SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20072
         (691 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

J04144-1|AAA51684.1| 1306|Homo sapiens DCP1 protein.                   49   1e-05
AY436326-1|AAR03504.1| 1306|Homo sapiens angiotensin I convertin...    49   1e-05
AF118569-1|AAD28560.1| 1306|Homo sapiens angiotensin I convertin...    49   1e-05
AB208971-1|BAD92208.1| 1247|Homo sapiens angiotensin I convertin...    49   1e-05
X16295-1|CAA34362.1|  732|Homo sapiens peptidyl  dipeptidase I p...    46   1e-04
M26658-1|AAA60612.1|  694|Homo sapiens DCP1 protein.                   46   1e-04
M26657-1|AAA60611.1|  732|Homo sapiens DCP1 protein.                   46   1e-04
BC036375-1|AAH36375.1|  739|Homo sapiens angiotensin I convertin...    46   1e-04
AF118569-2|AAD28561.1|  732|Homo sapiens angiotensin I convertin...    46   1e-04
BC048094-1|AAH48094.2|  805|Homo sapiens angiotensin I convertin...    43   9e-04
BC039902-1|AAH39902.1|  805|Homo sapiens angiotensin I convertin...    43   9e-04
AY623811-1|AAT45083.1|  805|Homo sapiens angiotensin converting ...    43   9e-04
AY358714-1|AAQ89076.1|  555|Homo sapiens ACE2 protein.                 43   9e-04
AY217547-1|AAO25651.1|  805|Homo sapiens angiotensin I convertin...    43   9e-04
AL110224-1|CAB53682.1|  804|Homo sapiens hypothetical protein pr...    43   9e-04
AF291820-1|AAF99721.1|  805|Homo sapiens ACE-related carboxypept...    43   9e-04
AF241254-1|AAF78220.1|  805|Homo sapiens angiotensin converting ...    43   9e-04
AB193260-1|BAD99267.1|  805|Homo sapiens angiotensin-converting ...    43   9e-04
AB193259-1|BAD99266.1|  805|Homo sapiens angiotensin-converting ...    43   9e-04
AB046569-1|BAB40370.1|  805|Homo sapiens ACE2 protein.                 43   9e-04
S81361-1|AAD14360.1|  135|Homo sapiens angiotensin I-converting ...    38   0.045
M86868-1|AAA52510.1|  465|Homo sapiens gamma-amino butyric acid ...    31   2.9  
BC130354-1|AAI30355.1|  465|Homo sapiens gamma-aminobutyric acid...    31   2.9  
BC130352-1|AAI30353.1|  465|Homo sapiens gamma-aminobutyric acid...    31   2.9  
AL121833-2|CAC07339.1|  465|Homo sapiens gamma-aminobutyric acid...    31   2.9  
BX538024-1|CAD97970.1|  979|Homo sapiens hypothetical protein pr...    30   8.9  
BC133009-1|AAI33010.1|  979|Homo sapiens ubiquitin specific pept...    30   8.9  
BC133007-1|AAI33008.1|  979|Homo sapiens USP37 protein protein.        30   8.9  
BC112901-1|AAI12902.1|  885|Homo sapiens USP37 protein protein.        30   8.9  
AL832645-1|CAD89955.1|  979|Homo sapiens hypothetical protein pr...    30   8.9  
AL136967-3|CAC09454.3|  276|Homo sapiens natural cytotoxicity tr...    30   8.9  
AL136967-2|CAC09452.3|  270|Homo sapiens natural cytotoxicity tr...    30   8.9  
AL136967-1|CAC09453.3|  258|Homo sapiens natural cytotoxicity tr...    30   8.9  
AB046814-1|BAB13420.1|  931|Homo sapiens KIAA1594 protein protein.     30   8.9  

>J04144-1|AAA51684.1| 1306|Homo sapiens DCP1 protein.
          Length = 1306

 Score = 49.2 bits (112), Expect = 1e-05
 Identities = 23/55 (41%), Positives = 33/55 (60%)
 Frame = +2

Query: 521 VSGMESNYATAKICSYKNESKCDLSLEPEITEIFSTSQDPEELKHAWVEWHNAAG 685
           +S M   Y+TAK+C     + C  SL+P++T I ++S+    L  AW  WHNAAG
Sbjct: 144 LSNMSRIYSTAKVCLPNKTATC-WSLDPDLTNILASSRSYAMLLFAWEGWHNAAG 197



 Score = 46.4 bits (105), Expect = 1e-04
 Identities = 24/78 (30%), Positives = 44/78 (56%)
 Frame = +2

Query: 452 VQEIQSAGRCGSA*RQIPSLMRTVSGMESNYATAKICSYKNESKCDLSLEPEITEIFSTS 631
           ++++Q   R     +++    + +  ME+ Y+ A +C + N S C L LEP++T + +TS
Sbjct: 721 IKKVQDLERAALPAQELEEYNKILLDMETTYSVATVC-HPNGS-C-LQLEPDLTNVMATS 777

Query: 632 QDPEELKHAWVEWHNAAG 685
           +  E+L  AW  W + AG
Sbjct: 778 RKYEDLLWAWEGWRDKAG 795



 Score = 42.7 bits (96), Expect = 0.001
 Identities = 20/82 (24%), Positives = 41/82 (50%)
 Frame = +3

Query: 261 DKATGLRKNRASLAEWEYTSNITKENEEKSIQTHLELSRQEKAAWEETKMYGWQDFQDFT 440
           D+ + +  N  + A W Y +NIT E  +  +Q +++++        + + +     Q+ T
Sbjct: 657 DRTSQVVWNEYAEANWNYNTNITTETSKILLQKNMQIANHTLKYGTQARKFDVNQLQNTT 716

Query: 441 LRRMFKKYSQLGVAALPDDKFQ 506
           ++R+ KK   L  AALP  + +
Sbjct: 717 IKRIIKKVQDLERAALPAQELE 738



 Score = 39.9 bits (89), Expect = 0.008
 Identities = 30/85 (35%), Positives = 42/85 (49%), Gaps = 4/85 (4%)
 Frame = +3

Query: 300 AEWEYTSNITKENEEKSIQTHLELSRQEKAAWEET--KMYG--WQDFQDFTLRRMFKKYS 467
           A W + +NIT EN  +  +  L LS++   AW +   ++Y   WQ+F D  LRR+     
Sbjct: 67  ASWAHDTNITAENARRQEEAAL-LSQEFAEAWGQKAKELYEPIWQNFTDPQLRRIIGAVR 125

Query: 468 QLGVAALPDDKFQA**ELYREWNRI 542
            LG A LP  K Q    L    +RI
Sbjct: 126 TLGSANLPLAKRQQYNALLSNMSRI 150


>AY436326-1|AAR03504.1| 1306|Homo sapiens angiotensin I converting
           enzyme (peptidyl-dipeptidase A) 1 protein.
          Length = 1306

 Score = 49.2 bits (112), Expect = 1e-05
 Identities = 23/55 (41%), Positives = 33/55 (60%)
 Frame = +2

Query: 521 VSGMESNYATAKICSYKNESKCDLSLEPEITEIFSTSQDPEELKHAWVEWHNAAG 685
           +S M   Y+TAK+C     + C  SL+P++T I ++S+    L  AW  WHNAAG
Sbjct: 144 LSNMSRIYSTAKVCLPNKTATC-WSLDPDLTNILASSRSYAMLLFAWEGWHNAAG 197



 Score = 46.4 bits (105), Expect = 1e-04
 Identities = 24/78 (30%), Positives = 44/78 (56%)
 Frame = +2

Query: 452 VQEIQSAGRCGSA*RQIPSLMRTVSGMESNYATAKICSYKNESKCDLSLEPEITEIFSTS 631
           ++++Q   R     +++    + +  ME+ Y+ A +C + N S C L LEP++T + +TS
Sbjct: 721 IKKVQDLERAALPAQELEEYNKILLDMETTYSVATVC-HPNGS-C-LQLEPDLTNVMATS 777

Query: 632 QDPEELKHAWVEWHNAAG 685
           +  E+L  AW  W + AG
Sbjct: 778 RKYEDLLWAWEGWRDKAG 795



 Score = 42.7 bits (96), Expect = 0.001
 Identities = 20/82 (24%), Positives = 41/82 (50%)
 Frame = +3

Query: 261 DKATGLRKNRASLAEWEYTSNITKENEEKSIQTHLELSRQEKAAWEETKMYGWQDFQDFT 440
           D+ + +  N  + A W Y +NIT E  +  +Q +++++        + + +     Q+ T
Sbjct: 657 DRTSQVVWNEYAEANWNYNTNITTETSKILLQKNMQIANHTLKYGTQARKFDVNQLQNTT 716

Query: 441 LRRMFKKYSQLGVAALPDDKFQ 506
           ++R+ KK   L  AALP  + +
Sbjct: 717 IKRIIKKVQDLERAALPAQELE 738



 Score = 39.9 bits (89), Expect = 0.008
 Identities = 30/85 (35%), Positives = 42/85 (49%), Gaps = 4/85 (4%)
 Frame = +3

Query: 300 AEWEYTSNITKENEEKSIQTHLELSRQEKAAWEET--KMYG--WQDFQDFTLRRMFKKYS 467
           A W + +NIT EN  +  +  L LS++   AW +   ++Y   WQ+F D  LRR+     
Sbjct: 67  ASWAHDTNITAENARRQEEAAL-LSQEFAEAWGQKAKELYEPIWQNFTDPQLRRIIGAVR 125

Query: 468 QLGVAALPDDKFQA**ELYREWNRI 542
            LG A LP  K Q    L    +RI
Sbjct: 126 TLGSANLPLAKRQQYNALLSNMSRI 150


>AF118569-1|AAD28560.1| 1306|Homo sapiens angiotensin I converting
           enzyme precursor protein.
          Length = 1306

 Score = 49.2 bits (112), Expect = 1e-05
 Identities = 23/55 (41%), Positives = 33/55 (60%)
 Frame = +2

Query: 521 VSGMESNYATAKICSYKNESKCDLSLEPEITEIFSTSQDPEELKHAWVEWHNAAG 685
           +S M   Y+TAK+C     + C  SL+P++T I ++S+    L  AW  WHNAAG
Sbjct: 144 LSNMSRIYSTAKVCLPNKTATC-WSLDPDLTNILASSRSYAMLLFAWEGWHNAAG 197



 Score = 46.4 bits (105), Expect = 1e-04
 Identities = 24/78 (30%), Positives = 44/78 (56%)
 Frame = +2

Query: 452 VQEIQSAGRCGSA*RQIPSLMRTVSGMESNYATAKICSYKNESKCDLSLEPEITEIFSTS 631
           ++++Q   R     +++    + +  ME+ Y+ A +C + N S C L LEP++T + +TS
Sbjct: 721 IKKVQDLERAALPAQELEEYNKILLDMETTYSVATVC-HPNGS-C-LQLEPDLTNVMATS 777

Query: 632 QDPEELKHAWVEWHNAAG 685
           +  E+L  AW  W + AG
Sbjct: 778 RKYEDLLWAWEGWRDKAG 795



 Score = 42.7 bits (96), Expect = 0.001
 Identities = 20/82 (24%), Positives = 41/82 (50%)
 Frame = +3

Query: 261 DKATGLRKNRASLAEWEYTSNITKENEEKSIQTHLELSRQEKAAWEETKMYGWQDFQDFT 440
           D+ + +  N  + A W Y +NIT E  +  +Q +++++        + + +     Q+ T
Sbjct: 657 DRTSQVVWNEYAEANWNYNTNITTETSKILLQKNMQIANHTLKYGTQARKFDVNQLQNTT 716

Query: 441 LRRMFKKYSQLGVAALPDDKFQ 506
           ++R+ KK   L  AALP  + +
Sbjct: 717 IKRIIKKVQDLERAALPAQELE 738



 Score = 39.9 bits (89), Expect = 0.008
 Identities = 30/85 (35%), Positives = 42/85 (49%), Gaps = 4/85 (4%)
 Frame = +3

Query: 300 AEWEYTSNITKENEEKSIQTHLELSRQEKAAWEET--KMYG--WQDFQDFTLRRMFKKYS 467
           A W + +NIT EN  +  +  L LS++   AW +   ++Y   WQ+F D  LRR+     
Sbjct: 67  ASWAHDTNITAENARRQEEAAL-LSQEFAEAWGQKAKELYEPIWQNFTDPQLRRIIGAVR 125

Query: 468 QLGVAALPDDKFQA**ELYREWNRI 542
            LG A LP  K Q    L    +RI
Sbjct: 126 TLGSANLPLAKRQQYNALLSNMSRI 150


>AB208971-1|BAD92208.1| 1247|Homo sapiens angiotensin I converting
           enzyme isoform 1 precursor variant protein.
          Length = 1247

 Score = 49.2 bits (112), Expect = 1e-05
 Identities = 23/55 (41%), Positives = 33/55 (60%)
 Frame = +2

Query: 521 VSGMESNYATAKICSYKNESKCDLSLEPEITEIFSTSQDPEELKHAWVEWHNAAG 685
           +S M   Y+TAK+C     + C  SL+P++T I ++S+    L  AW  WHNAAG
Sbjct: 152 LSNMSRIYSTAKVCLPNKTATC-WSLDPDLTNILASSRSYAMLLFAWEGWHNAAG 205



 Score = 46.4 bits (105), Expect = 1e-04
 Identities = 24/78 (30%), Positives = 44/78 (56%)
 Frame = +2

Query: 452 VQEIQSAGRCGSA*RQIPSLMRTVSGMESNYATAKICSYKNESKCDLSLEPEITEIFSTS 631
           ++++Q   R     +++    + +  ME+ Y+ A +C + N S C L LEP++T + +TS
Sbjct: 729 IKKVQDLERAALPAQELEEYNKILLDMETTYSVATVC-HPNGS-C-LQLEPDLTNVMATS 785

Query: 632 QDPEELKHAWVEWHNAAG 685
           +  E+L  AW  W + AG
Sbjct: 786 RKYEDLLWAWEGWRDKAG 803



 Score = 42.7 bits (96), Expect = 0.001
 Identities = 20/82 (24%), Positives = 41/82 (50%)
 Frame = +3

Query: 261 DKATGLRKNRASLAEWEYTSNITKENEEKSIQTHLELSRQEKAAWEETKMYGWQDFQDFT 440
           D+ + +  N  + A W Y +NIT E  +  +Q +++++        + + +     Q+ T
Sbjct: 665 DRTSQVVWNEYAEANWNYNTNITTETSKILLQKNMQIANHTLKYGTQARKFDVNQLQNTT 724

Query: 441 LRRMFKKYSQLGVAALPDDKFQ 506
           ++R+ KK   L  AALP  + +
Sbjct: 725 IKRIIKKVQDLERAALPAQELE 746



 Score = 39.9 bits (89), Expect = 0.008
 Identities = 30/85 (35%), Positives = 42/85 (49%), Gaps = 4/85 (4%)
 Frame = +3

Query: 300 AEWEYTSNITKENEEKSIQTHLELSRQEKAAWEET--KMYG--WQDFQDFTLRRMFKKYS 467
           A W + +NIT EN  +  +  L LS++   AW +   ++Y   WQ+F D  LRR+     
Sbjct: 75  ASWAHDTNITAENARRQEEAAL-LSQEFAEAWGQKAKELYEPIWQNFTDPQLRRIIGAVR 133

Query: 468 QLGVAALPDDKFQA**ELYREWNRI 542
            LG A LP  K Q    L    +RI
Sbjct: 134 TLGSANLPLAKRQQYNALLSNMSRI 158


>X16295-1|CAA34362.1|  732|Homo sapiens peptidyl  dipeptidase I
           protein.
          Length = 732

 Score = 46.4 bits (105), Expect = 1e-04
 Identities = 24/78 (30%), Positives = 44/78 (56%)
 Frame = +2

Query: 452 VQEIQSAGRCGSA*RQIPSLMRTVSGMESNYATAKICSYKNESKCDLSLEPEITEIFSTS 631
           ++++Q   R     +++    + +  ME+ Y+ A +C + N S C L LEP++T + +TS
Sbjct: 147 IKKVQDLERAALPAQELEEYNKILLDMETTYSVATVC-HPNGS-C-LQLEPDLTNVMATS 203

Query: 632 QDPEELKHAWVEWHNAAG 685
           +  E+L  AW  W + AG
Sbjct: 204 RKYEDLLWAWEGWRDKAG 221



 Score = 42.7 bits (96), Expect = 0.001
 Identities = 20/82 (24%), Positives = 41/82 (50%)
 Frame = +3

Query: 261 DKATGLRKNRASLAEWEYTSNITKENEEKSIQTHLELSRQEKAAWEETKMYGWQDFQDFT 440
           D+ + +  N  + A W Y +NIT E  +  +Q +++++        + + +     Q+ T
Sbjct: 83  DRTSQVVWNEYAEANWNYNTNITTETSKILLQKNMQIANHTLKYGTQARKFDVNQLQNTT 142

Query: 441 LRRMFKKYSQLGVAALPDDKFQ 506
           ++R+ KK   L  AALP  + +
Sbjct: 143 IKRIIKKVQDLERAALPAQELE 164


>M26658-1|AAA60612.1|  694|Homo sapiens DCP1 protein.
          Length = 694

 Score = 46.4 bits (105), Expect = 1e-04
 Identities = 24/78 (30%), Positives = 44/78 (56%)
 Frame = +2

Query: 452 VQEIQSAGRCGSA*RQIPSLMRTVSGMESNYATAKICSYKNESKCDLSLEPEITEIFSTS 631
           ++++Q   R     +++    + +  ME+ Y+ A +C + N S C L LEP++T + +TS
Sbjct: 109 IKKVQDLERAALPAQELEEYNKILLDMETTYSVATVC-HPNGS-C-LQLEPDLTNVMATS 165

Query: 632 QDPEELKHAWVEWHNAAG 685
           +  E+L  AW  W + AG
Sbjct: 166 RKYEDLLWAWEGWRDKAG 183


>M26657-1|AAA60611.1|  732|Homo sapiens DCP1 protein.
          Length = 732

 Score = 46.4 bits (105), Expect = 1e-04
 Identities = 24/78 (30%), Positives = 44/78 (56%)
 Frame = +2

Query: 452 VQEIQSAGRCGSA*RQIPSLMRTVSGMESNYATAKICSYKNESKCDLSLEPEITEIFSTS 631
           ++++Q   R     +++    + +  ME+ Y+ A +C + N S C L LEP++T + +TS
Sbjct: 147 IKKVQDLERAALPAQELEEYNKILLDMETTYSVATVC-HPNGS-C-LQLEPDLTNVMATS 203

Query: 632 QDPEELKHAWVEWHNAAG 685
           +  E+L  AW  W + AG
Sbjct: 204 RKYEDLLWAWEGWRDKAG 221



 Score = 42.7 bits (96), Expect = 0.001
 Identities = 20/82 (24%), Positives = 41/82 (50%)
 Frame = +3

Query: 261 DKATGLRKNRASLAEWEYTSNITKENEEKSIQTHLELSRQEKAAWEETKMYGWQDFQDFT 440
           D+ + +  N  + A W Y +NIT E  +  +Q +++++        + + +     Q+ T
Sbjct: 83  DRTSQVVWNEYAEANWNYNTNITTETSKILLQKNMQIANHTLKYGTQARKFDVNQLQNTT 142

Query: 441 LRRMFKKYSQLGVAALPDDKFQ 506
           ++R+ KK   L  AALP  + +
Sbjct: 143 IKRIIKKVQDLERAALPAQELE 164


>BC036375-1|AAH36375.1|  739|Homo sapiens angiotensin I converting
           enzyme (peptidyl-dipeptidase A) 1 protein.
          Length = 739

 Score = 46.4 bits (105), Expect = 1e-04
 Identities = 24/78 (30%), Positives = 44/78 (56%)
 Frame = +2

Query: 452 VQEIQSAGRCGSA*RQIPSLMRTVSGMESNYATAKICSYKNESKCDLSLEPEITEIFSTS 631
           ++++Q   R     +++    + +  ME+ Y+ A +C + N S C L LEP++T + +TS
Sbjct: 147 IKKVQDLERAALPAQELEEYNKILLDMETTYSVATVC-HPNGS-C-LQLEPDLTNVMATS 203

Query: 632 QDPEELKHAWVEWHNAAG 685
           +  E+L  AW  W + AG
Sbjct: 204 RKYEDLLWAWEGWRDKAG 221



 Score = 42.7 bits (96), Expect = 0.001
 Identities = 20/82 (24%), Positives = 41/82 (50%)
 Frame = +3

Query: 261 DKATGLRKNRASLAEWEYTSNITKENEEKSIQTHLELSRQEKAAWEETKMYGWQDFQDFT 440
           D+ + +  N  + A W Y +NIT E  +  +Q +++++        + + +     Q+ T
Sbjct: 83  DRTSQVVWNEYAEANWNYNTNITTETSKILLQKNMQIANHTLKYGTQARKFDVNQLQNTT 142

Query: 441 LRRMFKKYSQLGVAALPDDKFQ 506
           ++R+ KK   L  AALP  + +
Sbjct: 143 IKRIIKKVQDLERAALPAQELE 164


>AF118569-2|AAD28561.1|  732|Homo sapiens angiotensin I converting
           enzyme precursor protein.
          Length = 732

 Score = 46.4 bits (105), Expect = 1e-04
 Identities = 24/78 (30%), Positives = 44/78 (56%)
 Frame = +2

Query: 452 VQEIQSAGRCGSA*RQIPSLMRTVSGMESNYATAKICSYKNESKCDLSLEPEITEIFSTS 631
           ++++Q   R     +++    + +  ME+ Y+ A +C + N S C L LEP++T + +TS
Sbjct: 147 IKKVQDLERAALPAQELEEYNKILLDMETTYSVATVC-HPNGS-C-LQLEPDLTNVMATS 203

Query: 632 QDPEELKHAWVEWHNAAG 685
           +  E+L  AW  W + AG
Sbjct: 204 RKYEDLLWAWEGWRDKAG 221



 Score = 42.7 bits (96), Expect = 0.001
 Identities = 20/82 (24%), Positives = 41/82 (50%)
 Frame = +3

Query: 261 DKATGLRKNRASLAEWEYTSNITKENEEKSIQTHLELSRQEKAAWEETKMYGWQDFQDFT 440
           D+ + +  N  + A W Y +NIT E  +  +Q +++++        + + +     Q+ T
Sbjct: 83  DRTSQVVWNEYAEANWNYNTNITTETSKILLQKNMQIANHTLKYGTQARKFDVNQLQNTT 142

Query: 441 LRRMFKKYSQLGVAALPDDKFQ 506
           ++R+ KK   L  AALP  + +
Sbjct: 143 IKRIIKKVQDLERAALPAQELE 164


>BC048094-1|AAH48094.2|  805|Homo sapiens angiotensin I converting
           enzyme (peptidyl-dipeptidase A) 2 protein.
          Length = 805

 Score = 43.2 bits (97), Expect = 9e-04
 Identities = 24/78 (30%), Positives = 38/78 (48%)
 Frame = +2

Query: 452 VQEIQSAGRCGSA*RQIPSLMRTVSGMESNYATAKICSYKNESKCDLSLEPEITEIFSTS 631
           +Q +Q  G    +  +   L   ++ M + Y+T K+C+  N  +C L LEP + EI + S
Sbjct: 97  LQALQQNGSSVLSEDKSKRLNTILNTMSTIYSTGKVCNPDNPQEC-LLLEPGLNEIMANS 155

Query: 632 QDPEELKHAWVEWHNAAG 685
            D  E   AW  W +  G
Sbjct: 156 LDYNERLWAWESWRSEVG 173



 Score = 41.1 bits (92), Expect = 0.004
 Identities = 22/71 (30%), Positives = 36/71 (50%)
 Frame = +3

Query: 288 RASLAEWEYTSNITKENEEKSIQTHLELSRQEKAAWEETKMYGWQDFQDFTLRRMFKKYS 467
           ++SLA W Y +NIT+EN +       + S   K      +MY  Q+ Q+ T++   +   
Sbjct: 42  QSSLASWNYNTNITEENVQNMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQ 101

Query: 468 QLGVAALPDDK 500
           Q G + L +DK
Sbjct: 102 QNGSSVLSEDK 112


>BC039902-1|AAH39902.1|  805|Homo sapiens angiotensin I converting
           enzyme (peptidyl-dipeptidase A) 2 protein.
          Length = 805

 Score = 43.2 bits (97), Expect = 9e-04
 Identities = 24/78 (30%), Positives = 38/78 (48%)
 Frame = +2

Query: 452 VQEIQSAGRCGSA*RQIPSLMRTVSGMESNYATAKICSYKNESKCDLSLEPEITEIFSTS 631
           +Q +Q  G    +  +   L   ++ M + Y+T K+C+  N  +C L LEP + EI + S
Sbjct: 97  LQALQQNGSSVLSEDKSKRLNTILNTMSTIYSTGKVCNPDNPQEC-LLLEPGLNEIMANS 155

Query: 632 QDPEELKHAWVEWHNAAG 685
            D  E   AW  W +  G
Sbjct: 156 LDYNERLWAWESWRSEVG 173



 Score = 41.1 bits (92), Expect = 0.004
 Identities = 22/71 (30%), Positives = 36/71 (50%)
 Frame = +3

Query: 288 RASLAEWEYTSNITKENEEKSIQTHLELSRQEKAAWEETKMYGWQDFQDFTLRRMFKKYS 467
           ++SLA W Y +NIT+EN +       + S   K      +MY  Q+ Q+ T++   +   
Sbjct: 42  QSSLASWNYNTNITEENVQNMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQ 101

Query: 468 QLGVAALPDDK 500
           Q G + L +DK
Sbjct: 102 QNGSSVLSEDK 112


>AY623811-1|AAT45083.1|  805|Homo sapiens angiotensin converting
           enzyme 2 protein.
          Length = 805

 Score = 43.2 bits (97), Expect = 9e-04
 Identities = 24/78 (30%), Positives = 38/78 (48%)
 Frame = +2

Query: 452 VQEIQSAGRCGSA*RQIPSLMRTVSGMESNYATAKICSYKNESKCDLSLEPEITEIFSTS 631
           +Q +Q  G    +  +   L   ++ M + Y+T K+C+  N  +C L LEP + EI + S
Sbjct: 97  LQALQQNGSSVLSEDKSKRLNTILNTMSTIYSTGKVCNPDNPQEC-LLLEPGLNEIMANS 155

Query: 632 QDPEELKHAWVEWHNAAG 685
            D  E   AW  W +  G
Sbjct: 156 LDYNERLWAWESWRSEVG 173



 Score = 41.1 bits (92), Expect = 0.004
 Identities = 22/71 (30%), Positives = 36/71 (50%)
 Frame = +3

Query: 288 RASLAEWEYTSNITKENEEKSIQTHLELSRQEKAAWEETKMYGWQDFQDFTLRRMFKKYS 467
           ++SLA W Y +NIT+EN +       + S   K      +MY  Q+ Q+ T++   +   
Sbjct: 42  QSSLASWNYNTNITEENVQNMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQ 101

Query: 468 QLGVAALPDDK 500
           Q G + L +DK
Sbjct: 102 QNGSSVLSEDK 112


>AY358714-1|AAQ89076.1|  555|Homo sapiens ACE2 protein.
          Length = 555

 Score = 43.2 bits (97), Expect = 9e-04
 Identities = 24/78 (30%), Positives = 38/78 (48%)
 Frame = +2

Query: 452 VQEIQSAGRCGSA*RQIPSLMRTVSGMESNYATAKICSYKNESKCDLSLEPEITEIFSTS 631
           +Q +Q  G    +  +   L   ++ M + Y+T K+C+  N  +C L LEP + EI + S
Sbjct: 97  LQALQQNGSSVLSEDKSKRLNTILNTMSTIYSTGKVCNPDNPQEC-LLLEPGLNEIMANS 155

Query: 632 QDPEELKHAWVEWHNAAG 685
            D  E   AW  W +  G
Sbjct: 156 LDYNERLWAWESWRSEVG 173



 Score = 41.1 bits (92), Expect = 0.004
 Identities = 22/71 (30%), Positives = 36/71 (50%)
 Frame = +3

Query: 288 RASLAEWEYTSNITKENEEKSIQTHLELSRQEKAAWEETKMYGWQDFQDFTLRRMFKKYS 467
           ++SLA W Y +NIT+EN +       + S   K      +MY  Q+ Q+ T++   +   
Sbjct: 42  QSSLASWNYNTNITEENVQNMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQ 101

Query: 468 QLGVAALPDDK 500
           Q G + L +DK
Sbjct: 102 QNGSSVLSEDK 112


>AY217547-1|AAO25651.1|  805|Homo sapiens angiotensin I converting
           enzyme (peptidyl-dipeptidase A) 2 protein.
          Length = 805

 Score = 43.2 bits (97), Expect = 9e-04
 Identities = 24/78 (30%), Positives = 38/78 (48%)
 Frame = +2

Query: 452 VQEIQSAGRCGSA*RQIPSLMRTVSGMESNYATAKICSYKNESKCDLSLEPEITEIFSTS 631
           +Q +Q  G    +  +   L   ++ M + Y+T K+C+  N  +C L LEP + EI + S
Sbjct: 97  LQALQQNGSSVLSEDKSKRLNTILNTMSTIYSTGKVCNPDNPQEC-LLLEPGLNEIMANS 155

Query: 632 QDPEELKHAWVEWHNAAG 685
            D  E   AW  W +  G
Sbjct: 156 LDYNERLWAWESWRSEVG 173



 Score = 41.1 bits (92), Expect = 0.004
 Identities = 22/71 (30%), Positives = 36/71 (50%)
 Frame = +3

Query: 288 RASLAEWEYTSNITKENEEKSIQTHLELSRQEKAAWEETKMYGWQDFQDFTLRRMFKKYS 467
           ++SLA W Y +NIT+EN +       + S   K      +MY  Q+ Q+ T++   +   
Sbjct: 42  QSSLASWNYNTNITEENVQNMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQ 101

Query: 468 QLGVAALPDDK 500
           Q G + L +DK
Sbjct: 102 QNGSSVLSEDK 112


>AL110224-1|CAB53682.1|  804|Homo sapiens hypothetical protein
           protein.
          Length = 804

 Score = 43.2 bits (97), Expect = 9e-04
 Identities = 24/78 (30%), Positives = 38/78 (48%)
 Frame = +2

Query: 452 VQEIQSAGRCGSA*RQIPSLMRTVSGMESNYATAKICSYKNESKCDLSLEPEITEIFSTS 631
           +Q +Q  G    +  +   L   ++ M + Y+T K+C+  N  +C L LEP + EI + S
Sbjct: 96  LQALQQNGSSVLSEDKSKRLNTILNTMSTIYSTGKVCNPDNPQEC-LLLEPGLNEIMANS 154

Query: 632 QDPEELKHAWVEWHNAAG 685
            D  E   AW  W +  G
Sbjct: 155 LDYNERLWAWESWRSEVG 172



 Score = 41.1 bits (92), Expect = 0.004
 Identities = 22/71 (30%), Positives = 36/71 (50%)
 Frame = +3

Query: 288 RASLAEWEYTSNITKENEEKSIQTHLELSRQEKAAWEETKMYGWQDFQDFTLRRMFKKYS 467
           ++SLA W Y +NIT+EN +       + S   K      +MY  Q+ Q+ T++   +   
Sbjct: 41  QSSLASWNYNTNITEENVQNMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQ 100

Query: 468 QLGVAALPDDK 500
           Q G + L +DK
Sbjct: 101 QNGSSVLSEDK 111


>AF291820-1|AAF99721.1|  805|Homo sapiens ACE-related
           carboxypeptidase ACE2 protein.
          Length = 805

 Score = 43.2 bits (97), Expect = 9e-04
 Identities = 24/78 (30%), Positives = 38/78 (48%)
 Frame = +2

Query: 452 VQEIQSAGRCGSA*RQIPSLMRTVSGMESNYATAKICSYKNESKCDLSLEPEITEIFSTS 631
           +Q +Q  G    +  +   L   ++ M + Y+T K+C+  N  +C L LEP + EI + S
Sbjct: 97  LQALQQNGSSVLSEDKSKRLNTILNTMSTIYSTGKVCNPDNPQEC-LLLEPGLNEIMANS 155

Query: 632 QDPEELKHAWVEWHNAAG 685
            D  E   AW  W +  G
Sbjct: 156 LDYNERLWAWESWRSEVG 173



 Score = 41.1 bits (92), Expect = 0.004
 Identities = 22/71 (30%), Positives = 36/71 (50%)
 Frame = +3

Query: 288 RASLAEWEYTSNITKENEEKSIQTHLELSRQEKAAWEETKMYGWQDFQDFTLRRMFKKYS 467
           ++SLA W Y +NIT+EN +       + S   K      +MY  Q+ Q+ T++   +   
Sbjct: 42  QSSLASWNYNTNITEENVQNMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQ 101

Query: 468 QLGVAALPDDK 500
           Q G + L +DK
Sbjct: 102 QNGSSVLSEDK 112


>AF241254-1|AAF78220.1|  805|Homo sapiens angiotensin converting
           enzyme-like protein protein.
          Length = 805

 Score = 43.2 bits (97), Expect = 9e-04
 Identities = 24/78 (30%), Positives = 38/78 (48%)
 Frame = +2

Query: 452 VQEIQSAGRCGSA*RQIPSLMRTVSGMESNYATAKICSYKNESKCDLSLEPEITEIFSTS 631
           +Q +Q  G    +  +   L   ++ M + Y+T K+C+  N  +C L LEP + EI + S
Sbjct: 97  LQALQQNGSSVLSEDKSKRLNTILNTMSTIYSTGKVCNPDNPQEC-LLLEPGLNEIMANS 155

Query: 632 QDPEELKHAWVEWHNAAG 685
            D  E   AW  W +  G
Sbjct: 156 LDYNERLWAWESWRSEVG 173



 Score = 41.1 bits (92), Expect = 0.004
 Identities = 22/71 (30%), Positives = 36/71 (50%)
 Frame = +3

Query: 288 RASLAEWEYTSNITKENEEKSIQTHLELSRQEKAAWEETKMYGWQDFQDFTLRRMFKKYS 467
           ++SLA W Y +NIT+EN +       + S   K      +MY  Q+ Q+ T++   +   
Sbjct: 42  QSSLASWNYNTNITEENVQNMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQ 101

Query: 468 QLGVAALPDDK 500
           Q G + L +DK
Sbjct: 102 QNGSSVLSEDK 112


>AB193260-1|BAD99267.1|  805|Homo sapiens angiotensin-converting
           enzyme 2 protein.
          Length = 805

 Score = 43.2 bits (97), Expect = 9e-04
 Identities = 24/78 (30%), Positives = 38/78 (48%)
 Frame = +2

Query: 452 VQEIQSAGRCGSA*RQIPSLMRTVSGMESNYATAKICSYKNESKCDLSLEPEITEIFSTS 631
           +Q +Q  G    +  +   L   ++ M + Y+T K+C+  N  +C L LEP + EI + S
Sbjct: 97  LQALQQNGSSVLSEDKSKRLNTILNTMSTIYSTGKVCNPDNPQEC-LLLEPGLNEIMANS 155

Query: 632 QDPEELKHAWVEWHNAAG 685
            D  E   AW  W +  G
Sbjct: 156 LDYNERLWAWESWRSEVG 173



 Score = 41.1 bits (92), Expect = 0.004
 Identities = 22/71 (30%), Positives = 36/71 (50%)
 Frame = +3

Query: 288 RASLAEWEYTSNITKENEEKSIQTHLELSRQEKAAWEETKMYGWQDFQDFTLRRMFKKYS 467
           ++SLA W Y +NIT+EN +       + S   K      +MY  Q+ Q+ T++   +   
Sbjct: 42  QSSLASWNYNTNITEENVQNMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQ 101

Query: 468 QLGVAALPDDK 500
           Q G + L +DK
Sbjct: 102 QNGSSVLSEDK 112


>AB193259-1|BAD99266.1|  805|Homo sapiens angiotensin-converting
           enzyme 2 protein.
          Length = 805

 Score = 43.2 bits (97), Expect = 9e-04
 Identities = 24/78 (30%), Positives = 38/78 (48%)
 Frame = +2

Query: 452 VQEIQSAGRCGSA*RQIPSLMRTVSGMESNYATAKICSYKNESKCDLSLEPEITEIFSTS 631
           +Q +Q  G    +  +   L   ++ M + Y+T K+C+  N  +C L LEP + EI + S
Sbjct: 97  LQALQQNGSSVLSEDKSKRLNTILNTMSTIYSTGKVCNPDNPQEC-LLLEPGLNEIMANS 155

Query: 632 QDPEELKHAWVEWHNAAG 685
            D  E   AW  W +  G
Sbjct: 156 LDYNERLWAWESWRSEVG 173



 Score = 41.1 bits (92), Expect = 0.004
 Identities = 22/71 (30%), Positives = 36/71 (50%)
 Frame = +3

Query: 288 RASLAEWEYTSNITKENEEKSIQTHLELSRQEKAAWEETKMYGWQDFQDFTLRRMFKKYS 467
           ++SLA W Y +NIT+EN +       + S   K      +MY  Q+ Q+ T++   +   
Sbjct: 42  QSSLASWNYNTNITEENVQNMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQ 101

Query: 468 QLGVAALPDDK 500
           Q G + L +DK
Sbjct: 102 QNGSSVLSEDK 112


>AB046569-1|BAB40370.1|  805|Homo sapiens ACE2 protein.
          Length = 805

 Score = 43.2 bits (97), Expect = 9e-04
 Identities = 24/78 (30%), Positives = 38/78 (48%)
 Frame = +2

Query: 452 VQEIQSAGRCGSA*RQIPSLMRTVSGMESNYATAKICSYKNESKCDLSLEPEITEIFSTS 631
           +Q +Q  G    +  +   L   ++ M + Y+T K+C+  N  +C L LEP + EI + S
Sbjct: 97  LQALQQNGSSVLSEDKSKRLNTILNTMSTIYSTGKVCNPDNPQEC-LLLEPGLNEIMANS 155

Query: 632 QDPEELKHAWVEWHNAAG 685
            D  E   AW  W +  G
Sbjct: 156 LDYNERLWAWESWRSEVG 173



 Score = 41.1 bits (92), Expect = 0.004
 Identities = 22/71 (30%), Positives = 36/71 (50%)
 Frame = +3

Query: 288 RASLAEWEYTSNITKENEEKSIQTHLELSRQEKAAWEETKMYGWQDFQDFTLRRMFKKYS 467
           ++SLA W Y +NIT+EN +       + S   K      +MY  Q+ Q+ T++   +   
Sbjct: 42  QSSLASWNYNTNITEENVQNMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQ 101

Query: 468 QLGVAALPDDK 500
           Q G + L +DK
Sbjct: 102 QNGSSVLSEDK 112


>S81361-1|AAD14360.1|  135|Homo sapiens angiotensin I-converting
           enzyme protein.
          Length = 135

 Score = 37.5 bits (83), Expect = 0.045
 Identities = 16/38 (42%), Positives = 24/38 (63%)
 Frame = +2

Query: 572 NESKCDLSLEPEITEIFSTSQDPEELKHAWVEWHNAAG 685
           N++    SL+P++T I ++S+    L  AW  WHNAAG
Sbjct: 3   NKTATCWSLDPDLTNILASSRSYAMLLFAWEGWHNAAG 40


>M86868-1|AAA52510.1|  465|Homo sapiens gamma-amino butyric acid
           protein.
          Length = 465

 Score = 31.5 bits (68), Expect = 2.9
 Identities = 19/60 (31%), Positives = 30/60 (50%)
 Frame = +3

Query: 294 SLAEWEYTSNITKENEEKSIQTHLELSRQEKAAWEETKMYGWQDFQDFTLRRMFKKYSQL 473
           SLA +  +  +T+E  +  I  HL LS +  AA ++  + G   F+ F       KYS+L
Sbjct: 388 SLAGYPRSHILTEEERQDKIVVHLGLSGEANAARKKGLLKGQTGFRIFQNTHAIDKYSRL 447


>BC130354-1|AAI30355.1|  465|Homo sapiens gamma-aminobutyric acid
           (GABA) receptor, rho 2 protein.
          Length = 465

 Score = 31.5 bits (68), Expect = 2.9
 Identities = 19/60 (31%), Positives = 30/60 (50%)
 Frame = +3

Query: 294 SLAEWEYTSNITKENEEKSIQTHLELSRQEKAAWEETKMYGWQDFQDFTLRRMFKKYSQL 473
           SLA +  +  +T+E  +  I  HL LS +  AA ++  + G   F+ F       KYS+L
Sbjct: 388 SLAGYPRSHILTEEERQDKIVVHLGLSGEANAARKKGLLKGQTGFRIFQNTHAIDKYSRL 447


>BC130352-1|AAI30353.1|  465|Homo sapiens gamma-aminobutyric acid
           (GABA) receptor, rho 2 protein.
          Length = 465

 Score = 31.5 bits (68), Expect = 2.9
 Identities = 19/60 (31%), Positives = 30/60 (50%)
 Frame = +3

Query: 294 SLAEWEYTSNITKENEEKSIQTHLELSRQEKAAWEETKMYGWQDFQDFTLRRMFKKYSQL 473
           SLA +  +  +T+E  +  I  HL LS +  AA ++  + G   F+ F       KYS+L
Sbjct: 388 SLAGYPRSHILTEEERQDKIVVHLGLSGEANAARKKGLLKGQTGFRIFQNTHAIDKYSRL 447


>AL121833-2|CAC07339.1|  465|Homo sapiens gamma-aminobutyric acid
           (GABA) receptor, rho 2 protein.
          Length = 465

 Score = 31.5 bits (68), Expect = 2.9
 Identities = 19/60 (31%), Positives = 30/60 (50%)
 Frame = +3

Query: 294 SLAEWEYTSNITKENEEKSIQTHLELSRQEKAAWEETKMYGWQDFQDFTLRRMFKKYSQL 473
           SLA +  +  +T+E  +  I  HL LS +  AA ++  + G   F+ F       KYS+L
Sbjct: 388 SLAGYPRSHILTEEERQDKIVVHLGLSGEANAARKKGLLKGQTGFRIFQNTHAIDKYSRL 447


>BX538024-1|CAD97970.1|  979|Homo sapiens hypothetical protein
           protein.
          Length = 979

 Score = 29.9 bits (64), Expect = 8.9
 Identities = 12/33 (36%), Positives = 20/33 (60%)
 Frame = +3

Query: 303 EWEYTSNITKENEEKSIQTHLELSRQEKAAWEE 401
           +W    ++ +E EE+ +Q  L  S QE+ AWE+
Sbjct: 795 DWLQQYDMEREREEQELQQALAQSLQEQEAWEQ 827


>BC133009-1|AAI33010.1|  979|Homo sapiens ubiquitin specific
           peptidase 37 protein.
          Length = 979

 Score = 29.9 bits (64), Expect = 8.9
 Identities = 12/33 (36%), Positives = 20/33 (60%)
 Frame = +3

Query: 303 EWEYTSNITKENEEKSIQTHLELSRQEKAAWEE 401
           +W    ++ +E EE+ +Q  L  S QE+ AWE+
Sbjct: 795 DWLQQYDMEREREEQELQQALAQSLQEQEAWEQ 827


>BC133007-1|AAI33008.1|  979|Homo sapiens USP37 protein protein.
          Length = 979

 Score = 29.9 bits (64), Expect = 8.9
 Identities = 12/33 (36%), Positives = 20/33 (60%)
 Frame = +3

Query: 303 EWEYTSNITKENEEKSIQTHLELSRQEKAAWEE 401
           +W    ++ +E EE+ +Q  L  S QE+ AWE+
Sbjct: 795 DWLQQYDMEREREEQELQQALAQSLQEQEAWEQ 827


>BC112901-1|AAI12902.1|  885|Homo sapiens USP37 protein protein.
          Length = 885

 Score = 29.9 bits (64), Expect = 8.9
 Identities = 12/33 (36%), Positives = 20/33 (60%)
 Frame = +3

Query: 303 EWEYTSNITKENEEKSIQTHLELSRQEKAAWEE 401
           +W    ++ +E EE+ +Q  L  S QE+ AWE+
Sbjct: 701 DWLQQYDMEREREEQELQQALAQSLQEQEAWEQ 733


>AL832645-1|CAD89955.1|  979|Homo sapiens hypothetical protein
           protein.
          Length = 979

 Score = 29.9 bits (64), Expect = 8.9
 Identities = 12/33 (36%), Positives = 20/33 (60%)
 Frame = +3

Query: 303 EWEYTSNITKENEEKSIQTHLELSRQEKAAWEE 401
           +W    ++ +E EE+ +Q  L  S QE+ AWE+
Sbjct: 795 DWLQQYDMEREREEQELQQALAQSLQEQEAWEQ 827


>AL136967-3|CAC09454.3|  276|Homo sapiens natural cytotoxicity
           triggering receptor 2 protein.
          Length = 276

 Score = 29.9 bits (64), Expect = 8.9
 Identities = 15/39 (38%), Positives = 21/39 (53%)
 Frame = -2

Query: 498 CRQAEPQRPADCIS*TFYAT*NPGSPATRTSWSPPRLLS 382
           CR   P   +   S  FY   +P S +T+TSW+P  L+S
Sbjct: 109 CRIYRPSDNSVSKSVRFYLVVSPASASTQTSWTPRDLVS 147


>AL136967-2|CAC09452.3|  270|Homo sapiens natural cytotoxicity
           triggering receptor 2 protein.
          Length = 270

 Score = 29.9 bits (64), Expect = 8.9
 Identities = 15/39 (38%), Positives = 21/39 (53%)
 Frame = -2

Query: 498 CRQAEPQRPADCIS*TFYAT*NPGSPATRTSWSPPRLLS 382
           CR   P   +   S  FY   +P S +T+TSW+P  L+S
Sbjct: 109 CRIYRPSDNSVSKSVRFYLVVSPASASTQTSWTPRDLVS 147


>AL136967-1|CAC09453.3|  258|Homo sapiens natural cytotoxicity
           triggering receptor 2 protein.
          Length = 258

 Score = 29.9 bits (64), Expect = 8.9
 Identities = 15/39 (38%), Positives = 21/39 (53%)
 Frame = -2

Query: 498 CRQAEPQRPADCIS*TFYAT*NPGSPATRTSWSPPRLLS 382
           CR   P   +   S  FY   +P S +T+TSW+P  L+S
Sbjct: 109 CRIYRPSDNSVSKSVRFYLVVSPASASTQTSWTPRDLVS 147


>AB046814-1|BAB13420.1|  931|Homo sapiens KIAA1594 protein protein.
          Length = 931

 Score = 29.9 bits (64), Expect = 8.9
 Identities = 12/33 (36%), Positives = 20/33 (60%)
 Frame = +3

Query: 303 EWEYTSNITKENEEKSIQTHLELSRQEKAAWEE 401
           +W    ++ +E EE+ +Q  L  S QE+ AWE+
Sbjct: 747 DWLQQYDMEREREEQELQQALAQSLQEQEAWEQ 779


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 98,922,104
Number of Sequences: 237096
Number of extensions: 2038347
Number of successful extensions: 5157
Number of sequences better than 10.0: 34
Number of HSP's better than 10.0 without gapping: 4830
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5127
length of database: 76,859,062
effective HSP length: 88
effective length of database: 55,994,614
effective search space used: 7895240574
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -