SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20070
         (639 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BC100934-1|AAI00935.1|  288|Homo sapiens apolipoprotein A-I bind...   108   1e-23
BC100933-1|AAI00934.1|  288|Homo sapiens apolipoprotein A-I bind...   108   1e-23
BC100931-1|AAI00932.1|  288|Homo sapiens apolipoprotein A-I bind...   108   1e-23
BC056917-1|AAH56917.1|  260|Homo sapiens APOA1BP protein protein.     108   1e-23
AL365181-7|CAI13051.1|  288|Homo sapiens apolipoprotein A-I bind...   108   1e-23
AL365181-6|CAI13050.1|  260|Homo sapiens apolipoprotein A-I bind...   108   1e-23
AL365181-5|CAI13049.1|  245|Homo sapiens apolipoprotein A-I bind...   108   1e-23
AJ315849-1|CAC86580.1|  288|Homo sapiens apoA-I binding protein ...   108   1e-23
BC020948-1|AAH20948.1|  254|Homo sapiens FLJ44968 protein protein.     59   2e-08
BC100932-1|AAI00933.1|  185|Homo sapiens APOA1BP protein protein.      44   6e-04
BC032112-1|AAH32112.1|  552|Homo sapiens integrin alpha FG-GAP r...    31   3.4  
BC013047-1|AAH13047.1|  552|Homo sapiens integrin alpha FG-GAP r...    31   3.4  
BC010521-1|AAH10521.1|  526|Homo sapiens ITFG3 protein protein.        31   3.4  
AK057165-1|BAB71374.1|  540|Homo sapiens protein ( Homo sapiens ...    31   3.4  
AE006462-12|AAK61220.1|  636|Homo sapiens unknown function protein.    31   3.4  
AK092728-1|BAC03958.1|  173|Homo sapiens protein ( Homo sapiens ...    30   6.0  
S67334-1|AAB29081.1| 1070|Homo sapiens phosphatidylinositol 3-ki...    30   8.0  
BC114432-1|AAI14433.1| 1070|Homo sapiens phosphoinositide-3-kina...    30   8.0  
AJ297549-1|CAC21449.1| 1070|Homo sapiens phosphatidylinositol 3-...    30   8.0  

>BC100934-1|AAI00935.1|  288|Homo sapiens apolipoprotein A-I binding
           protein protein.
          Length = 288

 Score =  108 bits (260), Expect = 1e-23
 Identities = 53/88 (60%), Positives = 66/88 (75%), Gaps = 4/88 (4%)
 Frame = +2

Query: 257 NIGTMTSSMNQCNTVTRYLNQSEAAALDQDLFTEYKFSVDQLMELAGLSVASAIAKVFPP 436
           N G    S    +TV +YL+Q EA A+DQ+LF EY+FSVDQLMELAGLS A+AIAK +PP
Sbjct: 42  NSGGRWDSEVMASTVVKYLSQEEAQAVDQELFNEYQFSVDQLMELAGLSCATAIAKAYPP 101

Query: 437 STHS----SALIVCGPGNNGGDGLVAAR 508
           ++ S    + L++CGPGNNGGDGLV AR
Sbjct: 102 TSMSRSPPTVLVICGPGNNGGDGLVCAR 129



 Score = 43.6 bits (98), Expect = 6e-04
 Identities = 15/41 (36%), Positives = 29/41 (70%)
 Frame = +1

Query: 508 NMQLFGYNVSVHYPKRTPKPLYENLLEQCIRFNVNIIDKLP 630
           +++LFGY  +++YPKR  KPL+  L+ QC + ++  + ++P
Sbjct: 130 HLKLFGYEPTIYYPKRPNKPLFTALVTQCQKMDIPFLGEMP 170


>BC100933-1|AAI00934.1|  288|Homo sapiens apolipoprotein A-I binding
           protein protein.
          Length = 288

 Score =  108 bits (260), Expect = 1e-23
 Identities = 53/88 (60%), Positives = 66/88 (75%), Gaps = 4/88 (4%)
 Frame = +2

Query: 257 NIGTMTSSMNQCNTVTRYLNQSEAAALDQDLFTEYKFSVDQLMELAGLSVASAIAKVFPP 436
           N G    S    +TV +YL+Q EA A+DQ+LF EY+FSVDQLMELAGLS A+AIAK +PP
Sbjct: 42  NSGGRWDSEVMASTVVKYLSQEEAQAVDQELFNEYQFSVDQLMELAGLSCATAIAKAYPP 101

Query: 437 STHS----SALIVCGPGNNGGDGLVAAR 508
           ++ S    + L++CGPGNNGGDGLV AR
Sbjct: 102 TSMSRSPPTVLVICGPGNNGGDGLVCAR 129



 Score = 43.6 bits (98), Expect = 6e-04
 Identities = 15/41 (36%), Positives = 29/41 (70%)
 Frame = +1

Query: 508 NMQLFGYNVSVHYPKRTPKPLYENLLEQCIRFNVNIIDKLP 630
           +++LFGY  +++YPKR  KPL+  L+ QC + ++  + ++P
Sbjct: 130 HLKLFGYEPTIYYPKRPNKPLFTALVTQCQKMDIPFLGEMP 170


>BC100931-1|AAI00932.1|  288|Homo sapiens apolipoprotein A-I binding
           protein protein.
          Length = 288

 Score =  108 bits (260), Expect = 1e-23
 Identities = 53/88 (60%), Positives = 66/88 (75%), Gaps = 4/88 (4%)
 Frame = +2

Query: 257 NIGTMTSSMNQCNTVTRYLNQSEAAALDQDLFTEYKFSVDQLMELAGLSVASAIAKVFPP 436
           N G    S    +TV +YL+Q EA A+DQ+LF EY+FSVDQLMELAGLS A+AIAK +PP
Sbjct: 42  NSGGRWDSEVMASTVVKYLSQEEAQAVDQELFNEYQFSVDQLMELAGLSCATAIAKAYPP 101

Query: 437 STHS----SALIVCGPGNNGGDGLVAAR 508
           ++ S    + L++CGPGNNGGDGLV AR
Sbjct: 102 TSMSRSPPTVLVICGPGNNGGDGLVCAR 129



 Score = 43.6 bits (98), Expect = 6e-04
 Identities = 15/41 (36%), Positives = 29/41 (70%)
 Frame = +1

Query: 508 NMQLFGYNVSVHYPKRTPKPLYENLLEQCIRFNVNIIDKLP 630
           +++LFGY  +++YPKR  KPL+  L+ QC + ++  + ++P
Sbjct: 130 HLKLFGYEPTIYYPKRPNKPLFTALVTQCQKMDIPFLGEMP 170


>BC056917-1|AAH56917.1|  260|Homo sapiens APOA1BP protein protein.
          Length = 260

 Score =  108 bits (260), Expect = 1e-23
 Identities = 53/88 (60%), Positives = 66/88 (75%), Gaps = 4/88 (4%)
 Frame = +2

Query: 257 NIGTMTSSMNQCNTVTRYLNQSEAAALDQDLFTEYKFSVDQLMELAGLSVASAIAKVFPP 436
           N G    S    +TV +YL+Q EA A+DQ+LF EY+FSVDQLMELAGLS A+AIAK +PP
Sbjct: 42  NSGGRWDSEVMASTVVKYLSQEEAQAVDQELFNEYQFSVDQLMELAGLSCATAIAKAYPP 101

Query: 437 STHS----SALIVCGPGNNGGDGLVAAR 508
           ++ S    + L++CGPGNNGGDGLV AR
Sbjct: 102 TSMSRSPPTVLVICGPGNNGGDGLVCAR 129



 Score = 43.6 bits (98), Expect = 6e-04
 Identities = 15/41 (36%), Positives = 29/41 (70%)
 Frame = +1

Query: 508 NMQLFGYNVSVHYPKRTPKPLYENLLEQCIRFNVNIIDKLP 630
           +++LFGY  +++YPKR  KPL+  L+ QC + ++  + ++P
Sbjct: 130 HLKLFGYEPTIYYPKRPNKPLFTALVTQCQKMDIPFLGEMP 170


>AL365181-7|CAI13051.1|  288|Homo sapiens apolipoprotein A-I binding
           protein protein.
          Length = 288

 Score =  108 bits (260), Expect = 1e-23
 Identities = 53/88 (60%), Positives = 66/88 (75%), Gaps = 4/88 (4%)
 Frame = +2

Query: 257 NIGTMTSSMNQCNTVTRYLNQSEAAALDQDLFTEYKFSVDQLMELAGLSVASAIAKVFPP 436
           N G    S    +TV +YL+Q EA A+DQ+LF EY+FSVDQLMELAGLS A+AIAK +PP
Sbjct: 42  NSGGRWDSEVMASTVVKYLSQEEAQAVDQELFNEYQFSVDQLMELAGLSCATAIAKAYPP 101

Query: 437 STHS----SALIVCGPGNNGGDGLVAAR 508
           ++ S    + L++CGPGNNGGDGLV AR
Sbjct: 102 TSMSRSPPTVLVICGPGNNGGDGLVCAR 129



 Score = 43.6 bits (98), Expect = 6e-04
 Identities = 15/41 (36%), Positives = 29/41 (70%)
 Frame = +1

Query: 508 NMQLFGYNVSVHYPKRTPKPLYENLLEQCIRFNVNIIDKLP 630
           +++LFGY  +++YPKR  KPL+  L+ QC + ++  + ++P
Sbjct: 130 HLKLFGYEPTIYYPKRPNKPLFTALVTQCQKMDIPFLGEMP 170


>AL365181-6|CAI13050.1|  260|Homo sapiens apolipoprotein A-I binding
           protein protein.
          Length = 260

 Score =  108 bits (260), Expect = 1e-23
 Identities = 53/88 (60%), Positives = 66/88 (75%), Gaps = 4/88 (4%)
 Frame = +2

Query: 257 NIGTMTSSMNQCNTVTRYLNQSEAAALDQDLFTEYKFSVDQLMELAGLSVASAIAKVFPP 436
           N G    S    +TV +YL+Q EA A+DQ+LF EY+FSVDQLMELAGLS A+AIAK +PP
Sbjct: 42  NSGGRWDSEVMASTVVKYLSQEEAQAVDQELFNEYQFSVDQLMELAGLSCATAIAKAYPP 101

Query: 437 STHS----SALIVCGPGNNGGDGLVAAR 508
           ++ S    + L++CGPGNNGGDGLV AR
Sbjct: 102 TSMSRSPPTVLVICGPGNNGGDGLVCAR 129



 Score = 43.6 bits (98), Expect = 6e-04
 Identities = 15/41 (36%), Positives = 29/41 (70%)
 Frame = +1

Query: 508 NMQLFGYNVSVHYPKRTPKPLYENLLEQCIRFNVNIIDKLP 630
           +++LFGY  +++YPKR  KPL+  L+ QC + ++  + ++P
Sbjct: 130 HLKLFGYEPTIYYPKRPNKPLFTALVTQCQKMDIPFLGEMP 170


>AL365181-5|CAI13049.1|  245|Homo sapiens apolipoprotein A-I binding
           protein protein.
          Length = 245

 Score =  108 bits (260), Expect = 1e-23
 Identities = 53/88 (60%), Positives = 66/88 (75%), Gaps = 4/88 (4%)
 Frame = +2

Query: 257 NIGTMTSSMNQCNTVTRYLNQSEAAALDQDLFTEYKFSVDQLMELAGLSVASAIAKVFPP 436
           N G    S    +TV +YL+Q EA A+DQ+LF EY+FSVDQLMELAGLS A+AIAK +PP
Sbjct: 42  NSGGRWDSEVMASTVVKYLSQEEAQAVDQELFNEYQFSVDQLMELAGLSCATAIAKAYPP 101

Query: 437 STHS----SALIVCGPGNNGGDGLVAAR 508
           ++ S    + L++CGPGNNGGDGLV AR
Sbjct: 102 TSMSRSPPTVLVICGPGNNGGDGLVCAR 129



 Score = 43.6 bits (98), Expect = 6e-04
 Identities = 15/41 (36%), Positives = 29/41 (70%)
 Frame = +1

Query: 508 NMQLFGYNVSVHYPKRTPKPLYENLLEQCIRFNVNIIDKLP 630
           +++LFGY  +++YPKR  KPL+  L+ QC + ++  + ++P
Sbjct: 130 HLKLFGYEPTIYYPKRPNKPLFTALVTQCQKMDIPFLGEMP 170


>AJ315849-1|CAC86580.1|  288|Homo sapiens apoA-I binding protein
           protein.
          Length = 288

 Score =  108 bits (260), Expect = 1e-23
 Identities = 53/88 (60%), Positives = 66/88 (75%), Gaps = 4/88 (4%)
 Frame = +2

Query: 257 NIGTMTSSMNQCNTVTRYLNQSEAAALDQDLFTEYKFSVDQLMELAGLSVASAIAKVFPP 436
           N G    S    +TV +YL+Q EA A+DQ+LF EY+FSVDQLMELAGLS A+AIAK +PP
Sbjct: 42  NSGGRWDSEVMASTVVKYLSQEEAQAVDQELFNEYQFSVDQLMELAGLSCATAIAKAYPP 101

Query: 437 STHS----SALIVCGPGNNGGDGLVAAR 508
           ++ S    + L++CGPGNNGGDGLV AR
Sbjct: 102 TSMSRSPPTVLVICGPGNNGGDGLVCAR 129



 Score = 43.6 bits (98), Expect = 6e-04
 Identities = 15/41 (36%), Positives = 29/41 (70%)
 Frame = +1

Query: 508 NMQLFGYNVSVHYPKRTPKPLYENLLEQCIRFNVNIIDKLP 630
           +++LFGY  +++YPKR  KPL+  L+ QC + ++  + ++P
Sbjct: 130 HLKLFGYEPTIYYPKRPNKPLFTALVTQCQKMDIPFLGEMP 170


>BC020948-1|AAH20948.1|  254|Homo sapiens FLJ44968 protein protein.
          Length = 254

 Score = 58.8 bits (136), Expect = 2e-08
 Identities = 31/67 (46%), Positives = 43/67 (64%), Gaps = 4/67 (5%)
 Frame = +2

Query: 320 SEAAALDQDLFTEYKFSVDQLMELAGLSVASAIAKVFP-PS---THSSALIVCGPGNNGG 487
           +EAAAL+++L  +Y+F   QL+EL G + A A+ K FP P+      + L+VCGP  NG 
Sbjct: 79  AEAAALERELLEDYRFGRQQLVELCGHASAVAVTKAFPLPALSRKQRTVLVVCGPEQNGA 138

Query: 488 DGLVAAR 508
            GLV AR
Sbjct: 139 VGLVCAR 145



 Score = 29.9 bits (64), Expect = 8.0
 Identities = 11/41 (26%), Positives = 24/41 (58%)
 Frame = +1

Query: 508 NMQLFGYNVSVHYPKRTPKPLYENLLEQCIRFNVNIIDKLP 630
           ++++F Y  ++ YP R+   L+ +L  QC + ++  +  LP
Sbjct: 146 HLRVFEYEPTIFYPTRSLDLLHRDLTTQCEKMDIPFLSYLP 186


>BC100932-1|AAI00933.1|  185|Homo sapiens APOA1BP protein protein.
          Length = 185

 Score = 43.6 bits (98), Expect = 6e-04
 Identities = 15/41 (36%), Positives = 29/41 (70%)
 Frame = +1

Query: 508 NMQLFGYNVSVHYPKRTPKPLYENLLEQCIRFNVNIIDKLP 630
           +++LFGY  +++YPKR  KPL+  L+ QC + ++  + ++P
Sbjct: 27  HLKLFGYEPTIYYPKRPNKPLFTALVTQCQKMDIPFLGEMP 67



 Score = 41.1 bits (92), Expect = 0.003
 Identities = 15/20 (75%), Positives = 18/20 (90%)
 Frame = +2

Query: 449 SALIVCGPGNNGGDGLVAAR 508
           + L++CGPGNNGGDGLV AR
Sbjct: 7   TVLVICGPGNNGGDGLVCAR 26


>BC032112-1|AAH32112.1|  552|Homo sapiens integrin alpha FG-GAP
           repeat containing 3 protein.
          Length = 552

 Score = 31.1 bits (67), Expect = 3.4
 Identities = 15/43 (34%), Positives = 28/43 (65%), Gaps = 2/43 (4%)
 Frame = +2

Query: 380 LMELAGLS--VASAIAKVFPPSTHSSALIVCGPGNNGGDGLVA 502
           L+ELA +S  + +  A +F PS H++ +++ GP ++   GLV+
Sbjct: 468 LLELANVSTHIVAFDAVLFEPSRHAAYILLTGPADSEAPGLVS 510


>BC013047-1|AAH13047.1|  552|Homo sapiens integrin alpha FG-GAP
           repeat containing 3 protein.
          Length = 552

 Score = 31.1 bits (67), Expect = 3.4
 Identities = 15/43 (34%), Positives = 28/43 (65%), Gaps = 2/43 (4%)
 Frame = +2

Query: 380 LMELAGLS--VASAIAKVFPPSTHSSALIVCGPGNNGGDGLVA 502
           L+ELA +S  + +  A +F PS H++ +++ GP ++   GLV+
Sbjct: 468 LLELANVSTHIVAFDAVLFEPSRHAAYILLTGPADSEAPGLVS 510


>BC010521-1|AAH10521.1|  526|Homo sapiens ITFG3 protein protein.
          Length = 526

 Score = 31.1 bits (67), Expect = 3.4
 Identities = 15/43 (34%), Positives = 28/43 (65%), Gaps = 2/43 (4%)
 Frame = +2

Query: 380 LMELAGLS--VASAIAKVFPPSTHSSALIVCGPGNNGGDGLVA 502
           L+ELA +S  + +  A +F PS H++ +++ GP ++   GLV+
Sbjct: 442 LLELANVSTHIVAFDAVLFEPSRHAAYILLTGPADSEAPGLVS 484


>AK057165-1|BAB71374.1|  540|Homo sapiens protein ( Homo sapiens
           cDNA FLJ32603 fis, clone STOMA1000117. ).
          Length = 540

 Score = 31.1 bits (67), Expect = 3.4
 Identities = 15/43 (34%), Positives = 28/43 (65%), Gaps = 2/43 (4%)
 Frame = +2

Query: 380 LMELAGLS--VASAIAKVFPPSTHSSALIVCGPGNNGGDGLVA 502
           L+ELA +S  + +  A +F PS H++ +++ GP ++   GLV+
Sbjct: 468 LLELANVSTHIVAFDAVLFEPSRHAAYILLTGPADSEAPGLVS 510


>AE006462-12|AAK61220.1|  636|Homo sapiens unknown function protein.
          Length = 636

 Score = 31.1 bits (67), Expect = 3.4
 Identities = 15/43 (34%), Positives = 28/43 (65%), Gaps = 2/43 (4%)
 Frame = +2

Query: 380 LMELAGLS--VASAIAKVFPPSTHSSALIVCGPGNNGGDGLVA 502
           L+ELA +S  + +  A +F PS H++ +++ GP ++   GLV+
Sbjct: 525 LLELANVSTHIVAFDAVLFEPSRHAAYILLTGPADSEAPGLVS 567


>AK092728-1|BAC03958.1|  173|Homo sapiens protein ( Homo sapiens
           cDNA FLJ35409 fis, clone SKNSH2009435. ).
          Length = 173

 Score = 30.3 bits (65), Expect = 6.0
 Identities = 14/37 (37%), Positives = 20/37 (54%)
 Frame = -1

Query: 591 LFQKVFIQRFGCAFRIMYRYIVSEQLHILAATKPSPP 481
           L  +VF+  F C F+I+     +   H+LA  KP PP
Sbjct: 76  LLLRVFVCLFVCLFQILMDDKTTRICHLLAKRKPPPP 112


>S67334-1|AAB29081.1| 1070|Homo sapiens phosphatidylinositol
           3-kinase p110 beta isoform protein.
          Length = 1070

 Score = 29.9 bits (64), Expect = 8.0
 Identities = 18/67 (26%), Positives = 29/67 (43%)
 Frame = +2

Query: 362 KFSVDQLMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGDGLVAARICSCSDTMYRY 541
           KFS ++++ L GLS    + + +PP    S          GG  +VA    +C D     
Sbjct: 154 KFSEEKILSLVGLSWMDWLKQTYPPEHEPSIPENLEDKLYGGKLIVAVHFENCQDVFSFQ 213

Query: 542 IILNAHP 562
           +  N +P
Sbjct: 214 VSPNMNP 220


>BC114432-1|AAI14433.1| 1070|Homo sapiens phosphoinositide-3-kinase,
           catalytic, beta polypeptide protein.
          Length = 1070

 Score = 29.9 bits (64), Expect = 8.0
 Identities = 18/67 (26%), Positives = 29/67 (43%)
 Frame = +2

Query: 362 KFSVDQLMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGDGLVAARICSCSDTMYRY 541
           KFS ++++ L GLS    + + +PP    S          GG  +VA    +C D     
Sbjct: 154 KFSEEKILSLVGLSWMDWLKQTYPPEHEPSIPENLEDKLYGGKLIVAVHFENCQDVFSFQ 213

Query: 542 IILNAHP 562
           +  N +P
Sbjct: 214 VSPNMNP 220


>AJ297549-1|CAC21449.1| 1070|Homo sapiens phosphatidylinositol
           3-kinase catalytic subunit p110beta protein.
          Length = 1070

 Score = 29.9 bits (64), Expect = 8.0
 Identities = 18/67 (26%), Positives = 29/67 (43%)
 Frame = +2

Query: 362 KFSVDQLMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGDGLVAARICSCSDTMYRY 541
           KFS ++++ L GLS    + + +PP    S          GG  +VA    +C D     
Sbjct: 154 KFSEEKILSLVGLSWMDWLKQTYPPEHEPSIPENLEDKLYGGKLIVAVHFENCQDVFSFQ 213

Query: 542 IILNAHP 562
           +  N +P
Sbjct: 214 VSPNMNP 220


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 89,640,400
Number of Sequences: 237096
Number of extensions: 1908382
Number of successful extensions: 3655
Number of sequences better than 10.0: 19
Number of HSP's better than 10.0 without gapping: 3466
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3646
length of database: 76,859,062
effective HSP length: 87
effective length of database: 56,231,710
effective search space used: 7028963750
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -