SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20064
         (713 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

D31885-1|BAA06683.1|  226|Homo sapiens KIAA0069 protein.               74   4e-13
BC010281-1|AAH10281.1|  203|Homo sapiens ADP-ribosylation factor...    74   4e-13

>D31885-1|BAA06683.1|  226|Homo sapiens KIAA0069 protein.
          Length = 226

 Score = 74.1 bits (174), Expect = 4e-13
 Identities = 26/84 (30%), Positives = 57/84 (67%)
 Frame = +3

Query: 243 LTLSKSVILWEQQWHPCAIVGSMTIMYLLIWLLDLNTLASIAIVGLILNFVDFMVPVICN 422
           + ++  V+ WE+ W P AI+G +++++L+I+ LD + L+ ++   + L   D++VP++  
Sbjct: 53  MLMADKVLRWERAWFPPAIMGVVSLVFLIIYYLDPSVLSGVSCFVMFLCLADYLVPILAP 112

Query: 423 QLYGSSSWTGQHEKTFEEICRSIV 494
           +++GS+ WT + ++ F EIC ++V
Sbjct: 113 RIFGSNKWTTEQQQRFHEICSNLV 136



 Score = 34.3 bits (75), Expect = 0.44
 Identities = 13/52 (25%), Positives = 25/52 (48%)
 Frame = +2

Query: 533 YSLRDTSPFMYYTISISTLCTVAWISSSINNIFXXXXXXXXXXXWPGIQRMG 688
           ++L++  P MY+   I +L  VAW+   ++N+             PG+ + G
Sbjct: 150 FTLKEEKPKMYFMTMIVSLAAVAWVGQQVHNLLLTYLIVTSLLLLPGLNQHG 201


>BC010281-1|AAH10281.1|  203|Homo sapiens ADP-ribosylation
           factor-like 6 interacting protein 1 protein.
          Length = 203

 Score = 74.1 bits (174), Expect = 4e-13
 Identities = 26/84 (30%), Positives = 57/84 (67%)
 Frame = +3

Query: 243 LTLSKSVILWEQQWHPCAIVGSMTIMYLLIWLLDLNTLASIAIVGLILNFVDFMVPVICN 422
           + ++  V+ WE+ W P AI+G +++++L+I+ LD + L+ ++   + L   D++VP++  
Sbjct: 30  MLMADKVLRWERAWFPPAIMGVVSLVFLIIYYLDPSVLSGVSCFVMFLCLADYLVPILAP 89

Query: 423 QLYGSSSWTGQHEKTFEEICRSIV 494
           +++GS+ WT + ++ F EIC ++V
Sbjct: 90  RIFGSNKWTTEQQQRFHEICSNLV 113



 Score = 34.3 bits (75), Expect = 0.44
 Identities = 13/52 (25%), Positives = 25/52 (48%)
 Frame = +2

Query: 533 YSLRDTSPFMYYTISISTLCTVAWISSSINNIFXXXXXXXXXXXWPGIQRMG 688
           ++L++  P MY+   I +L  VAW+   ++N+             PG+ + G
Sbjct: 127 FTLKEEKPKMYFMTMIVSLAAVAWVGQQVHNLLLTYLIVTSLLLLPGLNQHG 178


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 100,840,553
Number of Sequences: 237096
Number of extensions: 2008786
Number of successful extensions: 7404
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 7275
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7404
length of database: 76,859,062
effective HSP length: 88
effective length of database: 55,994,614
effective search space used: 8343197486
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -