SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20075
         (715 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BC120960-1|AAI20961.1|  282|Homo sapiens keratin associated prot...    34   0.58 
BC120959-1|AAI20960.1|  282|Homo sapiens keratin associated prot...    34   0.58 
AJ406941-1|CAC27580.1|  191|Homo sapiens keratin associated prot...    34   0.58 
AK124538-1|BAC85878.1|  256|Homo sapiens protein ( Homo sapiens ...    33   0.77 
AB076347-1|BAD01534.1|  282|Homo sapiens keratin associated prot...    33   1.0  
BC133677-1|AAI33678.1|  194|Homo sapiens KRTAP10-3 protein protein.    32   1.8  
BC120950-1|AAI20951.1|  271|Homo sapiens keratin associated prot...    32   1.8  
BC120949-1|AAI20950.1|  271|Homo sapiens keratin associated prot...    32   1.8  
BC103846-1|AAI03847.1|  127|Homo sapiens keratin associated prot...    32   1.8  
BC103845-1|AAI03846.1|  127|Homo sapiens keratin associated prot...    32   1.8  
AJ406942-1|CAC27581.1|  127|Homo sapiens keratin associated prot...    32   1.8  
AB076353-1|BAD01540.1|  365|Homo sapiens keratin associated prot...    32   1.8  
AB076352-1|BAD01539.1|  271|Homo sapiens keratin associated prot...    32   1.8  
AB076351-1|BAD01538.1|  401|Homo sapiens keratin associated prot...    32   1.8  
BC125049-1|AAI25050.1|  401|Homo sapiens keratin associated prot...    32   2.3  
BC125048-1|AAI25049.1|  401|Homo sapiens keratin associated prot...    32   2.3  
BC131613-1|AAI31614.1|  292|Homo sapiens keratin associated prot...    31   3.1  
AB076364-1|BAD01551.1|  245|Homo sapiens keratin associated prot...    31   3.1  
AB076356-1|BAD01543.1|  292|Homo sapiens keratin associated prot...    31   3.1  
AB076350-1|BAD01537.1|  221|Homo sapiens keratin associated prot...    31   3.1  
BC119643-1|AAI19644.1|  370|Homo sapiens keratin associated prot...    31   4.1  
BC101162-1|AAI01163.1|  201|Homo sapiens keratin associated prot...    31   4.1  
BC101160-1|AAI01161.1|  201|Homo sapiens keratin associated prot...    31   4.1  
BC101159-1|AAI01160.1|  201|Homo sapiens keratin associated prot...    31   4.1  
BC004212-1|AAH04212.1|  201|Homo sapiens keratin associated prot...    31   4.1  
BC004180-1|AAH04180.1|  201|Homo sapiens keratin associated prot...    31   4.1  
AK126796-1|BAC86698.1|  195|Homo sapiens protein ( Homo sapiens ...    31   4.1  
AJ406943-1|CAC27582.1|  201|Homo sapiens keratin associated prot...    31   4.1  
AC007248-2|AAY15047.1|  556|Homo sapiens unknown protein.              31   4.1  
AB076354-1|BAD01541.1|  370|Homo sapiens keratin associated prot...    31   4.1  
AB012701-1|BAA82405.2|  556|Homo sapiens ST2L protein.                 31   4.1  
BC131611-1|AAI31612.1|  298|Homo sapiens keratin associated prot...    31   5.4  
AB076359-1|BAD01546.1|  298|Homo sapiens keratin associated prot...    31   5.4  
BC130562-1|AAI30563.1|  195|Homo sapiens keratin associated prot...    30   7.2  
BC126131-1|AAI26132.1|  195|Homo sapiens keratin associated prot...    30   7.2  
AK128020-1|BAC87234.1|  595|Homo sapiens ursor.  protein.              30   7.2  
AJ406944-1|CAC27583.1|  195|Homo sapiens keratin associated prot...    30   7.2  
BC127252-1|AAI27253.1|  136|Homo sapiens keratin associated prot...    30   9.5  
AJ406934-1|CAC27573.1|  136|Homo sapiens keratin associated prot...    30   9.5  
AB076348-1|BAD01535.1|  255|Homo sapiens keratin associated prot...    30   9.5  

>BC120960-1|AAI20961.1|  282|Homo sapiens keratin associated protein
           10-1 protein.
          Length = 282

 Score = 33.9 bits (74), Expect = 0.58
 Identities = 17/58 (29%), Positives = 24/58 (41%)
 Frame = -2

Query: 504 CKVSTCAWAKTTMVACTKSSPSSPNCCLGTKSQNSVMAFRLSVCGCTDCWQTICEAIC 331
           C +S CA A    + CT  S  S  CC      +   +   S C  + C Q+ C+  C
Sbjct: 32  CALSCCALAPCLTLVCTPVSRVSSPCCQAACEPSPCQSGCTSSCTPSCCQQSSCQPAC 89


>BC120959-1|AAI20960.1|  282|Homo sapiens keratin associated protein
           10-1 protein.
          Length = 282

 Score = 33.9 bits (74), Expect = 0.58
 Identities = 17/58 (29%), Positives = 24/58 (41%)
 Frame = -2

Query: 504 CKVSTCAWAKTTMVACTKSSPSSPNCCLGTKSQNSVMAFRLSVCGCTDCWQTICEAIC 331
           C +S CA A    + CT  S  S  CC      +   +   S C  + C Q+ C+  C
Sbjct: 32  CALSCCALAPCLTLVCTPVSRVSSPCCQAACEPSPCQSGCTSSCTPSCCQQSSCQPAC 89


>AJ406941-1|CAC27580.1|  191|Homo sapiens keratin associated protein
           4.9 protein.
          Length = 191

 Score = 33.9 bits (74), Expect = 0.58
 Identities = 16/58 (27%), Positives = 27/58 (46%)
 Frame = -2

Query: 504 CKVSTCAWAKTTMVACTKSSPSSPNCCLGTKSQNSVMAFRLSVCGCTDCWQTICEAIC 331
           C VS+C   +     C + + S P+CC  T  + +   +R S C  + C    C+ +C
Sbjct: 25  CCVSSCCRPQCCQSVCCQPTCSRPSCCQTTCCRTT--CYRPSCCVSSCCRPQCCQPVC 80


>AK124538-1|BAC85878.1|  256|Homo sapiens protein ( Homo sapiens
           cDNA FLJ42547 fis, clone BRACE3004880. ).
          Length = 256

 Score = 33.5 bits (73), Expect = 0.77
 Identities = 24/76 (31%), Positives = 33/76 (43%), Gaps = 8/76 (10%)
 Frame = -2

Query: 498 VSTCAWAKTTMVACTKSSPSSPNCCLG--TKSQNSVMAFRLSVCGCTDCWQTICE----- 340
           +S C  + TT+ AC  SS +   C L   T S   +    LS CG +    + C      
Sbjct: 123 LSACGLSSTTLFACRLSSVTVSTCSLSSVTLSACGLSRVTLSACGLSSMTPSACGLSRVT 182

Query: 339 -AICSLYSMRVTLTGL 295
            + C L SM V+  GL
Sbjct: 183 LSACHLSSMTVSTCGL 198


>AB076347-1|BAD01534.1|  282|Homo sapiens keratin associated protein
           protein.
          Length = 282

 Score = 33.1 bits (72), Expect = 1.0
 Identities = 17/58 (29%), Positives = 24/58 (41%)
 Frame = -2

Query: 504 CKVSTCAWAKTTMVACTKSSPSSPNCCLGTKSQNSVMAFRLSVCGCTDCWQTICEAIC 331
           C +S CA A    + CT  S  S  CC      +   +   S C  + C Q+ C+  C
Sbjct: 32  CALSCCAPAPCLTLVCTPVSRVSSPCCQAACEPSPCQSGCTSSCTPSCCQQSSCQPAC 89


>BC133677-1|AAI33678.1|  194|Homo sapiens KRTAP10-3 protein protein.
          Length = 194

 Score = 32.3 bits (70), Expect = 1.8
 Identities = 17/58 (29%), Positives = 23/58 (39%)
 Frame = -2

Query: 504 CKVSTCAWAKTTMVACTKSSPSSPNCCLGTKSQNSVMAFRLSVCGCTDCWQTICEAIC 331
           C  S CA A    + CT  S  S  CC      +   +   S C  + C Q+ C+  C
Sbjct: 32  CAPSCCALAPCLTLVCTPVSCVSSPCCQAACEPSPCQSGCTSSCTPSCCQQSSCQPAC 89


>BC120950-1|AAI20951.1|  271|Homo sapiens keratin associated protein
           10-5 protein.
          Length = 271

 Score = 32.3 bits (70), Expect = 1.8
 Identities = 18/58 (31%), Positives = 26/58 (44%)
 Frame = -2

Query: 504 CKVSTCAWAKTTMVACTKSSPSSPNCCLGTKSQNSVMAFRLSVCGCTDCWQTICEAIC 331
           C+ + CA +     AC       P CCL T S++S    + S C  T C  + C+  C
Sbjct: 74  CQPACCA-SSPCQQACCVPVCCKPVCCLPTCSKDSSSCCQQSSCQPTCCASSSCQQSC 130



 Score = 31.1 bits (67), Expect = 4.1
 Identities = 15/54 (27%), Positives = 24/54 (44%)
 Frame = -2

Query: 492 TCAWAKTTMVACTKSSPSSPNCCLGTKSQNSVMAFRLSVCGCTDCWQTICEAIC 331
           TC  + +   +C       P CC+ T S++S    + S C  T C  + C+  C
Sbjct: 119 TCCASSSCQQSCCVPVCCKPVCCVPTCSEDSSSCCQHSSCQPTCCTSSPCQQSC 172


>BC120949-1|AAI20950.1|  271|Homo sapiens keratin associated protein
           10-5 protein.
          Length = 271

 Score = 32.3 bits (70), Expect = 1.8
 Identities = 18/58 (31%), Positives = 26/58 (44%)
 Frame = -2

Query: 504 CKVSTCAWAKTTMVACTKSSPSSPNCCLGTKSQNSVMAFRLSVCGCTDCWQTICEAIC 331
           C+ + CA +     AC       P CCL T S++S    + S C  T C  + C+  C
Sbjct: 74  CQPACCA-SSPCQQACCVPVCCKPVCCLPTCSKDSSSCCQQSSCQPTCCASSSCQQSC 130



 Score = 31.1 bits (67), Expect = 4.1
 Identities = 15/54 (27%), Positives = 24/54 (44%)
 Frame = -2

Query: 492 TCAWAKTTMVACTKSSPSSPNCCLGTKSQNSVMAFRLSVCGCTDCWQTICEAIC 331
           TC  + +   +C       P CC+ T S++S    + S C  T C  + C+  C
Sbjct: 119 TCCASSSCQQSCCVPVCCKPVCCVPTCSEDSSSCCQHSSCQPTCCTSSPCQQSC 172


>BC103846-1|AAI03847.1|  127|Homo sapiens keratin associated protein
           4-10 protein.
          Length = 127

 Score = 32.3 bits (70), Expect = 1.8
 Identities = 17/63 (26%), Positives = 27/63 (42%), Gaps = 1/63 (1%)
 Frame = -2

Query: 504 CKVSTCAWAKTTMVACTKSSPSSPNCCLGTKSQNSVM-AFRLSVCGCTDCWQTICEAICS 328
           C VS+C     +   C +++   P+CC     Q +   +  +S C    C QT C   C 
Sbjct: 39  CVVSSCCRPSCSQTTCCQTTCCRPSCCRPVCCQTTCRPSCGVSSCCRPLCCQTTCRPSCG 98

Query: 327 LYS 319
           + S
Sbjct: 99  VSS 101


>BC103845-1|AAI03846.1|  127|Homo sapiens keratin associated protein
           4-10 protein.
          Length = 127

 Score = 32.3 bits (70), Expect = 1.8
 Identities = 17/63 (26%), Positives = 27/63 (42%), Gaps = 1/63 (1%)
 Frame = -2

Query: 504 CKVSTCAWAKTTMVACTKSSPSSPNCCLGTKSQNSVM-AFRLSVCGCTDCWQTICEAICS 328
           C VS+C     +   C +++   P+CC     Q +   +  +S C    C QT C   C 
Sbjct: 39  CVVSSCCRPSCSQTTCCQTTCCRPSCCRPVCCQTTCRPSCGVSSCCRPLCCQTTCRPSCG 98

Query: 327 LYS 319
           + S
Sbjct: 99  VSS 101


>AJ406942-1|CAC27581.1|  127|Homo sapiens keratin associated protein
           4.10 protein.
          Length = 127

 Score = 32.3 bits (70), Expect = 1.8
 Identities = 17/63 (26%), Positives = 27/63 (42%), Gaps = 1/63 (1%)
 Frame = -2

Query: 504 CKVSTCAWAKTTMVACTKSSPSSPNCCLGTKSQNSVM-AFRLSVCGCTDCWQTICEAICS 328
           C VS+C     +   C +++   P+CC     Q +   +  +S C    C QT C   C 
Sbjct: 39  CVVSSCCRPSCSQTTCCQTTCCRPSCCRPVCCQTTCRPSCGVSSCCRPLCCQTTCRPSCG 98

Query: 327 LYS 319
           + S
Sbjct: 99  VSS 101


>AB076353-1|BAD01540.1|  365|Homo sapiens keratin associated protein
           protein.
          Length = 365

 Score = 32.3 bits (70), Expect = 1.8
 Identities = 17/66 (25%), Positives = 27/66 (40%), Gaps = 4/66 (6%)
 Frame = -2

Query: 516 LAMLCKVSTCAWAKTTMVACTKSSPSSPNCCLGTKSQNSVMAFRLSVC---GCTDCWQT- 349
           +++ C  S+C    +   AC  SSP    CC+    +        S C    C  C  + 
Sbjct: 126 VSVCCGDSSCCQQSSCQSACCTSSPCQQACCVPVCCKPVCSGISSSCCQQSSCVSCVSSP 185

Query: 348 ICEAIC 331
            C+A+C
Sbjct: 186 CCQAVC 191



 Score = 31.1 bits (67), Expect = 4.1
 Identities = 17/58 (29%), Positives = 24/58 (41%)
 Frame = -2

Query: 504 CKVSTCAWAKTTMVACTKSSPSSPNCCLGTKSQNSVMAFRLSVCGCTDCWQTICEAIC 331
           C+   CA A    + CT  S  S  CC  T   +   +   S C  + C Q+ C+  C
Sbjct: 42  CEPPCCAPAPCLSLVCTPVSRVSSPCCPVTCEPSPCQSGCTSSCTPSCCQQSSCQLAC 99



 Score = 31.1 bits (67), Expect = 4.1
 Identities = 20/64 (31%), Positives = 25/64 (39%)
 Frame = -2

Query: 495 STCAWAKTTMVACTKSSPSSPNCCLGTKSQNSVMAFRLSVCGCTDCWQTICEAICSLYSM 316
           S+C    +   AC  SSP    CC+   S  S      S C  + C    C A C   S 
Sbjct: 248 SSCCQQSSCQPACCTSSPCQHACCVPVCSGAST-----SCCQQSSCQPACCTASCCRSSS 302

Query: 315 RVTL 304
            V+L
Sbjct: 303 SVSL 306


>AB076352-1|BAD01539.1|  271|Homo sapiens keratin associated protein
           protein.
          Length = 271

 Score = 32.3 bits (70), Expect = 1.8
 Identities = 18/58 (31%), Positives = 26/58 (44%)
 Frame = -2

Query: 504 CKVSTCAWAKTTMVACTKSSPSSPNCCLGTKSQNSVMAFRLSVCGCTDCWQTICEAIC 331
           C+ + CA +     AC       P CCL T S++S    + S C  T C  + C+  C
Sbjct: 74  CQPACCA-SSPCQQACCVPVCCKPVCCLPTCSKDSSSCCQQSSCQPTCCASSSCQQSC 130



 Score = 31.1 bits (67), Expect = 4.1
 Identities = 15/54 (27%), Positives = 24/54 (44%)
 Frame = -2

Query: 492 TCAWAKTTMVACTKSSPSSPNCCLGTKSQNSVMAFRLSVCGCTDCWQTICEAIC 331
           TC  + +   +C       P CC+ T S++S    + S C  T C  + C+  C
Sbjct: 119 TCCASSSCQQSCCVPVCCKPVCCVPTCSEDSSSCCQHSSCQPTCCTSSPCQQSC 172


>AB076351-1|BAD01538.1|  401|Homo sapiens keratin associated protein
           protein.
          Length = 401

 Score = 32.3 bits (70), Expect = 1.8
 Identities = 18/58 (31%), Positives = 24/58 (41%)
 Frame = -2

Query: 504 CKVSTCAWAKTTMVACTKSSPSSPNCCLGTKSQNSVMAFRLSVCGCTDCWQTICEAIC 331
           C  S CA A    + CT  S  S  CC  T   +   +   S C  + C Q+ C+  C
Sbjct: 42  CAPSCCAPAPCLSLVCTPVSRVSSPCCPVTCEPSPCQSGCTSSCTPSCCQQSSCQLAC 99



 Score = 31.1 bits (67), Expect = 4.1
 Identities = 17/62 (27%), Positives = 24/62 (38%), Gaps = 4/62 (6%)
 Frame = -2

Query: 504 CKVSTCAWAKTTMVACTKSSPSSPNCCLGTKSQNSVMAFRLSVC---GCTDCWQT-ICEA 337
           C  S+C    +   AC  SSP    CC+    +        S C    C  C  +  C+A
Sbjct: 130 CGDSSCCQQSSCQSACCTSSPCQQACCVPICCKPVCSGISSSCCQQSSCVSCVSSPCCQA 189

Query: 336 IC 331
           +C
Sbjct: 190 VC 191


>BC125049-1|AAI25050.1|  401|Homo sapiens keratin associated protein
           10-4 protein.
          Length = 401

 Score = 31.9 bits (69), Expect = 2.3
 Identities = 18/58 (31%), Positives = 24/58 (41%)
 Frame = -2

Query: 504 CKVSTCAWAKTTMVACTKSSPSSPNCCLGTKSQNSVMAFRLSVCGCTDCWQTICEAIC 331
           C  S CA A    + CT  S  S  CC  T   +   +   S C  + C Q+ C+  C
Sbjct: 42  CAPSCCAPAPCLSLVCTPVSCVSSPCCPVTCEPSPCQSGCTSSCTPSCCQQSSCQLAC 99



 Score = 31.1 bits (67), Expect = 4.1
 Identities = 17/62 (27%), Positives = 24/62 (38%), Gaps = 4/62 (6%)
 Frame = -2

Query: 504 CKVSTCAWAKTTMVACTKSSPSSPNCCLGTKSQNSVMAFRLSVC---GCTDCWQT-ICEA 337
           C  S+C    +   AC  SSP    CC+    +        S C    C  C  +  C+A
Sbjct: 130 CGDSSCCQQSSCQSACCTSSPCQQACCVPICCKPVCSGISSSCCQQSSCVSCVSSPCCQA 189

Query: 336 IC 331
           +C
Sbjct: 190 VC 191


>BC125048-1|AAI25049.1|  401|Homo sapiens keratin associated protein
           10-4 protein.
          Length = 401

 Score = 31.9 bits (69), Expect = 2.3
 Identities = 18/58 (31%), Positives = 24/58 (41%)
 Frame = -2

Query: 504 CKVSTCAWAKTTMVACTKSSPSSPNCCLGTKSQNSVMAFRLSVCGCTDCWQTICEAIC 331
           C  S CA A    + CT  S  S  CC  T   +   +   S C  + C Q+ C+  C
Sbjct: 42  CAPSCCAPAPCLSLVCTPVSCVSSPCCPVTCEPSPCQSGCTSSCTPSCCQQSSCQLAC 99



 Score = 31.1 bits (67), Expect = 4.1
 Identities = 17/62 (27%), Positives = 24/62 (38%), Gaps = 4/62 (6%)
 Frame = -2

Query: 504 CKVSTCAWAKTTMVACTKSSPSSPNCCLGTKSQNSVMAFRLSVC---GCTDCWQT-ICEA 337
           C  S+C    +   AC  SSP    CC+    +        S C    C  C  +  C+A
Sbjct: 130 CGDSSCCQQSSCQSACCTSSPCQQACCVPICCKPVCSGISSSCCQQSSCVSCVSSPCCQA 189

Query: 336 IC 331
           +C
Sbjct: 190 VC 191


>BC131613-1|AAI31614.1|  292|Homo sapiens keratin associated protein
           10-9 protein.
          Length = 292

 Score = 31.5 bits (68), Expect = 3.1
 Identities = 19/60 (31%), Positives = 26/60 (43%), Gaps = 1/60 (1%)
 Frame = -2

Query: 504 CKVSTCAWAKTTMVACTKSSPSSPNCCLGTKSQNSVMAFRLSVCGCTDCWQTICE-AICS 328
           C  S CA A    + CT  S  S  CC  T   +   +   S C  + C Q+ C+ A C+
Sbjct: 32  CATSCCAPAPCLTLVCTPVSRVSSPCCQVTCEPSPCQSGCTSSCTPSCCQQSSCQPAYCT 91



 Score = 31.1 bits (67), Expect = 4.1
 Identities = 16/58 (27%), Positives = 23/58 (39%)
 Frame = -2

Query: 504 CKVSTCAWAKTTMVACTKSSPSSPNCCLGTKSQNSVMAFRLSVCGCTDCWQTICEAIC 331
           C  S+C    +   AC  SS   P CC+    +    A   S    + C Q+ C+  C
Sbjct: 115 CGASSCCQQSSYQPACCASSSCQPACCVPVCCKPVCCAPTCSEDSYSCCQQSSCQPAC 172


>AB076364-1|BAD01551.1|  245|Homo sapiens keratin associated protein
           protein.
          Length = 245

 Score = 31.5 bits (68), Expect = 3.1
 Identities = 17/58 (29%), Positives = 24/58 (41%)
 Frame = -2

Query: 504 CKVSTCAWAKTTMVACTKSSPSSPNCCLGTKSQNSVMAFRLSVCGCTDCWQTICEAIC 331
           C+   CA A    + CT  S  S  CC  T   +   +   S C  + C Q+ C+  C
Sbjct: 37  CEPPCCAPAPCLSLVCTPVSRVSSPCCRVTCEPSPCQSGCTSSCTPSCCQQSSCQPAC 94


>AB076356-1|BAD01543.1|  292|Homo sapiens keratin associated protein
           protein.
          Length = 292

 Score = 31.5 bits (68), Expect = 3.1
 Identities = 19/60 (31%), Positives = 26/60 (43%), Gaps = 1/60 (1%)
 Frame = -2

Query: 504 CKVSTCAWAKTTMVACTKSSPSSPNCCLGTKSQNSVMAFRLSVCGCTDCWQTICE-AICS 328
           C  S CA A    + CT  S  S  CC  T   +   +   S C  + C Q+ C+ A C+
Sbjct: 32  CATSCCAPAPCLTLVCTPVSRVSSPCCQVTCEPSPCQSGCTSSCTPSCCQQSSCQPAYCT 91



 Score = 31.1 bits (67), Expect = 4.1
 Identities = 16/58 (27%), Positives = 23/58 (39%)
 Frame = -2

Query: 504 CKVSTCAWAKTTMVACTKSSPSSPNCCLGTKSQNSVMAFRLSVCGCTDCWQTICEAIC 331
           C  S+C    +   AC  SS   P CC+    +    A   S    + C Q+ C+  C
Sbjct: 115 CGASSCCQQSSYQPACCASSSCQPACCVPVCCKPVCCAPTCSEDSYSCCQQSSCQPAC 172


>AB076350-1|BAD01537.1|  221|Homo sapiens keratin associated protein
           protein.
          Length = 221

 Score = 31.5 bits (68), Expect = 3.1
 Identities = 17/58 (29%), Positives = 23/58 (39%)
 Frame = -2

Query: 504 CKVSTCAWAKTTMVACTKSSPSSPNCCLGTKSQNSVMAFRLSVCGCTDCWQTICEAIC 331
           C  S CA A    + CT  S  S  CC      +   +   S C  + C Q+ C+  C
Sbjct: 32  CAPSCCAPAPCLTLVCTPVSCVSSPCCQAACEPSPCQSGCTSSCTPSCCQQSSCQPAC 89


>BC119643-1|AAI19644.1|  370|Homo sapiens keratin associated protein
           10-7 protein.
          Length = 370

 Score = 31.1 bits (67), Expect = 4.1
 Identities = 17/58 (29%), Positives = 24/58 (41%)
 Frame = -2

Query: 504 CKVSTCAWAKTTMVACTKSSPSSPNCCLGTKSQNSVMAFRLSVCGCTDCWQTICEAIC 331
           C+   CA A    + CT  S  S  CC  T   +   +   S C  + C Q+ C+  C
Sbjct: 42  CEPPCCAPAPCLSLVCTPVSYVSSPCCRVTCEPSPCQSGCTSSCTPSCCQQSSCQLAC 99



 Score = 30.7 bits (66), Expect = 5.4
 Identities = 37/151 (24%), Positives = 51/151 (33%)
 Frame = -2

Query: 504 CKVSTCAWAKTTMVACTKSSPSSPNCCLGTKSQNSVMAFRLSVCGCTDCWQTICEAICSL 325
           CK + C  +     AC       P CC+ T S +S    + + C  +   Q  C  +C  
Sbjct: 214 CKPACCT-SSPCQQACCVPVCCKPVCCVPTCSDDSGSCCQPACCTSSQSQQGCCVPVCCK 272

Query: 324 YSMRVTLTGLLEFHTAGQNILLPA*RTTSAAP*NHSNGDLCKLLNLVARAALSHSAEPVL 145
               V +          Q+   PA  TTS    + S   LC+    V R A         
Sbjct: 273 PVCCVPVCSGASTSCCQQSSCQPACCTTSCCRPSSSVSLLCR---PVCRPACCVPVPSCC 329

Query: 144 RPAPELRDSQ*RLHRNCPPSFCAPRSCLSAL 52
            P             +C  S C P SC+S L
Sbjct: 330 APT-----------SSCQASCCRPASCVSLL 349


>BC101162-1|AAI01163.1|  201|Homo sapiens keratin associated protein
           4-12 protein.
          Length = 201

 Score = 31.1 bits (67), Expect = 4.1
 Identities = 19/62 (30%), Positives = 23/62 (37%)
 Frame = -2

Query: 504 CKVSTCAWAKTTMVACTKSSPSSPNCCLGTKSQNSVMAFRLSVCGCTDCWQTICEAICSL 325
           C  +TC        +C  SS   P CC     Q +    R S C  T C  T C   C +
Sbjct: 25  CCQTTCCRTTCCRPSCCVSSCCRPQCCQSVCCQPT--CCRPSCCQTTCCRTTCCRPSCCV 82

Query: 324 YS 319
            S
Sbjct: 83  SS 84



 Score = 30.7 bits (66), Expect = 5.4
 Identities = 15/58 (25%), Positives = 26/58 (44%)
 Frame = -2

Query: 504 CKVSTCAWAKTTMVACTKSSPSSPNCCLGTKSQNSVMAFRLSVCGCTDCWQTICEAIC 331
           C VS+C   +     C + +   P+CC  T  + +    R S C  + C    C+++C
Sbjct: 40  CCVSSCCRPQCCQSVCCQPTCCRPSCCQTTCCRTT--CCRPSCCVSSCCRPQCCQSVC 95



 Score = 30.7 bits (66), Expect = 5.4
 Identities = 15/58 (25%), Positives = 26/58 (44%)
 Frame = -2

Query: 504 CKVSTCAWAKTTMVACTKSSPSSPNCCLGTKSQNSVMAFRLSVCGCTDCWQTICEAIC 331
           C VS+C   +     C + +   P+CC  T  + +    R S C  + C    C+++C
Sbjct: 80  CCVSSCCRPQCCQSVCCQPTCCRPSCCQTTCCRTT--CCRPSCCVSSCCRPQCCQSVC 135


>BC101160-1|AAI01161.1|  201|Homo sapiens keratin associated protein
           4-12 protein.
          Length = 201

 Score = 31.1 bits (67), Expect = 4.1
 Identities = 19/62 (30%), Positives = 23/62 (37%)
 Frame = -2

Query: 504 CKVSTCAWAKTTMVACTKSSPSSPNCCLGTKSQNSVMAFRLSVCGCTDCWQTICEAICSL 325
           C  +TC        +C  SS   P CC     Q +    R S C  T C  T C   C +
Sbjct: 25  CCQTTCCRTTCCRPSCCVSSCCRPQCCQSVCCQPT--CCRPSCCQTTCCRTTCCRPSCCV 82

Query: 324 YS 319
            S
Sbjct: 83  SS 84



 Score = 30.7 bits (66), Expect = 5.4
 Identities = 15/58 (25%), Positives = 26/58 (44%)
 Frame = -2

Query: 504 CKVSTCAWAKTTMVACTKSSPSSPNCCLGTKSQNSVMAFRLSVCGCTDCWQTICEAIC 331
           C VS+C   +     C + +   P+CC  T  + +    R S C  + C    C+++C
Sbjct: 40  CCVSSCCRPQCCQSVCCQPTCCRPSCCQTTCCRTT--CCRPSCCVSSCCRPQCCQSVC 95



 Score = 30.7 bits (66), Expect = 5.4
 Identities = 15/58 (25%), Positives = 26/58 (44%)
 Frame = -2

Query: 504 CKVSTCAWAKTTMVACTKSSPSSPNCCLGTKSQNSVMAFRLSVCGCTDCWQTICEAIC 331
           C VS+C   +     C + +   P+CC  T  + +    R S C  + C    C+++C
Sbjct: 80  CCVSSCCRPQCCQSVCCQPTCCRPSCCQTTCCRTT--CCRPSCCVSSCCRPQCCQSVC 135


>BC101159-1|AAI01160.1|  201|Homo sapiens keratin associated protein
           4-12 protein.
          Length = 201

 Score = 31.1 bits (67), Expect = 4.1
 Identities = 19/62 (30%), Positives = 23/62 (37%)
 Frame = -2

Query: 504 CKVSTCAWAKTTMVACTKSSPSSPNCCLGTKSQNSVMAFRLSVCGCTDCWQTICEAICSL 325
           C  +TC        +C  SS   P CC     Q +    R S C  T C  T C   C +
Sbjct: 25  CCQTTCCRTTCCRPSCCVSSCCRPQCCQSVCCQPT--CCRPSCCQTTCCRTTCCRPSCCV 82

Query: 324 YS 319
            S
Sbjct: 83  SS 84



 Score = 30.7 bits (66), Expect = 5.4
 Identities = 15/58 (25%), Positives = 26/58 (44%)
 Frame = -2

Query: 504 CKVSTCAWAKTTMVACTKSSPSSPNCCLGTKSQNSVMAFRLSVCGCTDCWQTICEAIC 331
           C VS+C   +     C + +   P+CC  T  + +    R S C  + C    C+++C
Sbjct: 40  CCVSSCCRPQCCQSVCCQPTCCRPSCCQTTCCRTT--CCRPSCCVSSCCRPQCCQSVC 95



 Score = 30.7 bits (66), Expect = 5.4
 Identities = 15/58 (25%), Positives = 26/58 (44%)
 Frame = -2

Query: 504 CKVSTCAWAKTTMVACTKSSPSSPNCCLGTKSQNSVMAFRLSVCGCTDCWQTICEAIC 331
           C VS+C   +     C + +   P+CC  T  + +    R S C  + C    C+++C
Sbjct: 80  CCVSSCCRPQCCQSVCCQPTCCRPSCCQTTCCRTT--CCRPSCCVSSCCRPQCCQSVC 135


>BC004212-1|AAH04212.1|  201|Homo sapiens keratin associated protein
           4-12 protein.
          Length = 201

 Score = 31.1 bits (67), Expect = 4.1
 Identities = 19/62 (30%), Positives = 23/62 (37%)
 Frame = -2

Query: 504 CKVSTCAWAKTTMVACTKSSPSSPNCCLGTKSQNSVMAFRLSVCGCTDCWQTICEAICSL 325
           C  +TC        +C  SS   P CC     Q +    R S C  T C  T C   C +
Sbjct: 25  CCQTTCCRTTCCRPSCCVSSCCRPQCCQSVCCQPT--CCRPSCCQTTCCRTTCCRPSCCV 82

Query: 324 YS 319
            S
Sbjct: 83  SS 84



 Score = 30.7 bits (66), Expect = 5.4
 Identities = 15/58 (25%), Positives = 26/58 (44%)
 Frame = -2

Query: 504 CKVSTCAWAKTTMVACTKSSPSSPNCCLGTKSQNSVMAFRLSVCGCTDCWQTICEAIC 331
           C VS+C   +     C + +   P+CC  T  + +    R S C  + C    C+++C
Sbjct: 40  CCVSSCCRPQCCQSVCCQPTCCRPSCCQTTCCRTT--CCRPSCCVSSCCRPQCCQSVC 95



 Score = 30.7 bits (66), Expect = 5.4
 Identities = 15/58 (25%), Positives = 26/58 (44%)
 Frame = -2

Query: 504 CKVSTCAWAKTTMVACTKSSPSSPNCCLGTKSQNSVMAFRLSVCGCTDCWQTICEAIC 331
           C VS+C   +     C + +   P+CC  T  + +    R S C  + C    C+++C
Sbjct: 80  CCVSSCCRPQCCQSVCCQPTCCRPSCCQTTCCRTT--CCRPSCCVSSCCRPQCCQSVC 135


>BC004180-1|AAH04180.1|  201|Homo sapiens keratin associated protein
           4-12 protein.
          Length = 201

 Score = 31.1 bits (67), Expect = 4.1
 Identities = 19/62 (30%), Positives = 23/62 (37%)
 Frame = -2

Query: 504 CKVSTCAWAKTTMVACTKSSPSSPNCCLGTKSQNSVMAFRLSVCGCTDCWQTICEAICSL 325
           C  +TC        +C  SS   P CC     Q +    R S C  T C  T C   C +
Sbjct: 25  CCQTTCCRTTCCRPSCCVSSCCRPQCCQSVCCQPT--CCRPSCCQTTCCRTTCCRPSCCV 82

Query: 324 YS 319
            S
Sbjct: 83  SS 84



 Score = 30.7 bits (66), Expect = 5.4
 Identities = 15/58 (25%), Positives = 26/58 (44%)
 Frame = -2

Query: 504 CKVSTCAWAKTTMVACTKSSPSSPNCCLGTKSQNSVMAFRLSVCGCTDCWQTICEAIC 331
           C VS+C   +     C + +   P+CC  T  + +    R S C  + C    C+++C
Sbjct: 40  CCVSSCCRPQCCQSVCCQPTCCRPSCCQTTCCRTT--CCRPSCCVSSCCRPQCCQSVC 95



 Score = 30.7 bits (66), Expect = 5.4
 Identities = 15/58 (25%), Positives = 26/58 (44%)
 Frame = -2

Query: 504 CKVSTCAWAKTTMVACTKSSPSSPNCCLGTKSQNSVMAFRLSVCGCTDCWQTICEAIC 331
           C VS+C   +     C + +   P+CC  T  + +    R S C  + C    C+++C
Sbjct: 80  CCVSSCCRPQCCQSVCCQPTCCRPSCCQTTCCRTT--CCRPSCCVSSCCRPQCCQSVC 135


>AK126796-1|BAC86698.1|  195|Homo sapiens protein ( Homo sapiens
           cDNA FLJ44846 fis, clone BRACE3051144. ).
          Length = 195

 Score = 31.1 bits (67), Expect = 4.1
 Identities = 19/72 (26%), Positives = 29/72 (40%), Gaps = 7/72 (9%)
 Frame = -2

Query: 498 VSTCAWAKTTMVACTKSSPSSPNCC------LGTKSQNSVMAF-RLSVCGCTDCWQTICE 340
           ++ C W   ++  C   S     C       +G      V  F  +SVCGC   W ++CE
Sbjct: 1   MAVCLWVSLSVCGCLSPSVGISLCLWVSLPSVGVHLCLWVSLFVSVSVCGCLCLWVSLCE 60

Query: 339 AICSLYSMRVTL 304
             C    + V+L
Sbjct: 61  CPCECLCLWVSL 72


>AJ406943-1|CAC27582.1|  201|Homo sapiens keratin associated protein
           4.12 protein.
          Length = 201

 Score = 31.1 bits (67), Expect = 4.1
 Identities = 19/62 (30%), Positives = 23/62 (37%)
 Frame = -2

Query: 504 CKVSTCAWAKTTMVACTKSSPSSPNCCLGTKSQNSVMAFRLSVCGCTDCWQTICEAICSL 325
           C  +TC        +C  SS   P CC     Q +    R S C  T C  T C   C +
Sbjct: 25  CCQTTCCRTTCCRPSCCVSSCCRPQCCQSVCCQPT--CCRPSCCQTTCCRTTCCRPSCCV 82

Query: 324 YS 319
            S
Sbjct: 83  SS 84



 Score = 30.7 bits (66), Expect = 5.4
 Identities = 15/58 (25%), Positives = 26/58 (44%)
 Frame = -2

Query: 504 CKVSTCAWAKTTMVACTKSSPSSPNCCLGTKSQNSVMAFRLSVCGCTDCWQTICEAIC 331
           C VS+C   +     C + +   P+CC  T  + +    R S C  + C    C+++C
Sbjct: 40  CCVSSCCRPQCCQSVCCQPTCCRPSCCQTTCCRTT--CCRPSCCVSSCCRPQCCQSVC 95



 Score = 30.7 bits (66), Expect = 5.4
 Identities = 15/58 (25%), Positives = 26/58 (44%)
 Frame = -2

Query: 504 CKVSTCAWAKTTMVACTKSSPSSPNCCLGTKSQNSVMAFRLSVCGCTDCWQTICEAIC 331
           C VS+C   +     C + +   P+CC  T  + +    R S C  + C    C+++C
Sbjct: 80  CCVSSCCRPQCCQSVCCQPTCCRPSCCQTTCCRTT--CCRPSCCVSSCCRPQCCQSVC 135


>AC007248-2|AAY15047.1|  556|Homo sapiens unknown protein.
          Length = 556

 Score = 31.1 bits (67), Expect = 4.1
 Identities = 24/78 (30%), Positives = 40/78 (51%), Gaps = 1/78 (1%)
 Frame = +3

Query: 21  LTPKTTTNKLRVRKGRSVVHRNLEDNYGAVVIANHEALAQVLEQVQQSATMQPSLRGL-K 197
           LTP+ T NK    +    +H  L  N   V++   EAL++ L+ +Q  A +Q SL+ L K
Sbjct: 448 LTPQITHNKEFAYEQEVALHCALIQNDAKVILIEMEALSE-LDMLQAEA-LQDSLQHLMK 505

Query: 198 ACTNLRWSDFTVQPKSSV 251
               ++W +  +  K S+
Sbjct: 506 VQGTIKWREDHIANKRSL 523


>AB076354-1|BAD01541.1|  370|Homo sapiens keratin associated protein
           protein.
          Length = 370

 Score = 31.1 bits (67), Expect = 4.1
 Identities = 17/58 (29%), Positives = 24/58 (41%)
 Frame = -2

Query: 504 CKVSTCAWAKTTMVACTKSSPSSPNCCLGTKSQNSVMAFRLSVCGCTDCWQTICEAIC 331
           C+   CA A    + CT  S  S  CC  T   +   +   S C  + C Q+ C+  C
Sbjct: 42  CEPPCCAPAPCLSLVCTPVSYVSSPCCRVTCEPSPCQSGCTSSCTPSCCQQSSCQLAC 99



 Score = 30.7 bits (66), Expect = 5.4
 Identities = 37/151 (24%), Positives = 51/151 (33%)
 Frame = -2

Query: 504 CKVSTCAWAKTTMVACTKSSPSSPNCCLGTKSQNSVMAFRLSVCGCTDCWQTICEAICSL 325
           CK + C  +     AC       P CC+ T S +S    + + C  +   Q  C  +C  
Sbjct: 214 CKPACCT-SSPCQQACCVPVCCKPVCCVPTCSDDSGSCCQPACCTSSQSQQGCCVPVCCK 272

Query: 324 YSMRVTLTGLLEFHTAGQNILLPA*RTTSAAP*NHSNGDLCKLLNLVARAALSHSAEPVL 145
               V +          Q+   PA  TTS    + S   LC+    V R A         
Sbjct: 273 PVCCVPVCSGASTSCCQQSSCQPACCTTSCCRPSSSVSLLCR---PVCRPACCVPVPSCC 329

Query: 144 RPAPELRDSQ*RLHRNCPPSFCAPRSCLSAL 52
            P             +C  S C P SC+S L
Sbjct: 330 APT-----------SSCQASCCRPASCVSLL 349


>AB012701-1|BAA82405.2|  556|Homo sapiens ST2L protein.
          Length = 556

 Score = 31.1 bits (67), Expect = 4.1
 Identities = 24/78 (30%), Positives = 40/78 (51%), Gaps = 1/78 (1%)
 Frame = +3

Query: 21  LTPKTTTNKLRVRKGRSVVHRNLEDNYGAVVIANHEALAQVLEQVQQSATMQPSLRGL-K 197
           LTP+ T NK    +    +H  L  N   V++   EAL++ L+ +Q  A +Q SL+ L K
Sbjct: 448 LTPQITHNKEFAYEQEVALHCALIQNDAKVILIEMEALSE-LDMLQAEA-LQDSLQHLMK 505

Query: 198 ACTNLRWSDFTVQPKSSV 251
               ++W +  +  K S+
Sbjct: 506 VQGTIKWREDHIANKRSL 523


>BC131611-1|AAI31612.1|  298|Homo sapiens keratin associated protein
           10-11 protein.
          Length = 298

 Score = 30.7 bits (66), Expect = 5.4
 Identities = 16/55 (29%), Positives = 24/55 (43%)
 Frame = -2

Query: 495 STCAWAKTTMVACTKSSPSSPNCCLGTKSQNSVMAFRLSVCGCTDCWQTICEAIC 331
           S CA A +  + CT  S  S  CC      ++  +   S C  + C Q+ C+  C
Sbjct: 35  SCCAPAPSLSLVCTPVSCVSSPCCQAACEPSACQSGCTSSCTPSCCQQSSCQPAC 89


>AB076359-1|BAD01546.1|  298|Homo sapiens keratin associated protein
           protein.
          Length = 298

 Score = 30.7 bits (66), Expect = 5.4
 Identities = 16/55 (29%), Positives = 24/55 (43%)
 Frame = -2

Query: 495 STCAWAKTTMVACTKSSPSSPNCCLGTKSQNSVMAFRLSVCGCTDCWQTICEAIC 331
           S CA A +  + CT  S  S  CC      ++  +   S C  + C Q+ C+  C
Sbjct: 35  SCCAPAPSLSLVCTPVSCVSSPCCQAACEPSACQSGCTSSCTPSCCQQSSCQPAC 89


>BC130562-1|AAI30563.1|  195|Homo sapiens keratin associated protein
           4-14 protein.
          Length = 195

 Score = 30.3 bits (65), Expect = 7.2
 Identities = 17/65 (26%), Positives = 25/65 (38%), Gaps = 3/65 (4%)
 Frame = -2

Query: 504 CKVSTCAWAKTTMVACTKSSPSSPNCCLGTKSQNSV---MAFRLSVCGCTDCWQTICEAI 334
           C VS+C   +     C + +   P CC+ +  + S       R   C    C  T C   
Sbjct: 79  CCVSSCCKPQCCQSMCCQPTCCRPRCCISSCCRPSCCVSSCCRPQCCQSVCCQPTCCHPS 138

Query: 333 CSLYS 319
           CS+ S
Sbjct: 139 CSISS 143


>BC126131-1|AAI26132.1|  195|Homo sapiens keratin associated protein
           4-14 protein.
          Length = 195

 Score = 30.3 bits (65), Expect = 7.2
 Identities = 17/65 (26%), Positives = 25/65 (38%), Gaps = 3/65 (4%)
 Frame = -2

Query: 504 CKVSTCAWAKTTMVACTKSSPSSPNCCLGTKSQNSV---MAFRLSVCGCTDCWQTICEAI 334
           C VS+C   +     C + +   P CC+ +  + S       R   C    C  T C   
Sbjct: 79  CCVSSCCKPQCCQSMCCQPTCCRPRCCISSCCRPSCCVSSCCRPQCCQSVCCQPTCCHPS 138

Query: 333 CSLYS 319
           CS+ S
Sbjct: 139 CSISS 143


>AK128020-1|BAC87234.1|  595|Homo sapiens ursor.  protein.
          Length = 595

 Score = 30.3 bits (65), Expect = 7.2
 Identities = 17/41 (41%), Positives = 21/41 (51%), Gaps = 1/41 (2%)
 Frame = -2

Query: 177 AALSHSAEPVLRPAPE-LRDSQ*RLHRNCPPSFCAPRSCLS 58
           A LS  + P+L+P P  +R     L    PP F  P SCLS
Sbjct: 442 ACLSGLSVPLLQPTPRSVRLCHLSLRAPLPPPFATPTSCLS 482


>AJ406944-1|CAC27583.1|  195|Homo sapiens keratin associated protein
           4.14 protein.
          Length = 195

 Score = 30.3 bits (65), Expect = 7.2
 Identities = 17/65 (26%), Positives = 25/65 (38%), Gaps = 3/65 (4%)
 Frame = -2

Query: 504 CKVSTCAWAKTTMVACTKSSPSSPNCCLGTKSQNSV---MAFRLSVCGCTDCWQTICEAI 334
           C VS+C   +     C + +   P CC+ +  + S       R   C    C  T C   
Sbjct: 79  CCVSSCCKPQCCQSMCCQPTCCRPRCCISSCCRPSCCVSSCCRPQCCQSVCCQPTCCHPS 138

Query: 333 CSLYS 319
           CS+ S
Sbjct: 139 CSISS 143


>BC127252-1|AAI27253.1|  136|Homo sapiens keratin associated protein
           4-2 protein.
          Length = 136

 Score = 29.9 bits (64), Expect = 9.5
 Identities = 15/56 (26%), Positives = 24/56 (42%), Gaps = 2/56 (3%)
 Frame = -2

Query: 504 CKVSTCAWAKTTMVACTKSSPSSPNCCLGTKSQNSVMAFRLSVCGC--TDCWQTIC 343
           C VS+C   +     C + +  SP+CC  T  + +       V  C    C Q++C
Sbjct: 40  CCVSSCCRPQCCQSVCCQPTCCSPSCCQTTCCRTTCCRPSCCVSSCFRPQCCQSVC 95


>AJ406934-1|CAC27573.1|  136|Homo sapiens keratin associated protein
           4.2 protein.
          Length = 136

 Score = 29.9 bits (64), Expect = 9.5
 Identities = 15/56 (26%), Positives = 24/56 (42%), Gaps = 2/56 (3%)
 Frame = -2

Query: 504 CKVSTCAWAKTTMVACTKSSPSSPNCCLGTKSQNSVMAFRLSVCGC--TDCWQTIC 343
           C VS+C   +     C + +  SP+CC  T  + +       V  C    C Q++C
Sbjct: 40  CCVSSCCRPQCCQSVCCQPTCCSPSCCQTTCCRTTCCRPSCCVSSCFRPQCCQSVC 95


>AB076348-1|BAD01535.1|  255|Homo sapiens keratin associated protein
           protein.
          Length = 255

 Score = 29.9 bits (64), Expect = 9.5
 Identities = 16/55 (29%), Positives = 23/55 (41%)
 Frame = -2

Query: 495 STCAWAKTTMVACTKSSPSSPNCCLGTKSQNSVMAFRLSVCGCTDCWQTICEAIC 331
           S CA A    + CT  S  S  CC      ++  +   S C  + C Q+ C+  C
Sbjct: 35  SCCAPAPCLTLVCTPVSCVSSPCCQAACEPSACQSGCTSSCTPSCCQQSSCQPAC 89


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 109,323,048
Number of Sequences: 237096
Number of extensions: 2450664
Number of successful extensions: 7759
Number of sequences better than 10.0: 42
Number of HSP's better than 10.0 without gapping: 6808
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7672
length of database: 76,859,062
effective HSP length: 88
effective length of database: 55,994,614
effective search space used: 8343197486
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -