SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20065
         (649 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BC117164-1|AAI17165.1| 2061|Homo sapiens SET domain containing 2...   100   9e-21
BC117162-1|AAI17163.1| 2061|Homo sapiens SET domain containing 2...   100   9e-21
BC090954-1|AAH90954.1| 1845|Homo sapiens SETD2 protein protein.       100   9e-21
AY576987-1|AAT77612.1| 2061|Homo sapiens HSPC069 isoform a protein.   100   9e-21
AJ238403-1|CAC28349.1| 2061|Homo sapiens huntingtin interacting ...   100   9e-21
AF049103-1|AAC26194.1|  178|Homo sapiens Huntingtin interacting ...   100   9e-21
AB051519-1|BAB21823.2| 1915|Homo sapiens KIAA1732 protein protein.    100   9e-21

>BC117164-1|AAI17165.1| 2061|Homo sapiens SET domain containing 2
            protein.
          Length = 2061

 Score = 99.5 bits (237), Expect = 9e-21
 Identities = 46/78 (58%), Positives = 57/78 (73%)
 Frame = +1

Query: 13   LNPYRHSDAPAGRITCTADFKHLARKLTHFVMLKELKHCRSVEELVVTDSVRSKAKTFVK 192
            LNPYR  D   GRIT T DFKHLARKLTH VM KELK+C++ E+L   ++V+ K K ++K
Sbjct: 1983 LNPYRKPDCKVGRITTTEDFKHLARKLTHGVMNKELKYCKNPEDLECNENVKHKTKEYIK 2042

Query: 193  KYMAKFGPVYKRPPEEAD 246
            KYM KFG VYK P E+ +
Sbjct: 2043 KYMQKFGAVYK-PKEDTE 2059


>BC117162-1|AAI17163.1| 2061|Homo sapiens SET domain containing 2
            protein.
          Length = 2061

 Score = 99.5 bits (237), Expect = 9e-21
 Identities = 46/78 (58%), Positives = 57/78 (73%)
 Frame = +1

Query: 13   LNPYRHSDAPAGRITCTADFKHLARKLTHFVMLKELKHCRSVEELVVTDSVRSKAKTFVK 192
            LNPYR  D   GRIT T DFKHLARKLTH VM KELK+C++ E+L   ++V+ K K ++K
Sbjct: 1983 LNPYRKPDCKVGRITTTEDFKHLARKLTHGVMNKELKYCKNPEDLECNENVKHKTKEYIK 2042

Query: 193  KYMAKFGPVYKRPPEEAD 246
            KYM KFG VYK P E+ +
Sbjct: 2043 KYMQKFGAVYK-PKEDTE 2059


>BC090954-1|AAH90954.1| 1845|Homo sapiens SETD2 protein protein.
          Length = 1845

 Score = 99.5 bits (237), Expect = 9e-21
 Identities = 46/78 (58%), Positives = 57/78 (73%)
 Frame = +1

Query: 13   LNPYRHSDAPAGRITCTADFKHLARKLTHFVMLKELKHCRSVEELVVTDSVRSKAKTFVK 192
            LNPYR  D   GRIT T DFKHLARKLTH VM KELK+C++ E+L   ++V+ K K ++K
Sbjct: 1767 LNPYRKPDCKVGRITTTEDFKHLARKLTHGVMNKELKYCKNPEDLECNENVKHKTKEYIK 1826

Query: 193  KYMAKFGPVYKRPPEEAD 246
            KYM KFG VYK P E+ +
Sbjct: 1827 KYMQKFGAVYK-PKEDTE 1843


>AY576987-1|AAT77612.1| 2061|Homo sapiens HSPC069 isoform a protein.
          Length = 2061

 Score = 99.5 bits (237), Expect = 9e-21
 Identities = 46/78 (58%), Positives = 57/78 (73%)
 Frame = +1

Query: 13   LNPYRHSDAPAGRITCTADFKHLARKLTHFVMLKELKHCRSVEELVVTDSVRSKAKTFVK 192
            LNPYR  D   GRIT T DFKHLARKLTH VM KELK+C++ E+L   ++V+ K K ++K
Sbjct: 1983 LNPYRKPDCKVGRITTTEDFKHLARKLTHGVMNKELKYCKNPEDLECNENVKHKTKEYIK 2042

Query: 193  KYMAKFGPVYKRPPEEAD 246
            KYM KFG VYK P E+ +
Sbjct: 2043 KYMQKFGAVYK-PKEDTE 2059


>AJ238403-1|CAC28349.1| 2061|Homo sapiens huntingtin interacting
            protein 1 protein.
          Length = 2061

 Score = 99.5 bits (237), Expect = 9e-21
 Identities = 46/78 (58%), Positives = 57/78 (73%)
 Frame = +1

Query: 13   LNPYRHSDAPAGRITCTADFKHLARKLTHFVMLKELKHCRSVEELVVTDSVRSKAKTFVK 192
            LNPYR  D   GRIT T DFKHLARKLTH VM KELK+C++ E+L   ++V+ K K ++K
Sbjct: 1983 LNPYRKPDCKVGRITTTEDFKHLARKLTHGVMNKELKYCKNPEDLECNENVKHKTKEYIK 2042

Query: 193  KYMAKFGPVYKRPPEEAD 246
            KYM KFG VYK P E+ +
Sbjct: 2043 KYMQKFGAVYK-PKEDTE 2059


>AF049103-1|AAC26194.1|  178|Homo sapiens Huntingtin interacting
           protein protein.
          Length = 178

 Score = 99.5 bits (237), Expect = 9e-21
 Identities = 46/78 (58%), Positives = 57/78 (73%)
 Frame = +1

Query: 13  LNPYRHSDAPAGRITCTADFKHLARKLTHFVMLKELKHCRSVEELVVTDSVRSKAKTFVK 192
           LNPYR  D   GRIT T DFKHLARKLTH VM KELK+C++ E+L   ++V+ K K ++K
Sbjct: 100 LNPYRKPDCKVGRITTTEDFKHLARKLTHGVMNKELKYCKNPEDLECNENVKHKTKEYIK 159

Query: 193 KYMAKFGPVYKRPPEEAD 246
           KYM KFG VYK P E+ +
Sbjct: 160 KYMQKFGAVYK-PKEDTE 176


>AB051519-1|BAB21823.2| 1915|Homo sapiens KIAA1732 protein protein.
          Length = 1915

 Score = 99.5 bits (237), Expect = 9e-21
 Identities = 46/78 (58%), Positives = 57/78 (73%)
 Frame = +1

Query: 13   LNPYRHSDAPAGRITCTADFKHLARKLTHFVMLKELKHCRSVEELVVTDSVRSKAKTFVK 192
            LNPYR  D   GRIT T DFKHLARKLTH VM KELK+C++ E+L   ++V+ K K ++K
Sbjct: 1837 LNPYRKPDCKVGRITTTEDFKHLARKLTHGVMNKELKYCKNPEDLECNENVKHKTKEYIK 1896

Query: 193  KYMAKFGPVYKRPPEEAD 246
            KYM KFG VYK P E+ +
Sbjct: 1897 KYMQKFGAVYK-PKEDTE 1913


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 85,410,795
Number of Sequences: 237096
Number of extensions: 1755911
Number of successful extensions: 4346
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 4259
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4345
length of database: 76,859,062
effective HSP length: 87
effective length of database: 56,231,710
effective search space used: 7197658880
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -