SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20067
         (619 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY273815-1|AAQ16156.1| 2623|Homo sapiens bone specific CMF608 pr...    33   0.81 
BC080586-1|AAH80586.1|  743|Homo sapiens MXRA5 protein protein.        31   2.5  
BC064986-1|AAH64986.1|  743|Homo sapiens MXRA5 protein protein.        31   2.5  
BC011846-1|AAH11846.1|  743|Homo sapiens MXRA5 protein protein.        31   2.5  
AF245505-1|AAF86402.1| 2828|Homo sapiens adlican protein.              31   2.5  
BC036337-1|AAH36337.1|  811|Homo sapiens KIAA0644 gene product p...    30   5.7  
AB014544-1|BAA31619.2|  887|Homo sapiens KIAA0644 protein protein.     30   5.7  
BC063114-1|AAH63114.1|  384|Homo sapiens ASPN protein protein.         29   9.9  
AY358329-1|AAQ88695.1|  379|Homo sapiens ASPN protein.                 29   9.9  
AY029191-1|AAK31800.1|  381|Homo sapiens periodontal ligament as...    29   9.9  
AL137848-6|CAI16697.1|  380|Homo sapiens asporin protein.              29   9.9  
AL137848-5|CAI16698.1|  243|Homo sapiens asporin protein.              29   9.9  
AK027359-1|BAB55060.1|  246|Homo sapiens protein ( Homo sapiens ...    29   9.9  
AF316824-1|AAK35161.1|  379|Homo sapiens asporin precursor protein.    29   9.9  

>AY273815-1|AAQ16156.1| 2623|Homo sapiens bone specific CMF608
           protein.
          Length = 2623

 Score = 33.1 bits (72), Expect = 0.81
 Identities = 14/30 (46%), Positives = 20/30 (66%)
 Frame = +2

Query: 488 ISPQCFPGVHDLYAVNLSNNNLKSLHPETF 577
           I+P+ F G++ L  V+L  N L  LHP+TF
Sbjct: 144 INPEVFYGLNFLRLVHLEGNQLTKLHPDTF 173


>BC080586-1|AAH80586.1|  743|Homo sapiens MXRA5 protein protein.
          Length = 743

 Score = 31.5 bits (68), Expect = 2.5
 Identities = 14/31 (45%), Positives = 18/31 (58%)
 Frame = +2

Query: 488 ISPQCFPGVHDLYAVNLSNNNLKSLHPETFA 580
           I PQ F G+  L  ++L  N L  LHP TF+
Sbjct: 142 IHPQAFNGLTSLRLLHLEGNLLHQLHPSTFS 172


>BC064986-1|AAH64986.1|  743|Homo sapiens MXRA5 protein protein.
          Length = 743

 Score = 31.5 bits (68), Expect = 2.5
 Identities = 14/31 (45%), Positives = 18/31 (58%)
 Frame = +2

Query: 488 ISPQCFPGVHDLYAVNLSNNNLKSLHPETFA 580
           I PQ F G+  L  ++L  N L  LHP TF+
Sbjct: 142 IHPQAFNGLTSLRLLHLEGNLLHQLHPSTFS 172


>BC011846-1|AAH11846.1|  743|Homo sapiens MXRA5 protein protein.
          Length = 743

 Score = 31.5 bits (68), Expect = 2.5
 Identities = 14/31 (45%), Positives = 18/31 (58%)
 Frame = +2

Query: 488 ISPQCFPGVHDLYAVNLSNNNLKSLHPETFA 580
           I PQ F G+  L  ++L  N L  LHP TF+
Sbjct: 142 IHPQAFNGLTSLRLLHLEGNLLHQLHPSTFS 172


>AF245505-1|AAF86402.1| 2828|Homo sapiens adlican protein.
          Length = 2828

 Score = 31.5 bits (68), Expect = 2.5
 Identities = 14/31 (45%), Positives = 18/31 (58%)
 Frame = +2

Query: 488 ISPQCFPGVHDLYAVNLSNNNLKSLHPETFA 580
           I PQ F G+  L  ++L  N L  LHP TF+
Sbjct: 142 IHPQAFNGLTSLRLLHLEGNLLHQLHPSTFS 172


>BC036337-1|AAH36337.1|  811|Homo sapiens KIAA0644 gene product
           protein.
          Length = 811

 Score = 30.3 bits (65), Expect = 5.7
 Identities = 12/22 (54%), Positives = 16/22 (72%)
 Frame = +2

Query: 512 VHDLYAVNLSNNNLKSLHPETF 577
           +H L A++LS N L +LHP TF
Sbjct: 300 LHSLEALDLSGNELSALHPATF 321


>AB014544-1|BAA31619.2|  887|Homo sapiens KIAA0644 protein protein.
          Length = 887

 Score = 30.3 bits (65), Expect = 5.7
 Identities = 12/22 (54%), Positives = 16/22 (72%)
 Frame = +2

Query: 512 VHDLYAVNLSNNNLKSLHPETF 577
           +H L A++LS N L +LHP TF
Sbjct: 376 LHSLEALDLSGNELSALHPATF 397


>BC063114-1|AAH63114.1|  384|Homo sapiens ASPN protein protein.
          Length = 384

 Score = 29.5 bits (63), Expect = 9.9
 Identities = 11/25 (44%), Positives = 16/25 (64%)
 Frame = +2

Query: 503 FPGVHDLYAVNLSNNNLKSLHPETF 577
           F G+  LY + L+NN L  +HP+ F
Sbjct: 126 FKGLTSLYGLILNNNKLTKIHPKAF 150


>AY358329-1|AAQ88695.1|  379|Homo sapiens ASPN protein.
          Length = 379

 Score = 29.5 bits (63), Expect = 9.9
 Identities = 11/25 (44%), Positives = 16/25 (64%)
 Frame = +2

Query: 503 FPGVHDLYAVNLSNNNLKSLHPETF 577
           F G+  LY + L+NN L  +HP+ F
Sbjct: 121 FKGLTSLYGLILNNNKLTKIHPKAF 145


>AY029191-1|AAK31800.1|  381|Homo sapiens periodontal ligament
           associated protein 1 protein.
          Length = 381

 Score = 29.5 bits (63), Expect = 9.9
 Identities = 11/25 (44%), Positives = 16/25 (64%)
 Frame = +2

Query: 503 FPGVHDLYAVNLSNNNLKSLHPETF 577
           F G+  LY + L+NN L  +HP+ F
Sbjct: 123 FKGLTSLYGLILNNNKLTKIHPKAF 147


>AL137848-6|CAI16697.1|  380|Homo sapiens asporin protein.
          Length = 380

 Score = 29.5 bits (63), Expect = 9.9
 Identities = 11/25 (44%), Positives = 16/25 (64%)
 Frame = +2

Query: 503 FPGVHDLYAVNLSNNNLKSLHPETF 577
           F G+  LY + L+NN L  +HP+ F
Sbjct: 122 FKGLTSLYGLILNNNKLTKIHPKAF 146


>AL137848-5|CAI16698.1|  243|Homo sapiens asporin protein.
          Length = 243

 Score = 29.5 bits (63), Expect = 9.9
 Identities = 11/25 (44%), Positives = 16/25 (64%)
 Frame = +2

Query: 503 FPGVHDLYAVNLSNNNLKSLHPETF 577
           F G+  LY + L+NN L  +HP+ F
Sbjct: 122 FKGLTSLYGLILNNNKLTKIHPKAF 146


>AK027359-1|BAB55060.1|  246|Homo sapiens protein ( Homo sapiens
           cDNA FLJ14453 fis, clone HEMBB1001871, weakly similar to
           BONE/CARTILAGE PROTEOGLYCAN I PRECURSOR. ).
          Length = 246

 Score = 29.5 bits (63), Expect = 9.9
 Identities = 11/25 (44%), Positives = 16/25 (64%)
 Frame = +2

Query: 503 FPGVHDLYAVNLSNNNLKSLHPETF 577
           F G+  LY + L+NN L  +HP+ F
Sbjct: 125 FKGLTSLYGLILNNNKLTKIHPKAF 149


>AF316824-1|AAK35161.1|  379|Homo sapiens asporin precursor protein.
          Length = 379

 Score = 29.5 bits (63), Expect = 9.9
 Identities = 11/25 (44%), Positives = 16/25 (64%)
 Frame = +2

Query: 503 FPGVHDLYAVNLSNNNLKSLHPETF 577
           F G+  LY + L+NN L  +HP+ F
Sbjct: 121 FKGLTSLYGLILNNNKLTKIHPKAF 145


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 87,200,981
Number of Sequences: 237096
Number of extensions: 1786045
Number of successful extensions: 4236
Number of sequences better than 10.0: 14
Number of HSP's better than 10.0 without gapping: 4037
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4236
length of database: 76,859,062
effective HSP length: 87
effective length of database: 56,231,710
effective search space used: 6635341780
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -