = 18/70 (25%), Positives = 33/70 (47%)
 Frame = +2

Query: 272  ERLRKDTVRIEEEKDSLLSTLDSIKHSELLLDISECDKDDITRYADRILSRAMTVEVTVR 451
            ++L K   R+++E D LL  LD  + S        C+ +   +  D++L+   T+     
Sbjct: 1409 DKLEKTKTRLQQELDDLLVDLDHQRQSA-------CNLEKKQKKFDQLLAEEKTISAKYA 1461

Query: 452  TDRDHQQEEA 481
             +RD  + EA
Sbjct: 1462 EERDRAEAEA 1471


>AL713762-1|CAD28532.1|  188|Homo sapiens hypothetical protein
           protein.
          Length = 188

 Score = 29.9 bits (64), Expect = 8.4
 Identities = 21/68 (30%), Positives = 33/68 (48%), Gaps = 3/68 (4%)
 Frame = +2

Query: 173 GFTTTPHRRILGSRNAGAERQTDSSTR*VEMRVER---LRKDTVRIEEEKDSLLSTLDSI 343
           G TTTP +++L       +      T+  +  V       ++ +  EEEK + LS+  SI
Sbjct: 38  GLTTTPQQKLLSQHLPQRQGNDTDKTQGAQTCVANGVMAAQNQMECEEEKAATLSSDTSI 97

Query: 344 KHSELLLD 367
           + SE LLD
Sbjct: 98  QASEPLLD 105


>AL365496-6|CAM19867.1|  719|Homo sapiens protocadherin 15 protein.
          Length = 719

 Score = 29.9 bits (64), Expect = 8.4
 Identities = 18/62 (29%), Positives = 31/62 (50%), Gaps = 2/62 (3%)
 Frame = +2

Query: 302 EEEKDSLLSTLDSIKHSELLLDISECDKDDITRYADR--ILSRAMTVEVTVRTDRDHQQE 475
           EE+KD L  TLD  + +E  ++  E    D T Y++     S + T E    ++   ++E
Sbjct: 510 EEDKDYLKLTLDQEEATESTVESEEESSSDYTEYSEEESEFSESETTEEESESETPSEEE 569

Query: 476 EA 481
           E+
Sbjct: 570 ES 571


>AL365496-5|CAM19868.1| 1785|Homo sapiens protocadherin 15 protein.
          Length = 1785

 Score = 29.9 bits (64), Expect = 8.4
 Identities = 18/62 (29%), Positives = 31/62 (50%), Gaps = 2/62 (3%)
 Frame = +2

Query: 302  EEEKDSLLSTLDSIKHSELLLDISECDKDDITRYADR--ILSRAMTVEVTVRTDRDHQQE 475
            EE+KD L  TLD  + +E  ++  E    D T Y++     S + T E    ++   ++E
Sbjct: 1576 EEDKDYLKLTLDQEEATESTVESEEESSSDYTEYSEEESEFSESETTEEESESETPSEEE 1635

Query: 476  EA 481
            E+
Sbjct: 1636 ES 1637


>AL365496-4|CAM19871.1|  981|Homo sapiens protocadherin 15 protein.
          Length = 981

 Score = 29.9 bits (64), Expect = 8.4
 Identities = 18/62 (29%), Positives = 31/62 (50%), Gaps = 2/62 (3%)
 Frame = +2

Query: 302 EEEKDSLLSTLDSIKHSELLLDISECDKDDITRYADR--ILSRAMTVEVTVRTDRDHQQE 475
           EE+KD L  TLD  + +E  ++  E    D T Y++     S + T E    ++   ++E
Sbjct: 772 EEDKDYLKLTLDQEEATESTVESEEESSSDYTEYSEEESEFSESETTEEESESETPSEEE 831

Query: 476 EA 481
           E+
Sbjct: 832 ES 833


>AL365496-2|CAM19870.1|  650|Homo sapiens protocadherin 15 protein.
          Length = 650

 Score = 29.9 bits (64), Expect = 8.4
 Identities = 18/62 (29%), Positives = 31/62 (50%), Gaps = 2/62 (3%)
 Frame = +2

Query: 302 EEEKDSLLSTLDSIKHSELLLDISECDKDDITRYADR--ILSRAMTVEVTVRTDRDHQQE 475
           EE+KD L  TLD  + +E  ++  E    D T Y++     S + T E    ++   ++E
Sbjct: 441 EEDKDYLKLTLDQEEATESTVESEEESSSDYTEYSEEESEFSESETTEEESESETPSEEE 500

Query: 476 EA 481
           E+
Sbjct: 501 ES 502


>AL360214-9|CAM21540.1|  719|Homo sapiens protocadherin 15 protein.
          Length = 719

 Score = 29.9 bits (64), Expect = 8.4
 Identities = 18/62 (29%), Positives = 31/62 (50%), Gaps = 2/62 (3%)
 Frame = +2

Query: 302 EEEKDSLLSTLDSIKHSELLLDISECDKDDITRYADR--ILSRAMTVEVTVRTDRDHQQE 475
           EE+KD L  TLD  + +E  ++  E    D T Y++     S + T E    ++   ++E
Sbjct: 510 EEDKDYLKLTLDQEEATESTVESEEESSSDYTEYSEEESEFSESETTEEESESETPSEEE 569

Query: 476 EA 481
           E+
Sbjct: 570 ES 571


>AL360214-8|CAM21538.1| 1785|Homo sapiens protocadherin 15 protein.
          Length = 1785

 Score = 29.9 bits (64), Expect = 8.4
 Identities = 18/62 (29%), Positives = 31/62 (50%), Gaps = 2/62 (3%)
 Frame = +2

Query: 302  EEEKDSLLSTLDSIKHSELLLDISECDKDDITRYADR--ILSRAMTVEVTVRTDRDHQQE 475
            EE+KD L  TLD  + +E  ++  E    D T Y++     S + T E    ++   ++E
Sbjct: 1576 EEDKDYLKLTLDQEEATESTVESEEESSSDYTEYSEEESEFSESETTEEESESETPSEEE 1635

Query: 476  EA 481
            E+
Sbjct: 1636 ES 1637


>AL360214-7|CAM21539.1|  981|Homo sapiens protocadherin 15 protein.
          Length = 981

 Score = 29.9 bits (64), Expect = 8.4
 Identities = 18/62 (29%), Positives = 31/62 (50%), Gaps = 2/62 (3%)
 Frame = +2

Query: 302 EEEKDSLLSTLDSIKHSELLLDISECDKDDITRYADR--ILSRAMTVEVTVRTDRDHQQE 475
           EE+KD L  TLD  + +E  ++  E    D T Y++     S + T E    ++   ++E
Sbjct: 772 EEDKDYLKLTLDQEEATESTVESEEESSSDYTEYSEEESEFSESETTEEESESETPSEEE 831

Query: 476 EA 481
           E+
Sbjct: 832 ES 833


>AL360214-5|CAM21541.1|  650|Homo sapiens protocadherin 15 protein.
          Length = 650

 Score = 29.9 bits (64), Expect = 8.4
 Identities = 18/62 (29%), Positives = 31/62 (50%), Gaps = 2/62 (3%)
 Frame = +2

Query: 302 EEEKDSLLSTLDSIKHSELLLDISECDKDDITRYADR--ILSRAMTVEVTVRTDRDHQQE 475
           EE+KD L  TLD  + +E  ++  E    D T Y++     S + T E    ++   ++E
Sbjct: 441 EEDKDYLKLTLDQEEATESTVESEEESSSDYTEYSEEESEFSESETTEEESESETPSEEE 500

Query: 476 EA 481
           E+
Sbjct: 501 ES 502


>AL356114-9|CAM15122.1|  719|Homo sapiens protocadherin 15 protein.
          Length = 719

 Score = 29.9 bits (64), Expect = 8.4
 Identities = 18/62 (29%), Positives = 31/62 (50%), Gaps = 2/62 (3%)
 Frame = +2

Query: 302 EEEKDSLLSTLDSIKHSELLLDISECDKDDITRYADR--ILSRAMTVEVTVRTDRDHQQE 475
           EE+KD L  TLD  + +E  ++  E    D T Y++     S + T E    ++   ++E
Sbjct: 510 EEDKDYLKLTLDQEEATESTVESEEESSSDYTEYSEEESEFSESETTEEESESETPSEEE 569

Query: 476 EA 481
           E+
Sbjct: 570 ES 571


>AL356114-8|CAM15119.1| 1785|Homo sapiens protocadherin 15 protein.
          Length = 1785

 Score = 29.9 bits (64), Expect = 8.4
 Identities = 18/62 (29%), Positives = 31/62 (50%), Gaps = 2/62 (3%)
 Frame = +2

Query: 302  EEEKDSLLSTLDSIKHSELLLDISECDKDDITRYADR--ILSRAMTVEVTVRTDRDHQQE 475
            EE+KD L  TLD  + +E  ++  E    D T Y++     S + T E    ++   ++E
Sbjct: 1576 EEDKDYLKLTLDQEEATESTVESEEESSSDYTEYSEEESEFSESETTEEESESETPSEEE 1635

Query: 476  EA 481
            E+
Sbjct: 1636 ES 1637


>AL356114-7|CAM15121.1|  981|Homo sapiens protocadherin 15 protein.
          Length = 981

 Score = 29.9 bits (64), Expect = 8.4
 Identities = 18/62 (29%), Positives = 31/62 (50%), Gaps = 2/62 (3%)
 Frame = +2

Query: 302 EEEKDSLLSTLDSIKHSELLLDISECDKDDITRYADR--ILSRAMTVEVTVRTDRDHQQE 475
           EE+KD L  TLD  + +E  ++  E    D T Y++     S + T E    ++   ++E
Sbjct: 772 EEDKDYLKLTLDQEEATESTVESEEESSSDYTEYSEEESEFSESETTEEESESETPSEEE 831

Query: 476 EA 481
           E+
Sbjct: 832 ES 833


>AL356114-5|CAM15118.1|  650|Homo sapiens protocadherin 15 protein.
          Length = 650

 Score = 29.9 bits (64), Expect = 8.4
 Identities = 18/62 (29%), Positives = 31/62 (50%), Gaps = 2/62 (3%)
 Frame = +2

Query: 302 EEEKDSLLSTLDSIKHSELLLDISECDKDDITRYADR--ILSRAMTVEVTVRTDRDHQQE 475
           EE+KD L  TLD  + +E  ++  E    D T Y++     S + T E    ++   ++E
Sbjct: 441 EEDKDYLKLTLDQEEATESTVESEEESSSDYTEYSEEESEFSESETTEEESESETPSEEE 500

Query: 476 EA 481
           E+
Sbjct: 501 ES 502


>AL353784-8|CAM16786.1|  719|Homo sapiens protocadherin 15 protein.
          Length = 719

 Score = 29.9 bits (64), Expect = 8.4
 Identities = 18/62 (29%), Positives = 31/62 (50%), Gaps = 2/62 (3%)
 Frame = +2

Query: 302 EEEKDSLLSTLDSIKHSELLLDISECDKDDITRYADR--ILSRAMTVEVTVRTDRDHQQE 475
           EE+KD L  TLD  + +E  ++  E    D T Y++     S + T E    ++   ++E
Sbjct: 510 EEDKDYLKLTLDQEEATESTVESEEESSSDYTEYSEEESEFSESETTEEESESETPSEEE 569

Query: 476 EA 481
           E+
Sbjct: 570 ES 571


>AL353784-7|CAM16789.1| 1785|Homo sapiens protocadherin 15 protein.
          Length = 1785

 Score = 29.9 bits (64), Expect = 8.4
 Identities = 18/62 (29%), Positives = 31/62 (50%), Gaps = 2/62 (3%)
 Frame = +2

Query: 302  EEEKDSLLSTLDSIKHSELLLDISECDKDDITRYADR--ILSRAMTVEVTVRTDRDHQQE 475
            EE+KD L  TLD  + +E  ++  E    D T Y++     S + T E    ++   ++E
Sbjct: 1576 EEDKDYLKLTLDQEEATESTVESEEESSSDYTEYSEEESEFSESETTEEESESETPSEEE 1635

Query: 476  EA 481
            E+
Sbjct: 1636 ES 1637


>AL353784-6|CAM16788.1|  981|Homo sapiens protocadherin 15 protein.
          Length = 981

 Score = 29.9 bits (64), Expect = 8.4
 Identities = 18/62 (29%), Positives = 31/62 (50%), Gaps = 2/62 (3%)
 Frame = +2

Query: 302 EEEKDSLLSTLDSIKHSELLLDISECDKDDITRYADR--ILSRAMTVEVTVRTDRDHQQE 475
           EE+KD L  TLD  + +E  ++  E    D T Y++     S + T E    ++   ++E
Sbjct: 772 EEDKDYLKLTLDQEEATESTVESEEESSSDYTEYSEEESEFSESETTEEESESETPSEEE 831

Query: 476 EA 481
           E+
Sbjct: 832 ES 833


>AL353784-4|CAM16790.1|  650|Homo sapiens protocadherin 15 protein.
          Length = 650

 Score = 29.9 bits (64), Expect = 8.4
 Identities = 18/62 (29%), Positives = 31/62 (50%), Gaps = 2/62 (3%)
 Frame = +2

Query: 302 EEEKDSLLSTLDSIKHSELLLDISECDKDDITRYADR--ILSRAMTVEVTVRTDRDHQQE 475
           EE+KD L  TLD  + +E  ++  E    D T Y++     S + T E    ++   ++E
Sbjct: 441 EEDKDYLKLTLDQEEATESTVESEEESSSDYTEYSEEESEFSESETTEEESESETPSEEE 500

Query: 476 EA 481
           E+
Sbjct: 501 ES 502


>AF176313-1|AAK84170.1|  525|Homo sapiens ADAM-TS related protein 1
           protein.
          Length = 525

 Score = 29.9 bits (64), Expect = 8.4
 Identities = 13/24 (54%), Positives = 16/24 (66%)
 Frame = -3

Query: 598 WGPAETCTRSYRSGNGNAHSLRRC 527
           WGP   C+R+   G G A+SLRRC
Sbjct: 39  WGPWSECSRT--CGGGAANSLRRC 60


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 96,296,631
Number of Sequences: 237096
Number of extensions: 2072958
Number of successful extensions: 5714
Number of sequences better than 10.0: 31
Number of HSP's better than 10.0 without gapping: 5091
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5701
length of database: 76,859,062
effective HSP length: 87
effective length of database: 56,231,710
effective search space used: 7422585720
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -