SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20069
         (636 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BC112963-1|AAI12964.1|  655|Homo sapiens HSPA5 protein protein.       167   4e-41
X87949-1|CAA61201.1|  653|Homo sapiens BiP protein.                   166   7e-41
M19645-1|AAA52614.1|  653|Homo sapiens protein ( Human 78 kdalto...   166   7e-41
DQ385847-1|ABD04090.1|  654|Homo sapiens heat shock 70kDa protei...   166   7e-41
BC020235-1|AAH20235.1|  654|Homo sapiens heat shock 70kDa protei...   166   7e-41
AJ271729-1|CAB71335.1|  654|Homo sapiens glucose-regulated prote...   166   7e-41
AF216292-1|AAF42836.1|  654|Homo sapiens endoplasmic reticulum l...   166   7e-41
AF188611-1|AAF13605.1|  639|Homo sapiens BiP protein protein.         166   7e-41
M59829-1|AAA63228.1|  641|Homo sapiens heat shock-induced protei...   132   1e-30
D85730-1|BAA32521.1|  641|Homo sapiens Heat shock protein 70 tes...   132   1e-30
DQ383515-1|ABC88476.1|  641|Homo sapiens heat shock 70kDa protei...   132   1e-30
BC034483-1|AAH34483.1|  641|Homo sapiens heat shock 70kDa protei...   132   1e-30
BA000025-10|BAB63301.1|  641|Homo sapiens heat shock protein pro...   132   1e-30
AL929592-4|CAI18463.1|  641|Homo sapiens heat shock 70kDa protei...   132   1e-30
AL671762-4|CAI18215.1|  641|Homo sapiens heat shock 70kDa protei...   132   1e-30
AL662834-15|CAI17736.1|  641|Homo sapiens heat shock 70kDa prote...   132   1e-30
AK223386-1|BAD97106.1|  641|Homo sapiens heat shock 70kDa protei...   132   1e-30
AF134726-8|AAD21817.1|  641|Homo sapiens HSP70-HOM protein.           132   1e-30
U56725-1|AAD11466.1|  639|Homo sapiens heat shock protein protein.    130   3e-30
L26336-1|AAA52698.1|  639|Homo sapiens heat shock protein protein.    130   3e-30
DQ489378-1|ABE96830.1|  639|Homo sapiens heat shock 70kDa protei...   130   3e-30
BT009815-1|AAP88817.1|  639|Homo sapiens heat shock 70kDa protei...   130   3e-30
BC001752-1|AAH01752.1|  639|Homo sapiens heat shock 70kDa protei...   130   3e-30
AB209818-1|BAD93055.1|  709|Homo sapiens heat shock 70kDa protei...   130   4e-30
Y00371-1|CAA68445.1|  646|Homo sapiens 71 Kd heat shock cognate ...   130   5e-30
M59830-1|AAA63227.1|  641|Homo sapiens heat shock-induced protei...   130   5e-30
M59828-1|AAA63226.1|  641|Homo sapiens heat shock-induced protei...   130   5e-30
DQ451402-1|ABD96830.1|  641|Homo sapiens heat shock 70kDa protei...   130   5e-30
DQ388429-1|ABD48956.1|  641|Homo sapiens heat shock 70kDa protei...   130   5e-30
BC063507-1|AAH63507.1|  641|Homo sapiens heat shock 70kDa protei...   130   5e-30
BC057397-1|AAH57397.1|  641|Homo sapiens heat shock 70kDa protei...   130   5e-30
BC019816-1|AAH19816.1|  646|Homo sapiens heat shock 70kDa protei...   130   5e-30
BC018740-1|AAH18740.1|  641|Homo sapiens HSPA1A protein protein.      130   5e-30
BC016660-1|AAH16660.1|  646|Homo sapiens heat shock 70kDa protei...   130   5e-30
BC016179-1|AAH16179.1|  646|Homo sapiens heat shock 70kDa protei...   130   5e-30
BC009322-1|AAH09322.1|  641|Homo sapiens HSPA1A protein protein.      130   5e-30
BC002453-1|AAH02453.1|  641|Homo sapiens heat shock 70kDa protei...   130   5e-30
BA000025-9|BAB63300.1|  641|Homo sapiens heat shock protein prot...   130   5e-30
BA000025-8|BAB63299.1|  641|Homo sapiens heat shock protein prot...   130   5e-30
AL929592-7|CAI18466.1|  641|Homo sapiens heat shock 70kDa protei...   130   5e-30
AL929592-5|CAI18464.1|  641|Homo sapiens heat shock 70kDa protei...   130   5e-30
AL671762-7|CAI18217.1|  641|Homo sapiens heat shock 70kDa protei...   130   5e-30
AL671762-6|CAI18216.1|  641|Homo sapiens heat shock 70kDa protei...   130   5e-30
AL662834-18|CAI17738.1|  641|Homo sapiens heat shock 70kDa prote...   130   5e-30
AL662834-17|CAI17737.1|  641|Homo sapiens heat shock 70kDa prote...   130   5e-30
AK222785-1|BAD96505.1|  646|Homo sapiens heat shock 70kDa protei...   130   5e-30
AK222628-1|BAD96348.1|  493|Homo sapiens heat shock 70kDa protei...   130   5e-30
AF352832-1|AAK17898.1|  646|Homo sapiens constitutive heat shock...   130   5e-30
AF134726-7|AAD21816.1|  641|Homo sapiens HSP70-1 protein.             130   5e-30
AF134726-6|AAD21815.1|  641|Homo sapiens HSP70-2 protein.             130   5e-30
AB034951-1|BAB18615.1|  493|Homo sapiens heat shock cognate prot...   130   5e-30
M11717-1|AAA52697.1|  640|Homo sapiens heat shock protein protein.    129   7e-30
BC036107-1|AAH36107.1|  639|Homo sapiens HSPA2 protein protein.       128   2e-29
M11236-1|AAA52696.1|  247|Homo sapiens HSPA1L protein.                128   2e-29
X51757-1|CAA36061.1|  643|Homo sapiens protein ( Human heat-shoc...   126   7e-29
DQ521571-1|ABF47108.1|  643|Homo sapiens heat shock 70kDa protei...   126   7e-29
BC035665-1|AAH35665.1|  643|Homo sapiens heat shock 70kDa protei...   126   7e-29
AL590385-3|CAI16120.1|  643|Homo sapiens heat shock 70kDa protei...   126   7e-29
AK223362-1|BAD97082.1|  643|Homo sapiens heat shock 70kDa protei...   126   7e-29
U10149-1|AAC50076.1|  125|Homo sapiens heat shock protein protein.    124   4e-28
BC030634-1|AAH30634.1|  681|Homo sapiens HSPA9 protein protein.       100   9e-21
BC024034-1|AAH24034.1|  679|Homo sapiens heat shock 70kDa protei...   100   9e-21
BC000478-1|AAH00478.1|  679|Homo sapiens heat shock 70kDa protei...   100   9e-21
L15189-1|AAA67526.1|  679|Homo sapiens MTHSP75 protein.                98   3e-20
DQ531046-1|ABF50973.1|  679|Homo sapiens heat shock 70kDa protei...    98   3e-20
AK222758-1|BAD96478.1|  679|Homo sapiens heat shock 70kDa protei...    98   3e-20
BC119690-1|AAI19691.1|  509|Homo sapiens heat shock 70kDa protei...    83   6e-16
AF112210-1|AAF17198.1|  509|Homo sapiens heat shock protein hsp7...    83   6e-16
AF143723-1|AAF66640.1|  509|Homo sapiens heat shock protein HSP6...    81   3e-15
BC108738-1|AAI08739.1|   88|Homo sapiens HSPA14 protein protein.       77   4e-14
BC065281-1|AAH65281.1|   88|Homo sapiens HSPA14 protein protein.       77   4e-14
U04735-1|AAA16954.1|  471|Homo sapiens microsomal stress 70 prot...    70   8e-12
BC036370-1|AAH36370.1|  471|Homo sapiens stress 70 protein chape...    70   8e-12
AL163206-1|CAB90390.1|  471|Homo sapiens human microsomal stress...    70   8e-12
AF130249-1|AAD21091.1|  471|Homo sapiens STCH protein.                 70   8e-12
D86956-1|BAA13192.2|  949|Homo sapiens KIAA0201 protein.               68   2e-11
AK223282-1|BAD97002.1|  471|Homo sapiens stress 70 protein chape...    68   3e-11
AF039695-1|AAC18044.1|  872|Homo sapiens antigen NY-CO-25 protein.     63   7e-10
EF197155-1|ABM69040.1|  839|Homo sapiens heat shock 70 kDa prote...    63   9e-10
BC040560-1|AAH40560.1|  839|Homo sapiens heat shock 70kDa protei...    63   9e-10
AY290862-1|AAP44471.1|  839|Homo sapiens heat shock protein apg-...    63   9e-10
AC093591-2|AAY40975.1|  839|Homo sapiens unknown protein.              63   9e-10
AB023421-1|BAA75063.1|  839|Homo sapiens apg-1 protein.                63   9e-10
X67643-1|CAA47886.1|  474|Homo sapiens HS24/P52 protein.               62   2e-09
L12723-1|AAA02807.1|  701|Homo sapiens heat shock protein 70 pro...    62   2e-09
BT007375-1|AAP36039.1|  148|Homo sapiens heat shock protein, 110...    62   2e-09
BC126124-1|AAI26125.1|  840|Homo sapiens heat shock 70kDa protei...    62   2e-09
BC126122-1|AAI26123.1|  840|Homo sapiens heat shock 70kDa protei...    62   2e-09
BC110861-1|AAI10862.1|  840|Homo sapiens heat shock 70kDa protei...    62   2e-09
BC037553-1|AAH37553.1|  858|Homo sapiens heat shock 105kDa/110kD...    62   2e-09
BC002526-1|AAH02526.1|  148|Homo sapiens heat shock 70kDa protei...    62   2e-09
AL137142-5|CAI12430.1|  858|Homo sapiens heat shock 105kDa/110kD...    62   2e-09
AL137142-4|CAI12428.1|  814|Homo sapiens heat shock 105kDa/110kD...    62   2e-09
AL137142-3|CAI12429.1|  817|Homo sapiens heat shock 105kDa/110kD...    62   2e-09
AB209151-1|BAD92388.1|  782|Homo sapiens heat shock 70kDa protei...    62   2e-09
AB023420-1|BAA75062.1|  840|Homo sapiens apg-2 protein.                62   2e-09
AB003334-1|BAA34780.1|  858|Homo sapiens HSP105 alpha protein.         62   2e-09
AB003333-1|BAA34779.1|  814|Homo sapiens HSP105 beta protein.          62   2e-09
M24743-1|AAA59844.1|   36|Homo sapiens HSPA2 protein.                  61   3e-09
U65785-1|AAC50947.1|  999|Homo sapiens 150 kDa oxygen-regulated ...    44   6e-04
DQ372932-1|ABD14370.1|  999|Homo sapiens 150 kDa oxygen-regulate...    44   6e-04
DQ350134-1|ABC75106.1|  999|Homo sapiens 150 kDa oxygen-regulate...    44   6e-04
BC072436-1|AAH72436.1|  678|Homo sapiens HYOU1 protein protein.        44   6e-04
BC017726-1|AAH17726.1|  657|Homo sapiens Unknown (protein for IM...    44   6e-04
BC007276-1|AAH07276.2|  587|Homo sapiens HSPA8 protein protein.        44   6e-04
BC004560-1|AAH04560.1|  147|Homo sapiens HYOU1 protein protein.        44   6e-04
AK222756-1|BAD96476.1|  999|Homo sapiens oxygen regulated protei...    42   0.002
AB018045-1|BAA77235.1|  151|Homo sapiens heat shock protein 72 p...    41   0.004
AL929592-6|CAI18465.1|  476|Homo sapiens heat shock 70kDa protei...    40   0.007
AL671762-5|CAM25532.1|  476|Homo sapiens heat shock 70kDa protei...    40   0.007
AL662834-16|CAM24989.1|  476|Homo sapiens heat shock 70kDa prote...    40   0.007
X04676-1|CAA28381.1|   22|Homo sapiens protein ( Human hsp 70 ge...    35   0.21 
X67640-1|CAA47885.1|  266|Homo sapiens HS24/P52 protein.               34   0.49 
BC001460-1|AAH01460.2| 1019|Homo sapiens La ribonucleoprotein do...    30   6.0  
AK091465-1|BAC03668.1|  816|Homo sapiens protein ( Homo sapiens ...    30   6.0  
AB018274-1|BAA34451.1| 1096|Homo sapiens KIAA0731 protein protein.     30   6.0  

>BC112963-1|AAI12964.1|  655|Homo sapiens HSPA5 protein protein.
          Length = 655

 Score =  167 bits (405), Expect = 4e-41
 Identities = 75/92 (81%), Positives = 85/92 (92%)
 Frame = +2

Query: 230 GRLCRRQEEKDKDIGTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGE 409
           G +   +E+K +D+GTV+GIDLGTTYSCVGV+KNGRVEIIANDQGNRITPSYVAFT +GE
Sbjct: 15  GAVRAEEEDKKEDVGTVVGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTPEGE 74

Query: 410 RLIGDAAKNQLTTNPENTVFDAKRLIGREWSD 505
           RLIGDAAKNQLT+NPENTVFDAKRLIGR W+D
Sbjct: 75  RLIGDAAKNQLTSNPENTVFDAKRLIGRTWND 106



 Score = 64.1 bits (149), Expect = 4e-10
 Identities = 30/45 (66%), Positives = 35/45 (77%), Gaps = 1/45 (2%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGD-KVFAPEEISAMVL 636
           P+VQ D+KF PFKVVEK +KP++QV    G  K FAPEEISAMVL
Sbjct: 107 PSVQQDIKFLPFKVVEKKTKPYIQVDIGGGQTKTFAPEEISAMVL 151


>X87949-1|CAA61201.1|  653|Homo sapiens BiP protein.
          Length = 653

 Score =  166 bits (403), Expect = 7e-41
 Identities = 74/86 (86%), Positives = 83/86 (96%)
 Frame = +2

Query: 248 QEEKDKDIGTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDA 427
           +E+K +D+GTV+GIDLGTTYSCVGV+KNGRVEIIANDQGNRITPSYVAFT +GERLIGDA
Sbjct: 20  EEDKKEDVGTVVGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTPEGERLIGDA 79

Query: 428 AKNQLTTNPENTVFDAKRLIGREWSD 505
           AKNQLT+NPENTVFDAKRLIGR W+D
Sbjct: 80  AKNQLTSNPENTVFDAKRLIGRTWND 105



 Score = 64.1 bits (149), Expect = 4e-10
 Identities = 30/45 (66%), Positives = 35/45 (77%), Gaps = 1/45 (2%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGD-KVFAPEEISAMVL 636
           P+VQ D+KF PFKVVEK +KP++QV    G  K FAPEEISAMVL
Sbjct: 106 PSVQQDIKFLPFKVVEKKTKPYIQVDIGGGQTKTFAPEEISAMVL 150


>M19645-1|AAA52614.1|  653|Homo sapiens protein ( Human 78 kdalton
           glucose-regulated protein (GRP78) gene, complete cds. ).
          Length = 653

 Score =  166 bits (403), Expect = 7e-41
 Identities = 74/86 (86%), Positives = 83/86 (96%)
 Frame = +2

Query: 248 QEEKDKDIGTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDA 427
           +E+K +D+GTV+GIDLGTTYSCVGV+KNGRVEIIANDQGNRITPSYVAFT +GERLIGDA
Sbjct: 20  EEDKKEDVGTVVGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTPEGERLIGDA 79

Query: 428 AKNQLTTNPENTVFDAKRLIGREWSD 505
           AKNQLT+NPENTVFDAKRLIGR W+D
Sbjct: 80  AKNQLTSNPENTVFDAKRLIGRTWND 105



 Score = 64.1 bits (149), Expect = 4e-10
 Identities = 30/45 (66%), Positives = 35/45 (77%), Gaps = 1/45 (2%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGD-KVFAPEEISAMVL 636
           P+VQ D+KF PFKVVEK +KP++QV    G  K FAPEEISAMVL
Sbjct: 106 PSVQQDIKFLPFKVVEKKTKPYIQVDIGGGQTKTFAPEEISAMVL 150


>DQ385847-1|ABD04090.1|  654|Homo sapiens heat shock 70kDa protein 5
           (glucose-regulated protein, 78kDa) protein.
          Length = 654

 Score =  166 bits (403), Expect = 7e-41
 Identities = 74/86 (86%), Positives = 83/86 (96%)
 Frame = +2

Query: 248 QEEKDKDIGTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDA 427
           +E+K +D+GTV+GIDLGTTYSCVGV+KNGRVEIIANDQGNRITPSYVAFT +GERLIGDA
Sbjct: 20  EEDKKEDVGTVVGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTPEGERLIGDA 79

Query: 428 AKNQLTTNPENTVFDAKRLIGREWSD 505
           AKNQLT+NPENTVFDAKRLIGR W+D
Sbjct: 80  AKNQLTSNPENTVFDAKRLIGRTWND 105



 Score = 64.1 bits (149), Expect = 4e-10
 Identities = 30/45 (66%), Positives = 35/45 (77%), Gaps = 1/45 (2%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGD-KVFAPEEISAMVL 636
           P+VQ D+KF PFKVVEK +KP++QV    G  K FAPEEISAMVL
Sbjct: 106 PSVQQDIKFLPFKVVEKKTKPYIQVDIGGGQTKTFAPEEISAMVL 150


>BC020235-1|AAH20235.1|  654|Homo sapiens heat shock 70kDa protein 5
           (glucose-regulated protein, 78kDa) protein.
          Length = 654

 Score =  166 bits (403), Expect = 7e-41
 Identities = 74/86 (86%), Positives = 83/86 (96%)
 Frame = +2

Query: 248 QEEKDKDIGTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDA 427
           +E+K +D+GTV+GIDLGTTYSCVGV+KNGRVEIIANDQGNRITPSYVAFT +GERLIGDA
Sbjct: 20  EEDKKEDVGTVVGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTPEGERLIGDA 79

Query: 428 AKNQLTTNPENTVFDAKRLIGREWSD 505
           AKNQLT+NPENTVFDAKRLIGR W+D
Sbjct: 80  AKNQLTSNPENTVFDAKRLIGRTWND 105



 Score = 64.1 bits (149), Expect = 4e-10
 Identities = 30/45 (66%), Positives = 35/45 (77%), Gaps = 1/45 (2%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGD-KVFAPEEISAMVL 636
           P+VQ D+KF PFKVVEK +KP++QV    G  K FAPEEISAMVL
Sbjct: 106 PSVQQDIKFLPFKVVEKKTKPYIQVDIGGGQTKTFAPEEISAMVL 150


>AJ271729-1|CAB71335.1|  654|Homo sapiens glucose-regulated protein
           protein.
          Length = 654

 Score =  166 bits (403), Expect = 7e-41
 Identities = 74/86 (86%), Positives = 83/86 (96%)
 Frame = +2

Query: 248 QEEKDKDIGTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDA 427
           +E+K +D+GTV+GIDLGTTYSCVGV+KNGRVEIIANDQGNRITPSYVAFT +GERLIGDA
Sbjct: 20  EEDKKEDVGTVVGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTPEGERLIGDA 79

Query: 428 AKNQLTTNPENTVFDAKRLIGREWSD 505
           AKNQLT+NPENTVFDAKRLIGR W+D
Sbjct: 80  AKNQLTSNPENTVFDAKRLIGRTWND 105



 Score = 64.1 bits (149), Expect = 4e-10
 Identities = 30/45 (66%), Positives = 35/45 (77%), Gaps = 1/45 (2%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGD-KVFAPEEISAMVL 636
           P+VQ D+KF PFKVVEK +KP++QV    G  K FAPEEISAMVL
Sbjct: 106 PSVQQDIKFLPFKVVEKKTKPYIQVDIGGGQTKTFAPEEISAMVL 150


>AF216292-1|AAF42836.1|  654|Homo sapiens endoplasmic reticulum
           lumenal Ca2+ binding protein grp78 protein.
          Length = 654

 Score =  166 bits (403), Expect = 7e-41
 Identities = 74/86 (86%), Positives = 83/86 (96%)
 Frame = +2

Query: 248 QEEKDKDIGTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDA 427
           +E+K +D+GTV+GIDLGTTYSCVGV+KNGRVEIIANDQGNRITPSYVAFT +GERLIGDA
Sbjct: 20  EEDKKEDVGTVVGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTPEGERLIGDA 79

Query: 428 AKNQLTTNPENTVFDAKRLIGREWSD 505
           AKNQLT+NPENTVFDAKRLIGR W+D
Sbjct: 80  AKNQLTSNPENTVFDAKRLIGRTWND 105



 Score = 64.1 bits (149), Expect = 4e-10
 Identities = 30/45 (66%), Positives = 35/45 (77%), Gaps = 1/45 (2%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGD-KVFAPEEISAMVL 636
           P+VQ D+KF PFKVVEK +KP++QV    G  K FAPEEISAMVL
Sbjct: 106 PSVQQDIKFLPFKVVEKKTKPYIQVDIGGGQTKTFAPEEISAMVL 150


>AF188611-1|AAF13605.1|  639|Homo sapiens BiP protein protein.
          Length = 639

 Score =  166 bits (403), Expect = 7e-41
 Identities = 74/86 (86%), Positives = 83/86 (96%)
 Frame = +2

Query: 248 QEEKDKDIGTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDA 427
           +E+K +D+GTV+GIDLGTTYSCVGV+KNGRVEIIANDQGNRITPSYVAFT +GERLIGDA
Sbjct: 2   EEDKKEDVGTVVGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTPEGERLIGDA 61

Query: 428 AKNQLTTNPENTVFDAKRLIGREWSD 505
           AKNQLT+NPENTVFDAKRLIGR W+D
Sbjct: 62  AKNQLTSNPENTVFDAKRLIGRTWND 87



 Score = 64.1 bits (149), Expect = 4e-10
 Identities = 30/45 (66%), Positives = 35/45 (77%), Gaps = 1/45 (2%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGD-KVFAPEEISAMVL 636
           P+VQ D+KF PFKVVEK +KP++QV    G  K FAPEEISAMVL
Sbjct: 88  PSVQQDIKFLPFKVVEKKTKPYIQVDIGGGQTKTFAPEEISAMVL 132


>M59829-1|AAA63228.1|  641|Homo sapiens heat shock-induced protein
           protein.
          Length = 641

 Score =  132 bits (319), Expect = 1e-30
 Identities = 62/78 (79%), Positives = 71/78 (91%)
 Frame = +2

Query: 272 GTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTN 451
           G  IGIDLGTTYSCVGV+++G+VEIIANDQGNR TPSYVAFT D ERLIGDAAKNQ+  N
Sbjct: 6   GIAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMN 64

Query: 452 PENTVFDAKRLIGREWSD 505
           P+NTVFDAKRLIGR+++D
Sbjct: 65  PQNTVFDAKRLIGRKFND 82



 Score = 48.0 bits (109), Expect = 3e-05
 Identities = 22/44 (50%), Positives = 29/44 (65%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P VQ D+K +PF+V+ +  KP V V     +K F PEEIS+MVL
Sbjct: 83  PVVQADMKLWPFQVINEGGKPKVLVSYKGENKAFYPEEISSMVL 126


>D85730-1|BAA32521.1|  641|Homo sapiens Heat shock protein 70 testis
           variant protein.
          Length = 641

 Score =  132 bits (319), Expect = 1e-30
 Identities = 62/78 (79%), Positives = 71/78 (91%)
 Frame = +2

Query: 272 GTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTN 451
           G  IGIDLGTTYSCVGV+++G+VEIIANDQGNR TPSYVAFT D ERLIGDAAKNQ+  N
Sbjct: 6   GIAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMN 64

Query: 452 PENTVFDAKRLIGREWSD 505
           P+NTVFDAKRLIGR+++D
Sbjct: 65  PQNTVFDAKRLIGRKFND 82



 Score = 48.0 bits (109), Expect = 3e-05
 Identities = 22/44 (50%), Positives = 29/44 (65%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P VQ D+K +PF+V+ +  KP V V     +K F PEEIS+MVL
Sbjct: 83  PVVQADMKLWPFQVINEGGKPKVLVSYKGENKAFYPEEISSMVL 126


>DQ383515-1|ABC88476.1|  641|Homo sapiens heat shock 70kDa protein
           1-like protein.
          Length = 641

 Score =  132 bits (319), Expect = 1e-30
 Identities = 62/78 (79%), Positives = 71/78 (91%)
 Frame = +2

Query: 272 GTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTN 451
           G  IGIDLGTTYSCVGV+++G+VEIIANDQGNR TPSYVAFT D ERLIGDAAKNQ+  N
Sbjct: 6   GIAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMN 64

Query: 452 PENTVFDAKRLIGREWSD 505
           P+NTVFDAKRLIGR+++D
Sbjct: 65  PQNTVFDAKRLIGRKFND 82



 Score = 48.0 bits (109), Expect = 3e-05
 Identities = 22/44 (50%), Positives = 29/44 (65%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P VQ D+K +PF+V+ +  KP V V     +K F PEEIS+MVL
Sbjct: 83  PVVQADMKLWPFQVINEGGKPKVLVSYKGENKAFYPEEISSMVL 126


>BC034483-1|AAH34483.1|  641|Homo sapiens heat shock 70kDa protein
           1-like protein.
          Length = 641

 Score =  132 bits (319), Expect = 1e-30
 Identities = 62/78 (79%), Positives = 71/78 (91%)
 Frame = +2

Query: 272 GTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTN 451
           G  IGIDLGTTYSCVGV+++G+VEIIANDQGNR TPSYVAFT D ERLIGDAAKNQ+  N
Sbjct: 6   GIAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMN 64

Query: 452 PENTVFDAKRLIGREWSD 505
           P+NTVFDAKRLIGR+++D
Sbjct: 65  PQNTVFDAKRLIGRKFND 82



 Score = 48.0 bits (109), Expect = 3e-05
 Identities = 22/44 (50%), Positives = 29/44 (65%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P VQ D+K +PF+V+ +  KP V V     +K F PEEIS+MVL
Sbjct: 83  PVVQADMKLWPFQVINEGGKPKVLVSYKGENKAFYPEEISSMVL 126


>BA000025-10|BAB63301.1|  641|Homo sapiens heat shock protein
           protein.
          Length = 641

 Score =  132 bits (319), Expect = 1e-30
 Identities = 62/78 (79%), Positives = 71/78 (91%)
 Frame = +2

Query: 272 GTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTN 451
           G  IGIDLGTTYSCVGV+++G+VEIIANDQGNR TPSYVAFT D ERLIGDAAKNQ+  N
Sbjct: 6   GIAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMN 64

Query: 452 PENTVFDAKRLIGREWSD 505
           P+NTVFDAKRLIGR+++D
Sbjct: 65  PQNTVFDAKRLIGRKFND 82



 Score = 48.0 bits (109), Expect = 3e-05
 Identities = 22/44 (50%), Positives = 29/44 (65%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P VQ D+K +PF+V+ +  KP V V     +K F PEEIS+MVL
Sbjct: 83  PVVQADMKLWPFQVINEGGKPKVLVSYKGENKAFYPEEISSMVL 126


>AL929592-4|CAI18463.1|  641|Homo sapiens heat shock 70kDa protein
           1-like protein.
          Length = 641

 Score =  132 bits (319), Expect = 1e-30
 Identities = 62/78 (79%), Positives = 71/78 (91%)
 Frame = +2

Query: 272 GTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTN 451
           G  IGIDLGTTYSCVGV+++G+VEIIANDQGNR TPSYVAFT D ERLIGDAAKNQ+  N
Sbjct: 6   GIAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMN 64

Query: 452 PENTVFDAKRLIGREWSD 505
           P+NTVFDAKRLIGR+++D
Sbjct: 65  PQNTVFDAKRLIGRKFND 82



 Score = 48.0 bits (109), Expect = 3e-05
 Identities = 22/44 (50%), Positives = 29/44 (65%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P VQ D+K +PF+V+ +  KP V V     +K F PEEIS+MVL
Sbjct: 83  PVVQADMKLWPFQVINEGGKPKVLVSYKGENKAFYPEEISSMVL 126


>AL671762-4|CAI18215.1|  641|Homo sapiens heat shock 70kDa protein
           1-like protein.
          Length = 641

 Score =  132 bits (319), Expect = 1e-30
 Identities = 62/78 (79%), Positives = 71/78 (91%)
 Frame = +2

Query: 272 GTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTN 451
           G  IGIDLGTTYSCVGV+++G+VEIIANDQGNR TPSYVAFT D ERLIGDAAKNQ+  N
Sbjct: 6   GIAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMN 64

Query: 452 PENTVFDAKRLIGREWSD 505
           P+NTVFDAKRLIGR+++D
Sbjct: 65  PQNTVFDAKRLIGRKFND 82



 Score = 48.0 bits (109), Expect = 3e-05
 Identities = 22/44 (50%), Positives = 29/44 (65%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P VQ D+K +PF+V+ +  KP V V     +K F PEEIS+MVL
Sbjct: 83  PVVQADMKLWPFQVINEGGKPKVLVSYKGENKAFYPEEISSMVL 126


>AL662834-15|CAI17736.1|  641|Homo sapiens heat shock 70kDa protein
           1-like protein.
          Length = 641

 Score =  132 bits (319), Expect = 1e-30
 Identities = 62/78 (79%), Positives = 71/78 (91%)
 Frame = +2

Query: 272 GTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTN 451
           G  IGIDLGTTYSCVGV+++G+VEIIANDQGNR TPSYVAFT D ERLIGDAAKNQ+  N
Sbjct: 6   GIAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMN 64

Query: 452 PENTVFDAKRLIGREWSD 505
           P+NTVFDAKRLIGR+++D
Sbjct: 65  PQNTVFDAKRLIGRKFND 82



 Score = 48.0 bits (109), Expect = 3e-05
 Identities = 22/44 (50%), Positives = 29/44 (65%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P VQ D+K +PF+V+ +  KP V V     +K F PEEIS+MVL
Sbjct: 83  PVVQADMKLWPFQVINEGGKPKVLVSYKGENKAFYPEEISSMVL 126


>AK223386-1|BAD97106.1|  641|Homo sapiens heat shock 70kDa protein
           1-like variant protein.
          Length = 641

 Score =  132 bits (319), Expect = 1e-30
 Identities = 62/78 (79%), Positives = 71/78 (91%)
 Frame = +2

Query: 272 GTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTN 451
           G  IGIDLGTTYSCVGV+++G+VEIIANDQGNR TPSYVAFT D ERLIGDAAKNQ+  N
Sbjct: 6   GIAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMN 64

Query: 452 PENTVFDAKRLIGREWSD 505
           P+NTVFDAKRLIGR+++D
Sbjct: 65  PQNTVFDAKRLIGRKFND 82



 Score = 48.0 bits (109), Expect = 3e-05
 Identities = 22/44 (50%), Positives = 29/44 (65%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P VQ D+K +PF+V+ +  KP V V     +K F PEEIS+MVL
Sbjct: 83  PVVQADMKLWPFQVINEGGKPKVLVSYKGENKAFYPEEISSMVL 126


>AF134726-8|AAD21817.1|  641|Homo sapiens HSP70-HOM protein.
          Length = 641

 Score =  132 bits (319), Expect = 1e-30
 Identities = 62/78 (79%), Positives = 71/78 (91%)
 Frame = +2

Query: 272 GTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTN 451
           G  IGIDLGTTYSCVGV+++G+VEIIANDQGNR TPSYVAFT D ERLIGDAAKNQ+  N
Sbjct: 6   GIAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMN 64

Query: 452 PENTVFDAKRLIGREWSD 505
           P+NTVFDAKRLIGR+++D
Sbjct: 65  PQNTVFDAKRLIGRKFND 82



 Score = 48.0 bits (109), Expect = 3e-05
 Identities = 22/44 (50%), Positives = 29/44 (65%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P VQ D+K +PF+V+ +  KP V V     +K F PEEIS+MVL
Sbjct: 83  PVVQADMKLWPFQVINEGGKPKVLVSYKGENKAFYPEEISSMVL 126


>U56725-1|AAD11466.1|  639|Homo sapiens heat shock protein protein.
          Length = 639

 Score =  130 bits (315), Expect = 3e-30
 Identities = 63/91 (69%), Positives = 72/91 (79%)
 Frame = +2

Query: 272 GTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTN 451
           G  IGIDLGTTYSCVGV+++G+VEIIANDQGNR TPSYVAFT D ERLIGDAAKNQ+  N
Sbjct: 5   GPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMN 63

Query: 452 PENTVFDAKRLIGREWSDQLYNMMLSSSPSR 544
           P NT+FDAKRLIGR++ D      +   P R
Sbjct: 64  PTNTIFDAKRLIGRKFEDATVQSDMKHWPFR 94



 Score = 50.8 bits (116), Expect = 4e-06
 Identities = 24/43 (55%), Positives = 30/43 (69%)
 Frame = +1

Query: 508 TVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           TVQ D+K +PF+VV +  KP VQV+     K F PEEIS+MVL
Sbjct: 83  TVQSDMKHWPFRVVSEGGKPKVQVEYKGETKTFFPEEISSMVL 125


>L26336-1|AAA52698.1|  639|Homo sapiens heat shock protein protein.
          Length = 639

 Score =  130 bits (315), Expect = 3e-30
 Identities = 63/91 (69%), Positives = 72/91 (79%)
 Frame = +2

Query: 272 GTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTN 451
           G  IGIDLGTTYSCVGV+++G+VEIIANDQGNR TPSYVAFT D ERLIGDAAKNQ+  N
Sbjct: 5   GPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMN 63

Query: 452 PENTVFDAKRLIGREWSDQLYNMMLSSSPSR 544
           P NT+FDAKRLIGR++ D      +   P R
Sbjct: 64  PTNTIFDAKRLIGRKFEDATVQSDMKHWPFR 94



 Score = 50.8 bits (116), Expect = 4e-06
 Identities = 24/43 (55%), Positives = 30/43 (69%)
 Frame = +1

Query: 508 TVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           TVQ D+K +PF+VV +  KP VQV+     K F PEEIS+MVL
Sbjct: 83  TVQSDMKHWPFRVVSEGGKPKVQVEYKGETKTFFPEEISSMVL 125


>DQ489378-1|ABE96830.1|  639|Homo sapiens heat shock 70kDa protein 2
           protein.
          Length = 639

 Score =  130 bits (315), Expect = 3e-30
 Identities = 63/91 (69%), Positives = 72/91 (79%)
 Frame = +2

Query: 272 GTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTN 451
           G  IGIDLGTTYSCVGV+++G+VEIIANDQGNR TPSYVAFT D ERLIGDAAKNQ+  N
Sbjct: 5   GPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMN 63

Query: 452 PENTVFDAKRLIGREWSDQLYNMMLSSSPSR 544
           P NT+FDAKRLIGR++ D      +   P R
Sbjct: 64  PTNTIFDAKRLIGRKFEDATVQSDMKHWPFR 94



 Score = 50.8 bits (116), Expect = 4e-06
 Identities = 24/43 (55%), Positives = 30/43 (69%)
 Frame = +1

Query: 508 TVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           TVQ D+K +PF+VV +  KP VQV+     K F PEEIS+MVL
Sbjct: 83  TVQSDMKHWPFRVVSEGGKPKVQVEYKGETKTFFPEEISSMVL 125


>BT009815-1|AAP88817.1|  639|Homo sapiens heat shock 70kDa protein 2
           protein.
          Length = 639

 Score =  130 bits (315), Expect = 3e-30
 Identities = 63/91 (69%), Positives = 72/91 (79%)
 Frame = +2

Query: 272 GTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTN 451
           G  IGIDLGTTYSCVGV+++G+VEIIANDQGNR TPSYVAFT D ERLIGDAAKNQ+  N
Sbjct: 5   GPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMN 63

Query: 452 PENTVFDAKRLIGREWSDQLYNMMLSSSPSR 544
           P NT+FDAKRLIGR++ D      +   P R
Sbjct: 64  PTNTIFDAKRLIGRKFEDATVQSDMKHWPFR 94



 Score = 50.8 bits (116), Expect = 4e-06
 Identities = 24/43 (55%), Positives = 30/43 (69%)
 Frame = +1

Query: 508 TVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           TVQ D+K +PF+VV +  KP VQV+     K F PEEIS+MVL
Sbjct: 83  TVQSDMKHWPFRVVSEGGKPKVQVEYKGETKTFFPEEISSMVL 125


>BC001752-1|AAH01752.1|  639|Homo sapiens heat shock 70kDa protein 2
           protein.
          Length = 639

 Score =  130 bits (315), Expect = 3e-30
 Identities = 63/91 (69%), Positives = 72/91 (79%)
 Frame = +2

Query: 272 GTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTN 451
           G  IGIDLGTTYSCVGV+++G+VEIIANDQGNR TPSYVAFT D ERLIGDAAKNQ+  N
Sbjct: 5   GPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMN 63

Query: 452 PENTVFDAKRLIGREWSDQLYNMMLSSSPSR 544
           P NT+FDAKRLIGR++ D      +   P R
Sbjct: 64  PTNTIFDAKRLIGRKFEDATVQSDMKHWPFR 94



 Score = 50.8 bits (116), Expect = 4e-06
 Identities = 24/43 (55%), Positives = 30/43 (69%)
 Frame = +1

Query: 508 TVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           TVQ D+K +PF+VV +  KP VQV+     K F PEEIS+MVL
Sbjct: 83  TVQSDMKHWPFRVVSEGGKPKVQVEYKGETKTFFPEEISSMVL 125


>AB209818-1|BAD93055.1|  709|Homo sapiens heat shock 70kDa protein
           1A variant protein.
          Length = 709

 Score =  130 bits (314), Expect = 4e-30
 Identities = 65/92 (70%), Positives = 75/92 (81%), Gaps = 6/92 (6%)
 Frame = +2

Query: 248 QEEKDKDIGT------VIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGE 409
           Q   D++ GT       IGIDLGTTYSCVGV+++G+VEIIANDQGNR TPSYVAFT D E
Sbjct: 58  QSRADREQGTGMAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTE 116

Query: 410 RLIGDAAKNQLTTNPENTVFDAKRLIGREWSD 505
           RLIGDAAKNQ+  NP+NTVFDAKRLIGR++ D
Sbjct: 117 RLIGDAAKNQVALNPQNTVFDAKRLIGRKFGD 148



 Score = 49.6 bits (113), Expect = 9e-06
 Identities = 23/44 (52%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P VQ D+K +PF+V+    KP VQV      K F PEEIS+MVL
Sbjct: 149 PVVQSDMKHWPFQVINDGDKPKVQVSYKGDTKAFYPEEISSMVL 192


>Y00371-1|CAA68445.1|  646|Homo sapiens 71 Kd heat shock cognate
           protein protein.
          Length = 646

 Score =  130 bits (313), Expect = 5e-30
 Identities = 61/78 (78%), Positives = 68/78 (87%)
 Frame = +2

Query: 272 GTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTN 451
           G  +GIDLGTTYSCVGV+++G+VEIIANDQGNR TPSYVAFT D ERLIGDAAKNQ+  N
Sbjct: 4   GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMN 62

Query: 452 PENTVFDAKRLIGREWSD 505
           P NTVFDAKRLIGR + D
Sbjct: 63  PTNTVFDAKRLIGRRFDD 80



 Score = 43.6 bits (98), Expect = 6e-04
 Identities = 21/42 (50%), Positives = 27/42 (64%)
 Frame = +1

Query: 511 VQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           VQ D+K +PF VV    +P VQV+     K F PEE+S+MVL
Sbjct: 83  VQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVL 124


>M59830-1|AAA63227.1|  641|Homo sapiens heat shock-induced protein
           protein.
          Length = 641

 Score =  130 bits (313), Expect = 5e-30
 Identities = 61/75 (81%), Positives = 69/75 (92%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGV+++G+VEIIANDQGNR TPSYVAFT D ERLIGDAAKNQ+  NP+N
Sbjct: 7   IGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVALNPQN 65

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 66  TVFDAKRLIGRKFGD 80



 Score = 49.2 bits (112), Expect = 1e-05
 Identities = 23/44 (52%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P VQ D+K +PF+V+    KP VQV      K F PEEIS+MVL
Sbjct: 81  PVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEEISSMVL 124


>M59828-1|AAA63226.1|  641|Homo sapiens heat shock-induced protein
           protein.
          Length = 641

 Score =  130 bits (313), Expect = 5e-30
 Identities = 61/75 (81%), Positives = 69/75 (92%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGV+++G+VEIIANDQGNR TPSYVAFT D ERLIGDAAKNQ+  NP+N
Sbjct: 7   IGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVALNPQN 65

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 66  TVFDAKRLIGRKFGD 80



 Score = 49.2 bits (112), Expect = 1e-05
 Identities = 23/44 (52%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P VQ D+K +PF+V+    KP VQV      K F PEEIS+MVL
Sbjct: 81  PVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEEISSMVL 124


>DQ451402-1|ABD96830.1|  641|Homo sapiens heat shock 70kDa protein
           1A protein.
          Length = 641

 Score =  130 bits (313), Expect = 5e-30
 Identities = 61/75 (81%), Positives = 69/75 (92%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGV+++G+VEIIANDQGNR TPSYVAFT D ERLIGDAAKNQ+  NP+N
Sbjct: 7   IGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVALNPQN 65

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 66  TVFDAKRLIGRKFGD 80



 Score = 49.2 bits (112), Expect = 1e-05
 Identities = 23/44 (52%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P VQ D+K +PF+V+    KP VQV      K F PEEIS+MVL
Sbjct: 81  PVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEEISSMVL 124


>DQ388429-1|ABD48956.1|  641|Homo sapiens heat shock 70kDa protein
           1B protein.
          Length = 641

 Score =  130 bits (313), Expect = 5e-30
 Identities = 61/75 (81%), Positives = 69/75 (92%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGV+++G+VEIIANDQGNR TPSYVAFT D ERLIGDAAKNQ+  NP+N
Sbjct: 7   IGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVALNPQN 65

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 66  TVFDAKRLIGRKFGD 80



 Score = 49.2 bits (112), Expect = 1e-05
 Identities = 23/44 (52%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P VQ D+K +PF+V+    KP VQV      K F PEEIS+MVL
Sbjct: 81  PVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEEISSMVL 124


>BC063507-1|AAH63507.1|  641|Homo sapiens heat shock 70kDa protein
           1B protein.
          Length = 641

 Score =  130 bits (313), Expect = 5e-30
 Identities = 61/75 (81%), Positives = 69/75 (92%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGV+++G+VEIIANDQGNR TPSYVAFT D ERLIGDAAKNQ+  NP+N
Sbjct: 7   IGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVALNPQN 65

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 66  TVFDAKRLIGRKFGD 80



 Score = 49.2 bits (112), Expect = 1e-05
 Identities = 23/44 (52%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P VQ D+K +PF+V+    KP VQV      K F PEEIS+MVL
Sbjct: 81  PVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEEISSMVL 124


>BC057397-1|AAH57397.1|  641|Homo sapiens heat shock 70kDa protein
           1B protein.
          Length = 641

 Score =  130 bits (313), Expect = 5e-30
 Identities = 61/75 (81%), Positives = 69/75 (92%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGV+++G+VEIIANDQGNR TPSYVAFT D ERLIGDAAKNQ+  NP+N
Sbjct: 7   IGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVALNPQN 65

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 66  TVFDAKRLIGRKFGD 80



 Score = 49.2 bits (112), Expect = 1e-05
 Identities = 23/44 (52%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P VQ D+K +PF+V+    KP VQV      K F PEEIS+MVL
Sbjct: 81  PVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEEISSMVL 124


>BC019816-1|AAH19816.1|  646|Homo sapiens heat shock 70kDa protein 8
           protein.
          Length = 646

 Score =  130 bits (313), Expect = 5e-30
 Identities = 61/78 (78%), Positives = 68/78 (87%)
 Frame = +2

Query: 272 GTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTN 451
           G  +GIDLGTTYSCVGV+++G+VEIIANDQGNR TPSYVAFT D ERLIGDAAKNQ+  N
Sbjct: 4   GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMN 62

Query: 452 PENTVFDAKRLIGREWSD 505
           P NTVFDAKRLIGR + D
Sbjct: 63  PTNTVFDAKRLIGRRFDD 80



 Score = 43.6 bits (98), Expect = 6e-04
 Identities = 21/42 (50%), Positives = 27/42 (64%)
 Frame = +1

Query: 511 VQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           VQ D+K +PF VV    +P VQV+     K F PEE+S+MVL
Sbjct: 83  VQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVL 124


>BC018740-1|AAH18740.1|  641|Homo sapiens HSPA1A protein protein.
          Length = 641

 Score =  130 bits (313), Expect = 5e-30
 Identities = 61/75 (81%), Positives = 69/75 (92%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGV+++G+VEIIANDQGNR TPSYVAFT D ERLIGDAAKNQ+  NP+N
Sbjct: 7   IGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVALNPQN 65

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 66  TVFDAKRLIGRKFGD 80



 Score = 49.2 bits (112), Expect = 1e-05
 Identities = 23/44 (52%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P VQ D+K +PF+V+    KP VQV      K F PEEIS+MVL
Sbjct: 81  PVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEEISSMVL 124


>BC016660-1|AAH16660.1|  646|Homo sapiens heat shock 70kDa protein 8
           protein.
          Length = 646

 Score =  130 bits (313), Expect = 5e-30
 Identities = 61/78 (78%), Positives = 68/78 (87%)
 Frame = +2

Query: 272 GTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTN 451
           G  +GIDLGTTYSCVGV+++G+VEIIANDQGNR TPSYVAFT D ERLIGDAAKNQ+  N
Sbjct: 4   GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMN 62

Query: 452 PENTVFDAKRLIGREWSD 505
           P NTVFDAKRLIGR + D
Sbjct: 63  PTNTVFDAKRLIGRRFDD 80



 Score = 43.6 bits (98), Expect = 6e-04
 Identities = 21/42 (50%), Positives = 27/42 (64%)
 Frame = +1

Query: 511 VQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           VQ D+K +PF VV    +P VQV+     K F PEE+S+MVL
Sbjct: 83  VQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVL 124


>BC016179-1|AAH16179.1|  646|Homo sapiens heat shock 70kDa protein 8
           protein.
          Length = 646

 Score =  130 bits (313), Expect = 5e-30
 Identities = 61/78 (78%), Positives = 68/78 (87%)
 Frame = +2

Query: 272 GTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTN 451
           G  +GIDLGTTYSCVGV+++G+VEIIANDQGNR TPSYVAFT D ERLIGDAAKNQ+  N
Sbjct: 4   GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMN 62

Query: 452 PENTVFDAKRLIGREWSD 505
           P NTVFDAKRLIGR + D
Sbjct: 63  PTNTVFDAKRLIGRRFDD 80



 Score = 43.6 bits (98), Expect = 6e-04
 Identities = 21/42 (50%), Positives = 27/42 (64%)
 Frame = +1

Query: 511 VQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           VQ D+K +PF VV    +P VQV+     K F PEE+S+MVL
Sbjct: 83  VQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVL 124


>BC009322-1|AAH09322.1|  641|Homo sapiens HSPA1A protein protein.
          Length = 641

 Score =  130 bits (313), Expect = 5e-30
 Identities = 61/75 (81%), Positives = 69/75 (92%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGV+++G+VEIIANDQGNR TPSYVAFT D ERLIGDAAKNQ+  NP+N
Sbjct: 7   IGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVALNPQN 65

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 66  TVFDAKRLIGRKFGD 80



 Score = 49.2 bits (112), Expect = 1e-05
 Identities = 23/44 (52%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P VQ D+K +PF+V+    KP VQV      K F PEEIS+MVL
Sbjct: 81  PVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEEISSMVL 124


>BC002453-1|AAH02453.1|  641|Homo sapiens heat shock 70kDa protein
           1A protein.
          Length = 641

 Score =  130 bits (313), Expect = 5e-30
 Identities = 61/75 (81%), Positives = 69/75 (92%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGV+++G+VEIIANDQGNR TPSYVAFT D ERLIGDAAKNQ+  NP+N
Sbjct: 7   IGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVALNPQN 65

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 66  TVFDAKRLIGRKFGD 80



 Score = 49.2 bits (112), Expect = 1e-05
 Identities = 23/44 (52%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P VQ D+K +PF+V+    KP VQV      K F PEEIS+MVL
Sbjct: 81  PVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEEISSMVL 124


>BA000025-9|BAB63300.1|  641|Homo sapiens heat shock protein
           protein.
          Length = 641

 Score =  130 bits (313), Expect = 5e-30
 Identities = 61/75 (81%), Positives = 69/75 (92%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGV+++G+VEIIANDQGNR TPSYVAFT D ERLIGDAAKNQ+  NP+N
Sbjct: 7   IGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVALNPQN 65

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 66  TVFDAKRLIGRKFGD 80



 Score = 49.2 bits (112), Expect = 1e-05
 Identities = 23/44 (52%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P VQ D+K +PF+V+    KP VQV      K F PEEIS+MVL
Sbjct: 81  PVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEEISSMVL 124


>BA000025-8|BAB63299.1|  641|Homo sapiens heat shock protein
           protein.
          Length = 641

 Score =  130 bits (313), Expect = 5e-30
 Identities = 61/75 (81%), Positives = 69/75 (92%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGV+++G+VEIIANDQGNR TPSYVAFT D ERLIGDAAKNQ+  NP+N
Sbjct: 7   IGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVALNPQN 65

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 66  TVFDAKRLIGRKFGD 80



 Score = 49.2 bits (112), Expect = 1e-05
 Identities = 23/44 (52%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P VQ D+K +PF+V+    KP VQV      K F PEEIS+MVL
Sbjct: 81  PVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEEISSMVL 124


>AL929592-7|CAI18466.1|  641|Homo sapiens heat shock 70kDa protein
           1B protein.
          Length = 641

 Score =  130 bits (313), Expect = 5e-30
 Identities = 61/75 (81%), Positives = 69/75 (92%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGV+++G+VEIIANDQGNR TPSYVAFT D ERLIGDAAKNQ+  NP+N
Sbjct: 7   IGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVALNPQN 65

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 66  TVFDAKRLIGRKFGD 80



 Score = 49.2 bits (112), Expect = 1e-05
 Identities = 23/44 (52%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P VQ D+K +PF+V+    KP VQV      K F PEEIS+MVL
Sbjct: 81  PVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEEISSMVL 124


>AL929592-5|CAI18464.1|  641|Homo sapiens heat shock 70kDa protein
           1A protein.
          Length = 641

 Score =  130 bits (313), Expect = 5e-30
 Identities = 61/75 (81%), Positives = 69/75 (92%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGV+++G+VEIIANDQGNR TPSYVAFT D ERLIGDAAKNQ+  NP+N
Sbjct: 7   IGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVALNPQN 65

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 66  TVFDAKRLIGRKFGD 80



 Score = 49.6 bits (113), Expect = 9e-06
 Identities = 23/44 (52%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P VQ D+K +PF+V+    KP VQV      K F PEEIS+MVL
Sbjct: 81  PVVQSDMKHWPFQVINDGDKPKVQVSYKGDTKAFYPEEISSMVL 124


>AL671762-7|CAI18217.1|  641|Homo sapiens heat shock 70kDa protein
           1B protein.
          Length = 641

 Score =  130 bits (313), Expect = 5e-30
 Identities = 61/75 (81%), Positives = 69/75 (92%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGV+++G+VEIIANDQGNR TPSYVAFT D ERLIGDAAKNQ+  NP+N
Sbjct: 7   IGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVALNPQN 65

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 66  TVFDAKRLIGRKFGD 80



 Score = 49.2 bits (112), Expect = 1e-05
 Identities = 23/44 (52%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P VQ D+K +PF+V+    KP VQV      K F PEEIS+MVL
Sbjct: 81  PVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEEISSMVL 124


>AL671762-6|CAI18216.1|  641|Homo sapiens heat shock 70kDa protein
           1A protein.
          Length = 641

 Score =  130 bits (313), Expect = 5e-30
 Identities = 61/75 (81%), Positives = 69/75 (92%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGV+++G+VEIIANDQGNR TPSYVAFT D ERLIGDAAKNQ+  NP+N
Sbjct: 7   IGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVALNPQN 65

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 66  TVFDAKRLIGRKFGD 80



 Score = 49.2 bits (112), Expect = 1e-05
 Identities = 23/44 (52%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P VQ D+K +PF+V+    KP VQV      K F PEEIS+MVL
Sbjct: 81  PVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEEISSMVL 124


>AL662834-18|CAI17738.1|  641|Homo sapiens heat shock 70kDa protein
           1B protein.
          Length = 641

 Score =  130 bits (313), Expect = 5e-30
 Identities = 61/75 (81%), Positives = 69/75 (92%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGV+++G+VEIIANDQGNR TPSYVAFT D ERLIGDAAKNQ+  NP+N
Sbjct: 7   IGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVALNPQN 65

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 66  TVFDAKRLIGRKFGD 80



 Score = 49.2 bits (112), Expect = 1e-05
 Identities = 23/44 (52%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P VQ D+K +PF+V+    KP VQV      K F PEEIS+MVL
Sbjct: 81  PVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEEISSMVL 124


>AL662834-17|CAI17737.1|  641|Homo sapiens heat shock 70kDa protein
           1A protein.
          Length = 641

 Score =  130 bits (313), Expect = 5e-30
 Identities = 61/75 (81%), Positives = 69/75 (92%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGV+++G+VEIIANDQGNR TPSYVAFT D ERLIGDAAKNQ+  NP+N
Sbjct: 7   IGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVALNPQN 65

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 66  TVFDAKRLIGRKFGD 80



 Score = 49.2 bits (112), Expect = 1e-05
 Identities = 23/44 (52%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P VQ D+K +PF+V+    KP VQV      K F PEEIS+MVL
Sbjct: 81  PVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEEISSMVL 124


>AK222785-1|BAD96505.1|  646|Homo sapiens heat shock 70kDa protein 8
           isoform 1 variant protein.
          Length = 646

 Score =  130 bits (313), Expect = 5e-30
 Identities = 61/78 (78%), Positives = 68/78 (87%)
 Frame = +2

Query: 272 GTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTN 451
           G  +GIDLGTTYSCVGV+++G+VEIIANDQGNR TPSYVAFT D ERLIGDAAKNQ+  N
Sbjct: 4   GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMN 62

Query: 452 PENTVFDAKRLIGREWSD 505
           P NTVFDAKRLIGR + D
Sbjct: 63  PTNTVFDAKRLIGRRFDD 80



 Score = 43.6 bits (98), Expect = 6e-04
 Identities = 21/42 (50%), Positives = 27/42 (64%)
 Frame = +1

Query: 511 VQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           VQ D+K +PF VV    +P VQV+     K F PEE+S+MVL
Sbjct: 83  VQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVL 124


>AK222628-1|BAD96348.1|  493|Homo sapiens heat shock 70kDa protein 8
           isoform 2 variant protein.
          Length = 493

 Score =  130 bits (313), Expect = 5e-30
 Identities = 61/78 (78%), Positives = 68/78 (87%)
 Frame = +2

Query: 272 GTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTN 451
           G  +GIDLGTTYSCVGV+++G+VEIIANDQGNR TPSYVAFT D ERLIGDAAKNQ+  N
Sbjct: 4   GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMN 62

Query: 452 PENTVFDAKRLIGREWSD 505
           P NTVFDAKRLIGR + D
Sbjct: 63  PTNTVFDAKRLIGRRFDD 80



 Score = 43.6 bits (98), Expect = 6e-04
 Identities = 21/42 (50%), Positives = 27/42 (64%)
 Frame = +1

Query: 511 VQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           VQ D+K +PF VV    +P VQV+     K F PEE+S+MVL
Sbjct: 83  VQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVL 124


>AF352832-1|AAK17898.1|  646|Homo sapiens constitutive heat shock
           protein 70 protein.
          Length = 646

 Score =  130 bits (313), Expect = 5e-30
 Identities = 61/78 (78%), Positives = 68/78 (87%)
 Frame = +2

Query: 272 GTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTN 451
           G  +GIDLGTTYSCVGV+++G+VEIIANDQGNR TPSYVAFT D ERLIGDAAKNQ+  N
Sbjct: 4   GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMN 62

Query: 452 PENTVFDAKRLIGREWSD 505
           P NTVFDAKRLIGR + D
Sbjct: 63  PTNTVFDAKRLIGRRFDD 80



 Score = 43.6 bits (98), Expect = 6e-04
 Identities = 21/42 (50%), Positives = 27/42 (64%)
 Frame = +1

Query: 511 VQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           VQ D+K +PF VV    +P VQV+     K F PEE+S+MVL
Sbjct: 83  VQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVL 124


>AF134726-7|AAD21816.1|  641|Homo sapiens HSP70-1 protein.
          Length = 641

 Score =  130 bits (313), Expect = 5e-30
 Identities = 61/75 (81%), Positives = 69/75 (92%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGV+++G+VEIIANDQGNR TPSYVAFT D ERLIGDAAKNQ+  NP+N
Sbjct: 7   IGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVALNPQN 65

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 66  TVFDAKRLIGRKFGD 80



 Score = 49.6 bits (113), Expect = 9e-06
 Identities = 23/44 (52%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P VQ D+K +PF+V+    KP VQV      K F PEEIS+MVL
Sbjct: 81  PVVQSDMKHWPFQVINDGDKPKVQVSYKGDTKAFYPEEISSMVL 124


>AF134726-6|AAD21815.1|  641|Homo sapiens HSP70-2 protein.
          Length = 641

 Score =  130 bits (313), Expect = 5e-30
 Identities = 61/75 (81%), Positives = 69/75 (92%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGV+++G+VEIIANDQGNR TPSYVAFT D ERLIGDAAKNQ+  NP+N
Sbjct: 7   IGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVALNPQN 65

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 66  TVFDAKRLIGRKFGD 80



 Score = 49.2 bits (112), Expect = 1e-05
 Identities = 23/44 (52%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P VQ D+K +PF+V+    KP VQV      K F PEEIS+MVL
Sbjct: 81  PVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEEISSMVL 124


>AB034951-1|BAB18615.1|  493|Homo sapiens heat shock cognate protein
           54 protein.
          Length = 493

 Score =  130 bits (313), Expect = 5e-30
 Identities = 61/78 (78%), Positives = 68/78 (87%)
 Frame = +2

Query: 272 GTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTN 451
           G  +GIDLGTTYSCVGV+++G+VEIIANDQGNR TPSYVAFT D ERLIGDAAKNQ+  N
Sbjct: 4   GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMN 62

Query: 452 PENTVFDAKRLIGREWSD 505
           P NTVFDAKRLIGR + D
Sbjct: 63  PTNTVFDAKRLIGRRFDD 80



 Score = 43.6 bits (98), Expect = 6e-04
 Identities = 21/42 (50%), Positives = 27/42 (64%)
 Frame = +1

Query: 511 VQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           VQ D+K +PF VV    +P VQV+     K F PEE+S+MVL
Sbjct: 83  VQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVL 124


>M11717-1|AAA52697.1|  640|Homo sapiens heat shock protein protein.
          Length = 640

 Score =  129 bits (312), Expect = 7e-30
 Identities = 60/75 (80%), Positives = 69/75 (92%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           +GIDLGTTYSCVGV+++G+VEIIANDQGNR TPSYVAFT D ERLIGDAAKNQ+  NP+N
Sbjct: 7   VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVALNPQN 65

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 66  TVFDAKRLIGRKFGD 80



 Score = 49.2 bits (112), Expect = 1e-05
 Identities = 23/44 (52%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P VQ D+K +PF+V+    KP VQV      K F PEEIS+MVL
Sbjct: 81  PVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEEISSMVL 124


>BC036107-1|AAH36107.1|  639|Homo sapiens HSPA2 protein protein.
          Length = 639

 Score =  128 bits (309), Expect = 2e-29
 Identities = 62/91 (68%), Positives = 71/91 (78%)
 Frame = +2

Query: 272 GTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTN 451
           G  IGIDLG TYSCVGV+++G+VEIIANDQGNR TPSYVAFT D ERLIGDAAKNQ+  N
Sbjct: 5   GPAIGIDLGPTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMN 63

Query: 452 PENTVFDAKRLIGREWSDQLYNMMLSSSPSR 544
           P NT+FDAKRLIGR++ D      +   P R
Sbjct: 64  PTNTIFDAKRLIGRKFGDATVQSDMKHWPFR 94



 Score = 50.8 bits (116), Expect = 4e-06
 Identities = 24/43 (55%), Positives = 30/43 (69%)
 Frame = +1

Query: 508 TVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           TVQ D+K +PF+VV +  KP VQV+     K F PEEIS+MVL
Sbjct: 83  TVQSDMKHWPFRVVSEGGKPKVQVEYKGETKTFFPEEISSMVL 125


>M11236-1|AAA52696.1|  247|Homo sapiens HSPA1L protein.
          Length = 247

 Score =  128 bits (308), Expect = 2e-29
 Identities = 59/75 (78%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           +GIDLGTTYSCVGV++ GRVEI+ANDQGNR TPSYVAFT D ERL+GDAAKNQ   NP N
Sbjct: 9   VGIDLGTTYSCVGVFQQGRVEILANDQGNRTTPSYVAFT-DTERLVGDAAKNQAALNPHN 67

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR+++D
Sbjct: 68  TVFDAKRLIGRKFAD 82



 Score = 49.6 bits (113), Expect = 9e-06
 Identities = 25/43 (58%), Positives = 29/43 (67%)
 Frame = +1

Query: 508 TVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           TVQ D+K +PFKVV    KP V+V     DK F PEEIS+MVL
Sbjct: 84  TVQSDMKHWPFKVVSGGGKPKVRVCYRGEDKTFYPEEISSMVL 126


>X51757-1|CAA36061.1|  643|Homo sapiens protein ( Human heat-shock
           protein HSP70B' gene. ).
          Length = 643

 Score =  126 bits (304), Expect = 7e-29
 Identities = 60/88 (68%), Positives = 70/88 (79%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           +GIDLGTTYSCVGV++ GRVEI+ANDQGNR TPSYVAFT D ERL+GDAAK+Q   NP N
Sbjct: 9   VGIDLGTTYSCVGVFQQGRVEILANDQGNRTTPSYVAFT-DTERLVGDAAKSQAALNPHN 67

Query: 461 TVFDAKRLIGREWSDQLYNMMLSSSPSR 544
           TVFDAKRLIGR+++D      +   P R
Sbjct: 68  TVFDAKRLIGRKFADTTVQSDMKHWPFR 95



 Score = 50.0 bits (114), Expect = 7e-06
 Identities = 24/43 (55%), Positives = 29/43 (67%)
 Frame = +1

Query: 508 TVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           TVQ D+K +PF+VV +  KP V V     DK F PEEIS+MVL
Sbjct: 84  TVQSDMKHWPFRVVSEGGKPKVPVSYRGEDKTFYPEEISSMVL 126


>DQ521571-1|ABF47108.1|  643|Homo sapiens heat shock 70kDa protein 6
           (HSP70B') protein.
          Length = 643

 Score =  126 bits (304), Expect = 7e-29
 Identities = 60/88 (68%), Positives = 70/88 (79%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           +GIDLGTTYSCVGV++ GRVEI+ANDQGNR TPSYVAFT D ERL+GDAAK+Q   NP N
Sbjct: 9   VGIDLGTTYSCVGVFQQGRVEILANDQGNRTTPSYVAFT-DTERLVGDAAKSQAALNPHN 67

Query: 461 TVFDAKRLIGREWSDQLYNMMLSSSPSR 544
           TVFDAKRLIGR+++D      +   P R
Sbjct: 68  TVFDAKRLIGRKFADTTVQSDMKHWPFR 95



 Score = 49.6 bits (113), Expect = 9e-06
 Identities = 24/43 (55%), Positives = 30/43 (69%)
 Frame = +1

Query: 508 TVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           TVQ D+K +PF+VV +  KP V+V     DK F PEEIS+MVL
Sbjct: 84  TVQSDMKHWPFRVVSEGGKPKVRVCYRGEDKTFYPEEISSMVL 126


>BC035665-1|AAH35665.1|  643|Homo sapiens heat shock 70kDa protein 6
           (HSP70B') protein.
          Length = 643

 Score =  126 bits (304), Expect = 7e-29
 Identities = 60/88 (68%), Positives = 70/88 (79%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           +GIDLGTTYSCVGV++ GRVEI+ANDQGNR TPSYVAFT D ERL+GDAAK+Q   NP N
Sbjct: 9   VGIDLGTTYSCVGVFQQGRVEILANDQGNRTTPSYVAFT-DTERLVGDAAKSQAALNPHN 67

Query: 461 TVFDAKRLIGREWSDQLYNMMLSSSPSR 544
           TVFDAKRLIGR+++D      +   P R
Sbjct: 68  TVFDAKRLIGRKFADTTVQSDMKHWPFR 95



 Score = 49.6 bits (113), Expect = 9e-06
 Identities = 24/43 (55%), Positives = 30/43 (69%)
 Frame = +1

Query: 508 TVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           TVQ D+K +PF+VV +  KP V+V     DK F PEEIS+MVL
Sbjct: 84  TVQSDMKHWPFRVVSEGGKPKVRVCYRGEDKTFYPEEISSMVL 126


>AL590385-3|CAI16120.1|  643|Homo sapiens heat shock 70kDa protein 6
           (HSP70B') protein.
          Length = 643

 Score =  126 bits (304), Expect = 7e-29
 Identities = 60/88 (68%), Positives = 70/88 (79%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           +GIDLGTTYSCVGV++ GRVEI+ANDQGNR TPSYVAFT D ERL+GDAAK+Q   NP N
Sbjct: 9   VGIDLGTTYSCVGVFQQGRVEILANDQGNRTTPSYVAFT-DTERLVGDAAKSQAALNPHN 67

Query: 461 TVFDAKRLIGREWSDQLYNMMLSSSPSR 544
           TVFDAKRLIGR+++D      +   P R
Sbjct: 68  TVFDAKRLIGRKFADTTVQSDMKHWPFR 95



 Score = 49.6 bits (113), Expect = 9e-06
 Identities = 24/43 (55%), Positives = 30/43 (69%)
 Frame = +1

Query: 508 TVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           TVQ D+K +PF+VV +  KP V+V     DK F PEEIS+MVL
Sbjct: 84  TVQSDMKHWPFRVVSEGGKPKVRVCYRGEDKTFYPEEISSMVL 126


>AK223362-1|BAD97082.1|  643|Homo sapiens heat shock 70kDa protein 6
           (HSP70B') variant protein.
          Length = 643

 Score =  126 bits (304), Expect = 7e-29
 Identities = 60/88 (68%), Positives = 70/88 (79%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           +GIDLGTTYSCVGV++ GRVEI+ANDQGNR TPSYVAFT D ERL+GDAAK+Q   NP N
Sbjct: 9   VGIDLGTTYSCVGVFQQGRVEILANDQGNRTTPSYVAFT-DTERLVGDAAKSQAALNPHN 67

Query: 461 TVFDAKRLIGREWSDQLYNMMLSSSPSR 544
           TVFDAKRLIGR+++D      +   P R
Sbjct: 68  TVFDAKRLIGRKFADTTVQSDMKHWPFR 95



 Score = 49.6 bits (113), Expect = 9e-06
 Identities = 24/43 (55%), Positives = 30/43 (69%)
 Frame = +1

Query: 508 TVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           TVQ D+K +PF+VV +  KP V+V     DK F PEEIS+MVL
Sbjct: 84  TVQSDMKHWPFRVVSEGGKPKVRVCYRGEDKTFYPEEISSMVL 126


>U10149-1|AAC50076.1|  125|Homo sapiens heat shock protein protein.
          Length = 125

 Score =  124 bits (298), Expect = 4e-28
 Identities = 62/91 (68%), Positives = 71/91 (78%)
 Frame = +2

Query: 272 GTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTN 451
           G  IGIDLGTTYSCVGV+++G+VEIIANDQGNR TPSYVAFT D ERLIG AAKNQ+  N
Sbjct: 5   GPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIG-AAKNQVAMN 62

Query: 452 PENTVFDAKRLIGREWSDQLYNMMLSSSPSR 544
           P NT+FDAKRLIGR++ D      +   P R
Sbjct: 63  PTNTIFDAKRLIGRKFEDATVQSDMKHWPFR 93



 Score = 50.8 bits (116), Expect = 4e-06
 Identities = 24/43 (55%), Positives = 30/43 (69%)
 Frame = +1

Query: 508 TVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           TVQ D+K +PF+VV +  KP VQV+     K F PEEIS+MVL
Sbjct: 82  TVQSDMKHWPFRVVSEGGKPKVQVEYKGETKTFFPEEISSMVL 124


>BC030634-1|AAH30634.1|  681|Homo sapiens HSPA9 protein protein.
          Length = 681

 Score = 99.5 bits (237), Expect = 9e-21
 Identities = 49/92 (53%), Positives = 61/92 (66%), Gaps = 1/92 (1%)
 Frame = +2

Query: 233 RLCRRQEEKDKDI-GTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGE 409
           RL  R++   + I G V+GIDLGTT SCV V +  R +++ N +G R TPS VAFT DGE
Sbjct: 41  RLVSRRDYASEAIKGAVVGIDLGTTNSCVAVMEGKRAKVLENAEGARTTPSVVAFTADGE 100

Query: 410 RLIGDAAKNQLTTNPENTVFDAKRLIGREWSD 505
           RL+G  AK Q  TNP NT +  KRLIGR + D
Sbjct: 101 RLVGMPAKRQAVTNPNNTFYATKRLIGRRYDD 132


>BC024034-1|AAH24034.1|  679|Homo sapiens heat shock 70kDa protein 9
           (mortalin) protein.
          Length = 679

 Score = 99.5 bits (237), Expect = 9e-21
 Identities = 49/92 (53%), Positives = 61/92 (66%), Gaps = 1/92 (1%)
 Frame = +2

Query: 233 RLCRRQEEKDKDI-GTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGE 409
           RL  R++   + I G V+GIDLGTT SCV V +  R +++ N +G R TPS VAFT DGE
Sbjct: 39  RLVSRRDYASEAIKGAVVGIDLGTTNSCVAVMEGKRAKVLENAEGARTTPSVVAFTADGE 98

Query: 410 RLIGDAAKNQLTTNPENTVFDAKRLIGREWSD 505
           RL+G  AK Q  TNP NT +  KRLIGR + D
Sbjct: 99  RLVGMPAKRQAVTNPNNTFYATKRLIGRRYDD 130


>BC000478-1|AAH00478.1|  679|Homo sapiens heat shock 70kDa protein 9
           (mortalin) protein.
          Length = 679

 Score = 99.5 bits (237), Expect = 9e-21
 Identities = 49/92 (53%), Positives = 61/92 (66%), Gaps = 1/92 (1%)
 Frame = +2

Query: 233 RLCRRQEEKDKDI-GTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGE 409
           RL  R++   + I G V+GIDLGTT SCV V +  R +++ N +G R TPS VAFT DGE
Sbjct: 39  RLVSRRDYASEAIKGAVVGIDLGTTNSCVAVMEGKRAKVLENAEGARTTPSVVAFTADGE 98

Query: 410 RLIGDAAKNQLTTNPENTVFDAKRLIGREWSD 505
           RL+G  AK Q  TNP NT +  KRLIGR + D
Sbjct: 99  RLVGMPAKRQAVTNPNNTFYATKRLIGRRYDD 130


>L15189-1|AAA67526.1|  679|Homo sapiens MTHSP75 protein.
          Length = 679

 Score = 97.9 bits (233), Expect = 3e-20
 Identities = 48/92 (52%), Positives = 61/92 (66%), Gaps = 1/92 (1%)
 Frame = +2

Query: 233 RLCRRQEEKDKDI-GTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGE 409
           RL  R++   + I G V+GIDLGTT SCV V +  + +++ N +G R TPS VAFT DGE
Sbjct: 39  RLVSRRDYASEAIKGAVVGIDLGTTNSCVAVMEGKQAKVLENAEGARTTPSVVAFTADGE 98

Query: 410 RLIGDAAKNQLTTNPENTVFDAKRLIGREWSD 505
           RL+G  AK Q  TNP NT +  KRLIGR + D
Sbjct: 99  RLVGMPAKRQAVTNPNNTFYATKRLIGRRYDD 130


>DQ531046-1|ABF50973.1|  679|Homo sapiens heat shock 70kDa protein
           9B (mortalin-2) protein.
          Length = 679

 Score = 97.9 bits (233), Expect = 3e-20
 Identities = 48/92 (52%), Positives = 61/92 (66%), Gaps = 1/92 (1%)
 Frame = +2

Query: 233 RLCRRQEEKDKDI-GTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGE 409
           RL  R++   + I G V+GIDLGTT SCV V +  + +++ N +G R TPS VAFT DGE
Sbjct: 39  RLVSRRDYASEAIKGAVVGIDLGTTNSCVAVMEGKQAKVLENAEGARTTPSVVAFTADGE 98

Query: 410 RLIGDAAKNQLTTNPENTVFDAKRLIGREWSD 505
           RL+G  AK Q  TNP NT +  KRLIGR + D
Sbjct: 99  RLVGMPAKRQAVTNPNNTFYATKRLIGRRYDD 130


>AK222758-1|BAD96478.1|  679|Homo sapiens heat shock 70kDa protein
           9B precursor variant protein.
          Length = 679

 Score = 97.9 bits (233), Expect = 3e-20
 Identities = 48/92 (52%), Positives = 61/92 (66%), Gaps = 1/92 (1%)
 Frame = +2

Query: 233 RLCRRQEEKDKDI-GTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGE 409
           RL  R++   + I G V+GIDLGTT SCV V +  + +++ N +G R TPS VAFT DGE
Sbjct: 39  RLVSRRDYASEAIKGAVVGIDLGTTNSCVAVMEGKQAKVLENAEGARTTPSVVAFTADGE 98

Query: 410 RLIGDAAKNQLTTNPENTVFDAKRLIGREWSD 505
           RL+G  AK Q  TNP NT +  KRLIGR + D
Sbjct: 99  RLVGMPAKRQAVTNPNNTFYATKRLIGRRYDD 130


>BC119690-1|AAI19691.1|  509|Homo sapiens heat shock 70kDa protein
           14 protein.
          Length = 509

 Score = 83.4 bits (197), Expect = 6e-16
 Identities = 39/109 (35%), Positives = 66/109 (60%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IG+ LG T +CV VYK+GR  ++AND G+R+TP+ VA++++ E ++G AAK     N  N
Sbjct: 4   IGVHLGCTSACVAVYKDGRAGVVANDAGDRVTPAVVAYSEN-EEIVGLAAKQSRIRNISN 62

Query: 461 TVFDAKRLIGREWSDQLYNMMLSSSPSRSLKRTANLMFKYKLHKATKYL 607
           TV   K+++GR  SD      ++ S    +++   L ++    + TK++
Sbjct: 63  TVMKVKQILGRSSSDPQAQKYIAESKCLVIEKNGKLRYEIDTGEETKFV 111


>AF112210-1|AAF17198.1|  509|Homo sapiens heat shock protein
           hsp70-related protein protein.
          Length = 509

 Score = 83.4 bits (197), Expect = 6e-16
 Identities = 39/109 (35%), Positives = 66/109 (60%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IG+ LG T +CV VYK+GR  ++AND G+R+TP+ VA++++ E ++G AAK     N  N
Sbjct: 4   IGVHLGCTSACVAVYKDGRAGVVANDAGDRVTPAVVAYSEN-EEIVGLAAKQSRIRNISN 62

Query: 461 TVFDAKRLIGREWSDQLYNMMLSSSPSRSLKRTANLMFKYKLHKATKYL 607
           TV   K+++GR  SD      ++ S    +++   L ++    + TK++
Sbjct: 63  TVMKVKQILGRSSSDPQAQKYIAESKCLVIEKNGKLRYEIDTGEETKFV 111


>AF143723-1|AAF66640.1|  509|Homo sapiens heat shock protein HSP60
           protein.
          Length = 509

 Score = 81.0 bits (191), Expect = 3e-15
 Identities = 38/109 (34%), Positives = 65/109 (59%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IG+ LG T +C  VYK+GR  ++AND G+R+TP+ VA++++ E ++G AAK     N  N
Sbjct: 4   IGVHLGCTSACEAVYKDGRAGVVANDAGDRVTPAVVAYSEN-EEIVGLAAKQSRIRNISN 62

Query: 461 TVFDAKRLIGREWSDQLYNMMLSSSPSRSLKRTANLMFKYKLHKATKYL 607
           TV   K+++GR  SD      ++ S    +++   L ++    + TK++
Sbjct: 63  TVMKVKQILGRSSSDPQAQKYIAESKCLVIEKNGKLRYEIDTGEETKFV 111


>BC108738-1|AAI08739.1|   88|Homo sapiens HSPA14 protein protein.
          Length = 88

 Score = 77.4 bits (182), Expect = 4e-14
 Identities = 36/86 (41%), Positives = 56/86 (65%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IG+ LG T +CV VYK+GR  ++AND G+R+TP+ VA++++ E ++G AAK     N  N
Sbjct: 4   IGVHLGCTSACVAVYKDGRAGVVANDAGDRVTPAVVAYSEN-EEIVGLAAKQSRIRNISN 62

Query: 461 TVFDAKRLIGREWSDQLYNMMLSSSP 538
           TV   K+++GR      +  +LS+ P
Sbjct: 63  TVMKVKQILGRSQKCGPWTWLLSNYP 88


>BC065281-1|AAH65281.1|   88|Homo sapiens HSPA14 protein protein.
          Length = 88

 Score = 77.4 bits (182), Expect = 4e-14
 Identities = 36/86 (41%), Positives = 56/86 (65%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IG+ LG T +CV VYK+GR  ++AND G+R+TP+ VA++++ E ++G AAK     N  N
Sbjct: 4   IGVHLGCTSACVAVYKDGRAGVVANDAGDRVTPAVVAYSEN-EEIVGLAAKQSRIRNISN 62

Query: 461 TVFDAKRLIGREWSDQLYNMMLSSSP 538
           TV   K+++GR      +  +LS+ P
Sbjct: 63  TVMKVKQILGRSQKCGPWTWLLSNYP 88


>U04735-1|AAA16954.1|  471|Homo sapiens microsomal stress 70 protein
           ATPase core protein.
          Length = 471

 Score = 69.7 bits (163), Expect = 8e-12
 Identities = 37/101 (36%), Positives = 60/101 (59%), Gaps = 2/101 (1%)
 Frame = +2

Query: 278 VIGIDLGTTYSCVGVY--KNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTN 451
           VIGIDLGTTY  VGV+    G+V++I ++ G+   PS V+FT D +  +G  +     +N
Sbjct: 33  VIGIDLGTTYCSVGVFFPGTGKVKVIPDENGHISIPSMVSFT-DNDVYVGYESVELADSN 91

Query: 452 PENTVFDAKRLIGREWSDQLYNMMLSSSPSRSLKRTANLMF 574
           P+NT++DAKR IG+ ++ +     +   P + L +   + F
Sbjct: 92  PQNTIYDAKRFIGKIFTAEELEAEIGRYPFKVLNKNGMVEF 132


>BC036370-1|AAH36370.1|  471|Homo sapiens stress 70 protein
           chaperone, microsome-associated, 60kDa protein.
          Length = 471

 Score = 69.7 bits (163), Expect = 8e-12
 Identities = 37/101 (36%), Positives = 60/101 (59%), Gaps = 2/101 (1%)
 Frame = +2

Query: 278 VIGIDLGTTYSCVGVY--KNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTN 451
           VIGIDLGTTY  VGV+    G+V++I ++ G+   PS V+FT D +  +G  +     +N
Sbjct: 33  VIGIDLGTTYCSVGVFFPGTGKVKVIPDENGHISIPSMVSFT-DNDVYVGYESVELADSN 91

Query: 452 PENTVFDAKRLIGREWSDQLYNMMLSSSPSRSLKRTANLMF 574
           P+NT++DAKR IG+ ++ +     +   P + L +   + F
Sbjct: 92  PQNTIYDAKRFIGKIFTAEELEAEIGRYPFKVLNKNGMVEF 132


>AL163206-1|CAB90390.1|  471|Homo sapiens human microsomal stress70
           protein ATPase core precursor protein.
          Length = 471

 Score = 69.7 bits (163), Expect = 8e-12
 Identities = 37/101 (36%), Positives = 60/101 (59%), Gaps = 2/101 (1%)
 Frame = +2

Query: 278 VIGIDLGTTYSCVGVY--KNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTN 451
           VIGIDLGTTY  VGV+    G+V++I ++ G+   PS V+FT D +  +G  +     +N
Sbjct: 33  VIGIDLGTTYCSVGVFFPGTGKVKVIPDENGHISIPSMVSFT-DNDVYVGYESVELADSN 91

Query: 452 PENTVFDAKRLIGREWSDQLYNMMLSSSPSRSLKRTANLMF 574
           P+NT++DAKR IG+ ++ +     +   P + L +   + F
Sbjct: 92  PQNTIYDAKRFIGKIFTAEELEAEIGRYPFKVLNKNGMVEF 132


>AF130249-1|AAD21091.1|  471|Homo sapiens STCH protein.
          Length = 471

 Score = 69.7 bits (163), Expect = 8e-12
 Identities = 37/101 (36%), Positives = 60/101 (59%), Gaps = 2/101 (1%)
 Frame = +2

Query: 278 VIGIDLGTTYSCVGVY--KNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTN 451
           VIGIDLGTTY  VGV+    G+V++I ++ G+   PS V+FT D +  +G  +     +N
Sbjct: 33  VIGIDLGTTYCSVGVFFPGTGKVKVIPDENGHISIPSMVSFT-DNDVYVGYESVELADSN 91

Query: 452 PENTVFDAKRLIGREWSDQLYNMMLSSSPSRSLKRTANLMF 574
           P+NT++DAKR IG+ ++ +     +   P + L +   + F
Sbjct: 92  PQNTIYDAKRFIGKIFTAEELEAEIGRYPFKVLNKNGMVEF 132


>D86956-1|BAA13192.2|  949|Homo sapiens KIAA0201 protein.
          Length = 949

 Score = 68.1 bits (159), Expect = 2e-11
 Identities = 39/100 (39%), Positives = 59/100 (59%), Gaps = 1/100 (1%)
 Frame = +2

Query: 209 RASFGGRGRLCRRQEEKDKDIG-TVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSY 385
           R+  G  GR  R + E D++   +V+G+D+G+    + V + G +E IAN+  +R TPS 
Sbjct: 70  RSRQGAGGRRPRPEAEADREPAMSVVGLDVGSQSCYIAVARAGGIETIANEFSDRCTPSV 129

Query: 386 VAFTQDGERLIGDAAKNQLTTNPENTVFDAKRLIGREWSD 505
           ++F     R IG AAKNQ  T+  NTV + KR  GR ++D
Sbjct: 130 ISFGSK-NRTIGVAAKNQQITHANNTVSNFKRFHGRAFND 168


>AK223282-1|BAD97002.1|  471|Homo sapiens stress 70 protein
           chaperone, microsome-associated, 60kDa precursor variant
           protein.
          Length = 471

 Score = 67.7 bits (158), Expect = 3e-11
 Identities = 37/101 (36%), Positives = 59/101 (58%), Gaps = 2/101 (1%)
 Frame = +2

Query: 278 VIGIDLGTTYSCVGVY--KNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTN 451
           VIGIDLGTTY  VGV+    G+V++I ++ G+   PS V+FT D +  +G  +     +N
Sbjct: 33  VIGIDLGTTYCSVGVFFPGTGKVKVIPDENGHISIPSMVSFT-DNDVYVGYESVELADSN 91

Query: 452 PENTVFDAKRLIGREWSDQLYNMMLSSSPSRSLKRTANLMF 574
           P+NT+ DAKR IG+ ++ +     +   P + L +   + F
Sbjct: 92  PQNTICDAKRFIGKIFTAEELEAEIGRYPFKVLNKNGMVEF 132


>AF039695-1|AAC18044.1|  872|Homo sapiens antigen NY-CO-25 protein.
          Length = 872

 Score = 63.3 bits (147), Expect = 7e-10
 Identities = 35/89 (39%), Positives = 54/89 (60%), Gaps = 1/89 (1%)
 Frame = +2

Query: 242 RRQEEKDKDIG-TVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLI 418
           R + E D++   +V+G+D+G+    + V + G +E IAN+  +R TPS ++F     R I
Sbjct: 4   RPEAEADREPAMSVVGLDVGSQSCYIAVARAGGIETIANEFSDRCTPSVISFGSK-NRTI 62

Query: 419 GDAAKNQLTTNPENTVFDAKRLIGREWSD 505
           G AAKNQ  T+  NTV + KR  GR ++D
Sbjct: 63  GVAAKNQQITHANNTVSNFKRFHGRAFND 91


>EF197155-1|ABM69040.1|  839|Homo sapiens heat shock 70 kDa protein
           4-like protein protein.
          Length = 839

 Score = 62.9 bits (146), Expect = 9e-10
 Identities = 31/79 (39%), Positives = 49/79 (62%)
 Frame = +2

Query: 275 TVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNP 454
           +V+GIDLG     + V ++G +E IAN+  +R TP+ ++      R IG+AAK+Q+ TN 
Sbjct: 2   SVVGIDLGFLNCYIAVARSGGIETIANEYSDRCTPACISLGSR-TRAIGNAAKSQIVTNV 60

Query: 455 ENTVFDAKRLIGREWSDQL 511
            NT+   K+L GR + D +
Sbjct: 61  RNTIHGFKKLHGRSFDDPI 79


>BC040560-1|AAH40560.1|  839|Homo sapiens heat shock 70kDa protein
           4-like protein.
          Length = 839

 Score = 62.9 bits (146), Expect = 9e-10
 Identities = 31/79 (39%), Positives = 49/79 (62%)
 Frame = +2

Query: 275 TVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNP 454
           +V+GIDLG     + V ++G +E IAN+  +R TP+ ++      R IG+AAK+Q+ TN 
Sbjct: 2   SVVGIDLGFLNCYIAVARSGGIETIANEYSDRCTPACISLGSR-TRAIGNAAKSQIVTNV 60

Query: 455 ENTVFDAKRLIGREWSDQL 511
            NT+   K+L GR + D +
Sbjct: 61  RNTIHGFKKLHGRSFDDPI 79


>AY290862-1|AAP44471.1|  839|Homo sapiens heat shock protein apg-1
           protein.
          Length = 839

 Score = 62.9 bits (146), Expect = 9e-10
 Identities = 31/79 (39%), Positives = 49/79 (62%)
 Frame = +2

Query: 275 TVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNP 454
           +V+GIDLG     + V ++G +E IAN+  +R TP+ ++      R IG+AAK+Q+ TN 
Sbjct: 2   SVVGIDLGFLNCYIAVARSGGIETIANEYSDRCTPACISLGSR-TRAIGNAAKSQIVTNV 60

Query: 455 ENTVFDAKRLIGREWSDQL 511
            NT+   K+L GR + D +
Sbjct: 61  RNTIHGFKKLHGRSFDDPI 79


>AC093591-2|AAY40975.1|  839|Homo sapiens unknown protein.
          Length = 839

 Score = 62.9 bits (146), Expect = 9e-10
 Identities = 31/79 (39%), Positives = 49/79 (62%)
 Frame = +2

Query: 275 TVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNP 454
           +V+GIDLG     + V ++G +E IAN+  +R TP+ ++      R IG+AAK+Q+ TN 
Sbjct: 2   SVVGIDLGFLNCYIAVARSGGIETIANEYSDRCTPACISLGSR-TRAIGNAAKSQIVTNV 60

Query: 455 ENTVFDAKRLIGREWSDQL 511
            NT+   K+L GR + D +
Sbjct: 61  RNTIHGFKKLHGRSFDDPI 79


>AB023421-1|BAA75063.1|  839|Homo sapiens apg-1 protein.
          Length = 839

 Score = 62.9 bits (146), Expect = 9e-10
 Identities = 31/79 (39%), Positives = 49/79 (62%)
 Frame = +2

Query: 275 TVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNP 454
           +V+GIDLG     + V ++G +E IAN+  +R TP+ ++      R IG+AAK+Q+ TN 
Sbjct: 2   SVVGIDLGFLNCYIAVARSGGIETIANEYSDRCTPACISLGSR-TRAIGNAAKSQIVTNV 60

Query: 455 ENTVFDAKRLIGREWSDQL 511
            NT+   K+L GR + D +
Sbjct: 61  RNTIHGFKKLHGRSFDDPI 79


>X67643-1|CAA47886.1|  474|Homo sapiens HS24/P52 protein.
          Length = 474

 Score = 61.7 bits (143), Expect = 2e-09
 Identities = 34/77 (44%), Positives = 48/77 (62%)
 Frame = +2

Query: 275 TVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNP 454
           +V+GIDLG     V V + G +E IAN+  +R TP+ ++F     R IG AAK+Q+ +N 
Sbjct: 2   SVVGIDLGFQSCYVAVARAGGIETIANEYSDRCTPACISFGPK-NRSIGAAAKSQVISNA 60

Query: 455 ENTVFDAKRLIGREWSD 505
           +NTV   KR  GR +SD
Sbjct: 61  KNTVQGFKRFHGRAFSD 77


>L12723-1|AAA02807.1|  701|Homo sapiens heat shock protein 70
           protein.
          Length = 701

 Score = 61.7 bits (143), Expect = 2e-09
 Identities = 34/77 (44%), Positives = 48/77 (62%)
 Frame = +2

Query: 275 TVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNP 454
           +V+GIDLG     V V + G +E IAN+  +R TP+ ++F     R IG AAK+Q+ +N 
Sbjct: 2   SVVGIDLGFQSCYVAVARAGGIETIANEYSDRCTPACISFGPK-NRSIGAAAKSQVISNA 60

Query: 455 ENTVFDAKRLIGREWSD 505
           +NTV   KR  GR +SD
Sbjct: 61  KNTVQGFKRFHGRAFSD 77


>BT007375-1|AAP36039.1|  148|Homo sapiens heat shock protein, 110
           kDa protein.
          Length = 148

 Score = 61.7 bits (143), Expect = 2e-09
 Identities = 34/77 (44%), Positives = 48/77 (62%)
 Frame = +2

Query: 275 TVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNP 454
           +V+GIDLG     V V + G +E IAN+  +R TP+ ++F     R IG AAK+Q+ +N 
Sbjct: 2   SVVGIDLGFQSCYVAVARAGGIETIANEYSDRCTPACISFGPK-NRSIGAAAKSQVISNA 60

Query: 455 ENTVFDAKRLIGREWSD 505
           +NTV   KR  GR +SD
Sbjct: 61  KNTVQGFKRFHGRAFSD 77


>BC126124-1|AAI26125.1|  840|Homo sapiens heat shock 70kDa protein 4
           protein.
          Length = 840

 Score = 61.7 bits (143), Expect = 2e-09
 Identities = 34/77 (44%), Positives = 48/77 (62%)
 Frame = +2

Query: 275 TVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNP 454
           +V+GIDLG     V V + G +E IAN+  +R TP+ ++F     R IG AAK+Q+ +N 
Sbjct: 2   SVVGIDLGFQSCYVAVARAGGIETIANEYSDRCTPACISFGPK-NRSIGAAAKSQVISNA 60

Query: 455 ENTVFDAKRLIGREWSD 505
           +NTV   KR  GR +SD
Sbjct: 61  KNTVQGFKRFHGRAFSD 77


>BC126122-1|AAI26123.1|  840|Homo sapiens heat shock 70kDa protein 4
           protein.
          Length = 840

 Score = 61.7 bits (143), Expect = 2e-09
 Identities = 34/77 (44%), Positives = 48/77 (62%)
 Frame = +2

Query: 275 TVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNP 454
           +V+GIDLG     V V + G +E IAN+  +R TP+ ++F     R IG AAK+Q+ +N 
Sbjct: 2   SVVGIDLGFQSCYVAVARAGGIETIANEYSDRCTPACISFGPK-NRSIGAAAKSQVISNA 60

Query: 455 ENTVFDAKRLIGREWSD 505
           +NTV   KR  GR +SD
Sbjct: 61  KNTVQGFKRFHGRAFSD 77


>BC110861-1|AAI10862.1|  840|Homo sapiens heat shock 70kDa protein 4
           protein.
          Length = 840

 Score = 61.7 bits (143), Expect = 2e-09
 Identities = 34/77 (44%), Positives = 48/77 (62%)
 Frame = +2

Query: 275 TVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNP 454
           +V+GIDLG     V V + G +E IAN+  +R TP+ ++F     R IG AAK+Q+ +N 
Sbjct: 2   SVVGIDLGFQSCYVAVARAGGIETIANEYSDRCTPACISFGPK-NRSIGAAAKSQVISNA 60

Query: 455 ENTVFDAKRLIGREWSD 505
           +NTV   KR  GR +SD
Sbjct: 61  KNTVQGFKRFHGRAFSD 77


>BC037553-1|AAH37553.1|  858|Homo sapiens heat shock 105kDa/110kDa
           protein 1 protein.
          Length = 858

 Score = 61.7 bits (143), Expect = 2e-09
 Identities = 32/77 (41%), Positives = 48/77 (62%)
 Frame = +2

Query: 275 TVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNP 454
           +V+G+D+G+    + V + G +E IAN+  +R TPS ++F     R IG AAKNQ  T+ 
Sbjct: 2   SVVGLDVGSQSCYIAVARAGGIETIANEFSDRCTPSVISFGSK-NRTIGVAAKNQQITHA 60

Query: 455 ENTVFDAKRLIGREWSD 505
            NTV + KR  GR ++D
Sbjct: 61  NNTVSNFKRFHGRAFND 77


>BC002526-1|AAH02526.1|  148|Homo sapiens heat shock 70kDa protein 4
           protein.
          Length = 148

 Score = 61.7 bits (143), Expect = 2e-09
 Identities = 34/77 (44%), Positives = 48/77 (62%)
 Frame = +2

Query: 275 TVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNP 454
           +V+GIDLG     V V + G +E IAN+  +R TP+ ++F     R IG AAK+Q+ +N 
Sbjct: 2   SVVGIDLGFQSCYVAVARAGGIETIANEYSDRCTPACISFGPK-NRSIGAAAKSQVISNA 60

Query: 455 ENTVFDAKRLIGREWSD 505
           +NTV   KR  GR +SD
Sbjct: 61  KNTVQGFKRFHGRAFSD 77


>AL137142-5|CAI12430.1|  858|Homo sapiens heat shock 105kDa/110kDa
           protein 1 protein.
          Length = 858

 Score = 61.7 bits (143), Expect = 2e-09
 Identities = 32/77 (41%), Positives = 48/77 (62%)
 Frame = +2

Query: 275 TVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNP 454
           +V+G+D+G+    + V + G +E IAN+  +R TPS ++F     R IG AAKNQ  T+ 
Sbjct: 2   SVVGLDVGSQSCYIAVARAGGIETIANEFSDRCTPSVISFGSK-NRTIGVAAKNQQITHA 60

Query: 455 ENTVFDAKRLIGREWSD 505
            NTV + KR  GR ++D
Sbjct: 61  NNTVSNFKRFHGRAFND 77


>AL137142-4|CAI12428.1|  814|Homo sapiens heat shock 105kDa/110kDa
           protein 1 protein.
          Length = 814

 Score = 61.7 bits (143), Expect = 2e-09
 Identities = 32/77 (41%), Positives = 48/77 (62%)
 Frame = +2

Query: 275 TVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNP 454
           +V+G+D+G+    + V + G +E IAN+  +R TPS ++F     R IG AAKNQ  T+ 
Sbjct: 2   SVVGLDVGSQSCYIAVARAGGIETIANEFSDRCTPSVISFGSK-NRTIGVAAKNQQITHA 60

Query: 455 ENTVFDAKRLIGREWSD 505
            NTV + KR  GR ++D
Sbjct: 61  NNTVSNFKRFHGRAFND 77


>AL137142-3|CAI12429.1|  817|Homo sapiens heat shock 105kDa/110kDa
           protein 1 protein.
          Length = 817

 Score = 61.7 bits (143), Expect = 2e-09
 Identities = 32/77 (41%), Positives = 48/77 (62%)
 Frame = +2

Query: 275 TVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNP 454
           +V+G+D+G+    + V + G +E IAN+  +R TPS ++F     R IG AAKNQ  T+ 
Sbjct: 2   SVVGLDVGSQSCYIAVARAGGIETIANEFSDRCTPSVISFGSK-NRTIGVAAKNQQITHA 60

Query: 455 ENTVFDAKRLIGREWSD 505
            NTV + KR  GR ++D
Sbjct: 61  NNTVSNFKRFHGRAFND 77


>AB209151-1|BAD92388.1|  782|Homo sapiens heat shock 70kDa protein 4
           isoform a variant protein.
          Length = 782

 Score = 61.7 bits (143), Expect = 2e-09
 Identities = 34/77 (44%), Positives = 48/77 (62%)
 Frame = +2

Query: 275 TVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNP 454
           +V+GIDLG     V V + G +E IAN+  +R TP+ ++F     R IG AAK+Q+ +N 
Sbjct: 25  SVVGIDLGFQSCYVAVARAGGIETIANEYSDRCTPACISFGPK-NRSIGAAAKSQVISNA 83

Query: 455 ENTVFDAKRLIGREWSD 505
           +NTV   KR  GR +SD
Sbjct: 84  KNTVQGFKRFHGRAFSD 100


>AB023420-1|BAA75062.1|  840|Homo sapiens apg-2 protein.
          Length = 840

 Score = 61.7 bits (143), Expect = 2e-09
 Identities = 34/77 (44%), Positives = 48/77 (62%)
 Frame = +2

Query: 275 TVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNP 454
           +V+GIDLG     V V + G +E IAN+  +R TP+ ++F     R IG AAK+Q+ +N 
Sbjct: 2   SVVGIDLGFQSCYVAVARAGGIETIANEYSDRCTPACISFGPK-NRSIGAAAKSQVISNA 60

Query: 455 ENTVFDAKRLIGREWSD 505
           +NTV   KR  GR +SD
Sbjct: 61  KNTVQGFKRFHGRAFSD 77


>AB003334-1|BAA34780.1|  858|Homo sapiens HSP105 alpha protein.
          Length = 858

 Score = 61.7 bits (143), Expect = 2e-09
 Identities = 32/77 (41%), Positives = 48/77 (62%)
 Frame = +2

Query: 275 TVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNP 454
           +V+G+D+G+    + V + G +E IAN+  +R TPS ++F     R IG AAKNQ  T+ 
Sbjct: 2   SVVGLDVGSQSCYIAVARAGGIETIANEFSDRCTPSVISFGSK-NRTIGVAAKNQQITHA 60

Query: 455 ENTVFDAKRLIGREWSD 505
            NTV + KR  GR ++D
Sbjct: 61  NNTVSNFKRFHGRAFND 77


>AB003333-1|BAA34779.1|  814|Homo sapiens HSP105 beta protein.
          Length = 814

 Score = 61.7 bits (143), Expect = 2e-09
 Identities = 32/77 (41%), Positives = 48/77 (62%)
 Frame = +2

Query: 275 TVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNP 454
           +V+G+D+G+    + V + G +E IAN+  +R TPS ++F     R IG AAKNQ  T+ 
Sbjct: 2   SVVGLDVGSQSCYIAVARAGGIETIANEFSDRCTPSVISFGSK-NRTIGVAAKNQQITHA 60

Query: 455 ENTVFDAKRLIGREWSD 505
            NTV + KR  GR ++D
Sbjct: 61  NNTVSNFKRFHGRAFND 77


>M24743-1|AAA59844.1|   36|Homo sapiens HSPA2 protein.
          Length = 36

 Score = 61.3 bits (142), Expect = 3e-09
 Identities = 26/30 (86%), Positives = 30/30 (100%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNR 370
           IGIDLGTTYSCVGV+++G+VEIIANDQGNR
Sbjct: 7   IGIDLGTTYSCVGVFQHGKVEIIANDQGNR 36


>U65785-1|AAC50947.1|  999|Homo sapiens 150 kDa oxygen-regulated
           protein ORP150 protein.
          Length = 999

 Score = 43.6 bits (98), Expect = 6e-04
 Identities = 25/78 (32%), Positives = 42/78 (53%), Gaps = 1/78 (1%)
 Frame = +2

Query: 266 DIGTVIGIDLGTTYSCVGVYKNG-RVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQL 442
           D   V+ +DLG+    V + K G  +EI+ N +  R TP  V   ++ ER  GD+A +  
Sbjct: 31  DTLAVMSVDLGSESMKVAIVKPGVPMEIVLNKESRRKTPVIVTL-KENERFFGDSAASMA 89

Query: 443 TTNPENTVFDAKRLIGRE 496
             NP+ T+   + L+G++
Sbjct: 90  IKNPKATLRYFQHLLGKQ 107


>DQ372932-1|ABD14370.1|  999|Homo sapiens 150 kDa oxygen-regulated
           protein variant 1 protein.
          Length = 999

 Score = 43.6 bits (98), Expect = 6e-04
 Identities = 25/78 (32%), Positives = 42/78 (53%), Gaps = 1/78 (1%)
 Frame = +2

Query: 266 DIGTVIGIDLGTTYSCVGVYKNG-RVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQL 442
           D   V+ +DLG+    V + K G  +EI+ N +  R TP  V   ++ ER  GD+A +  
Sbjct: 31  DTLAVMSVDLGSESMKVAIVKPGVPMEIVLNKESRRKTPVIVTL-KENERFFGDSAASMA 89

Query: 443 TTNPENTVFDAKRLIGRE 496
             NP+ T+   + L+G++
Sbjct: 90  IKNPKATLRYFQHLLGKQ 107


>DQ350134-1|ABC75106.1|  999|Homo sapiens 150 kDa oxygen-regulated
           protein protein.
          Length = 999

 Score = 43.6 bits (98), Expect = 6e-04
 Identities = 25/78 (32%), Positives = 42/78 (53%), Gaps = 1/78 (1%)
 Frame = +2

Query: 266 DIGTVIGIDLGTTYSCVGVYKNG-RVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQL 442
           D   V+ +DLG+    V + K G  +EI+ N +  R TP  V   ++ ER  GD+A +  
Sbjct: 31  DTLAVMSVDLGSESMKVAIVKPGVPMEIVLNKESRRKTPVIVTL-KENERFFGDSAASMA 89

Query: 443 TTNPENTVFDAKRLIGRE 496
             NP+ T+   + L+G++
Sbjct: 90  IKNPKATLRYFQHLLGKQ 107


>BC072436-1|AAH72436.1|  678|Homo sapiens HYOU1 protein protein.
          Length = 678

 Score = 43.6 bits (98), Expect = 6e-04
 Identities = 25/78 (32%), Positives = 42/78 (53%), Gaps = 1/78 (1%)
 Frame = +2

Query: 266 DIGTVIGIDLGTTYSCVGVYKNG-RVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQL 442
           D   V+ +DLG+    V + K G  +EI+ N +  R TP  V   ++ ER  GD+A +  
Sbjct: 31  DTLAVMSVDLGSESMKVAIVKPGVPMEIVLNKESRRKTPVIVTL-KENERFFGDSAASMA 89

Query: 443 TTNPENTVFDAKRLIGRE 496
             NP+ T+   + L+G++
Sbjct: 90  IKNPKATLRYFQHLLGKQ 107


>BC017726-1|AAH17726.1|  657|Homo sapiens Unknown (protein for
           IMAGE:3898847) protein.
          Length = 657

 Score = 43.6 bits (98), Expect = 6e-04
 Identities = 25/78 (32%), Positives = 42/78 (53%), Gaps = 1/78 (1%)
 Frame = +2

Query: 266 DIGTVIGIDLGTTYSCVGVYKNG-RVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQL 442
           D   V+ +DLG+    V + K G  +EI+ N +  R TP  V   ++ ER  GD+A +  
Sbjct: 31  DTLAVMSVDLGSESMKVAIVKPGVPMEIVLNKESRRKTPVIVTL-KENERFFGDSAASMA 89

Query: 443 TTNPENTVFDAKRLIGRE 496
             NP+ T+   + L+G++
Sbjct: 90  IKNPKATLRYFQHLLGKQ 107


>BC007276-1|AAH07276.2|  587|Homo sapiens HSPA8 protein protein.
          Length = 587

 Score = 43.6 bits (98), Expect = 6e-04
 Identities = 21/42 (50%), Positives = 27/42 (64%)
 Frame = +1

Query: 511 VQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           VQ D+K +PF VV    +P VQV+     K F PEE+S+MVL
Sbjct: 24  VQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVL 65



 Score = 35.9 bits (79), Expect = 0.12
 Identities = 15/19 (78%), Positives = 16/19 (84%)
 Frame = +2

Query: 449 NPENTVFDAKRLIGREWSD 505
           NP NTVFDAKRLIGR + D
Sbjct: 3   NPTNTVFDAKRLIGRRFDD 21


>BC004560-1|AAH04560.1|  147|Homo sapiens HYOU1 protein protein.
          Length = 147

 Score = 43.6 bits (98), Expect = 6e-04
 Identities = 25/78 (32%), Positives = 42/78 (53%), Gaps = 1/78 (1%)
 Frame = +2

Query: 266 DIGTVIGIDLGTTYSCVGVYKNG-RVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQL 442
           D   V+ +DLG+    V + K G  +EI+ N +  R TP  V   ++ ER  GD+A +  
Sbjct: 31  DTLAVMSVDLGSESMKVAIVKPGVPMEIVLNKESRRKTPVIVTL-KENERFFGDSAASMA 89

Query: 443 TTNPENTVFDAKRLIGRE 496
             NP+ T+   + L+G++
Sbjct: 90  IKNPKATLRYFQHLLGKQ 107


>AK222756-1|BAD96476.1|  999|Homo sapiens oxygen regulated protein
           precursor variant protein.
          Length = 999

 Score = 41.9 bits (94), Expect = 0.002
 Identities = 24/78 (30%), Positives = 42/78 (53%), Gaps = 1/78 (1%)
 Frame = +2

Query: 266 DIGTVIGIDLGTTYSCVGVYKNG-RVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQL 442
           D   V+ +DLG+    V + K G  +EI+ N +  R TP  V   ++ ER  GD+A +  
Sbjct: 31  DTLAVMSVDLGSESMKVAIVKPGVPMEIVLNKESRRKTPVIVTL-EENERFFGDSAASMA 89

Query: 443 TTNPENTVFDAKRLIGRE 496
             +P+ T+   + L+G++
Sbjct: 90  IKDPKATLRYFQHLLGKQ 107


>AB018045-1|BAA77235.1|  151|Homo sapiens heat shock protein 72
           protein.
          Length = 151

 Score = 40.7 bits (91), Expect = 0.004
 Identities = 19/38 (50%), Positives = 24/38 (63%)
 Frame = +1

Query: 523 VKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           +K +PF+V+    KP VQV      K F PEEIS+MVL
Sbjct: 1   MKHWPFQVINDGDKPKVQVSYKGETKAFYPEEISSMVL 38


>AL929592-6|CAI18465.1|  476|Homo sapiens heat shock 70kDa protein
           1A protein.
          Length = 476

 Score = 39.9 bits (89), Expect = 0.007
 Identities = 16/21 (76%), Positives = 20/21 (95%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVE 343
           IGIDLGTTYSCVGV+++G+ E
Sbjct: 7   IGIDLGTTYSCVGVFQHGKGE 27


>AL671762-5|CAM25532.1|  476|Homo sapiens heat shock 70kDa protein
           1A protein.
          Length = 476

 Score = 39.9 bits (89), Expect = 0.007
 Identities = 16/21 (76%), Positives = 20/21 (95%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVE 343
           IGIDLGTTYSCVGV+++G+ E
Sbjct: 7   IGIDLGTTYSCVGVFQHGKGE 27


>AL662834-16|CAM24989.1|  476|Homo sapiens heat shock 70kDa protein
           1A protein.
          Length = 476

 Score = 39.9 bits (89), Expect = 0.007
 Identities = 16/21 (76%), Positives = 20/21 (95%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVE 343
           IGIDLGTTYSCVGV+++G+ E
Sbjct: 7   IGIDLGTTYSCVGVFQHGKGE 27


>X04676-1|CAA28381.1|   22|Homo sapiens protein ( Human hsp 70 gene
           5' region for 70 kDa heat shock protein. ).
          Length = 22

 Score = 35.1 bits (77), Expect = 0.21
 Identities = 13/16 (81%), Positives = 16/16 (100%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYK 328
           +GIDLGTTYSCVGV++
Sbjct: 7   VGIDLGTTYSCVGVFQ 22


>X67640-1|CAA47885.1|  266|Homo sapiens HS24/P52 protein.
          Length = 266

 Score = 33.9 bits (74), Expect = 0.49
 Identities = 17/32 (53%), Positives = 22/32 (68%)
 Frame = +2

Query: 410 RLIGDAAKNQLTTNPENTVFDAKRLIGREWSD 505
           R IG AAK+Q+ +N +NTV   KR  GR +SD
Sbjct: 10  RSIGAAAKSQVISNAKNTVQGFKRFHGRAFSD 41


>BC001460-1|AAH01460.2| 1019|Homo sapiens La ribonucleoprotein
           domain family, member 1 protein.
          Length = 1019

 Score = 30.3 bits (65), Expect = 6.0
 Identities = 12/36 (33%), Positives = 23/36 (63%)
 Frame = -1

Query: 300 VPKSIPITVPMSLSFSSCRRHKRPRPPKLARTNSTA 193
           + +S+P TVP S ++ + R  + PR P+L  ++ T+
Sbjct: 686 IARSLPTTVPESPNYRNTRTPRTPRTPQLKDSSQTS 721


>AK091465-1|BAC03668.1|  816|Homo sapiens protein ( Homo sapiens
           cDNA FLJ34146 fis, clone FCBBF3011889, weakly similar to
           Drosophila melanogaster La related protein (larp) mRNA.
           ).
          Length = 816

 Score = 30.3 bits (65), Expect = 6.0
 Identities = 12/36 (33%), Positives = 23/36 (63%)
 Frame = -1

Query: 300 VPKSIPITVPMSLSFSSCRRHKRPRPPKLARTNSTA 193
           + +S+P TVP S ++ + R  + PR P+L  ++ T+
Sbjct: 763 IARSLPTTVPESPNYRNTRTPRTPRTPQLKDSSQTS 798


>AB018274-1|BAA34451.1| 1096|Homo sapiens KIAA0731 protein protein.
          Length = 1096

 Score = 30.3 bits (65), Expect = 6.0
 Identities = 12/36 (33%), Positives = 23/36 (63%)
 Frame = -1

Query: 300 VPKSIPITVPMSLSFSSCRRHKRPRPPKLARTNSTA 193
           + +S+P TVP S ++ + R  + PR P+L  ++ T+
Sbjct: 763 IARSLPTTVPESPNYRNTRTPRTPRTPQLKDSSQTS 798


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 92,849,042
Number of Sequences: 237096
Number of extensions: 2019354
Number of successful extensions: 11513
Number of sequences better than 10.0: 116
Number of HSP's better than 10.0 without gapping: 11289
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 11416
length of database: 76,859,062
effective HSP length: 87
effective length of database: 56,231,710
effective search space used: 6972732040
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -