SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20063
         (681 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

M58458-1|AAA63255.1|  263|Homo sapiens ribosomal protein S4X iso...   158   2e-38
M22146-1|AAA36597.1|  244|Homo sapiens protein ( Human scar prot...   158   2e-38
CR456735-1|CAG33016.1|  263|Homo sapiens RPS4X protein.               158   2e-38
BC100904-1|AAI00905.1|  263|Homo sapiens RPS4X protein protein.       158   2e-38
BC100903-1|AAI00904.1|  263|Homo sapiens RPS4X protein protein.       158   2e-38
BC071662-1|AAH71662.1|  263|Homo sapiens ribosomal protein S4, X...   158   2e-38
BC007308-1|AAH07308.2|  243|Homo sapiens RPS4X protein protein.       158   2e-38
BC000472-1|AAH00472.1|  263|Homo sapiens ribosomal protein S4, X...   158   2e-38
AK222479-1|BAD96199.1|  263|Homo sapiens ribosomal protein S4, X...   158   2e-38
AF041428-1|AAB96968.1|  263|Homo sapiens ribosomal protein s4 X ...   158   2e-38
M58459-1|AAA63256.1|  263|Homo sapiens ribosomal protein S4Y iso...   150   4e-36
BC100906-1|AAI00907.1|  262|Homo sapiens RPS4Y1 protein protein.      150   4e-36
BC100905-1|AAI00906.1|  263|Homo sapiens ribosomal protein S4, Y...   150   4e-36
BC010286-1|AAH10286.1|  263|Homo sapiens ribosomal protein S4, Y...   150   4e-36
AK222594-1|BAD96314.1|  263|Homo sapiens ribosomal protein S4, Y...   150   4e-36
AF041427-1|AAB96967.1|  263|Homo sapiens ribosomal protein s4 Y ...   150   4e-36
AF497481-1|AAM18074.1|  263|Homo sapiens ribosomal protein S4 pr...   146   8e-35
Z70767-1|CAA94808.1|   59|Homo sapiens ribosomal protein S4 prot...   113   7e-25
AY358764-1|AAQ89124.1|  182|Homo sapiens EPQL1862 protein.             32   1.6  
BC131489-1|AAI31490.1|  604|Homo sapiens USP35 protein protein.        31   2.9  
AJ586137-1|CAE51937.1| 1017|Homo sapiens ubiquitin-specific prot...    31   2.9  
AB037793-1|BAA92610.1|  773|Homo sapiens KIAA1372 protein protein.     31   2.9  
AK024165-1|BAB14843.1|  182|Homo sapiens protein ( Homo sapiens ...    31   3.8  
BC112317-1|AAI12318.1| 1284|Homo sapiens zinc finger protein 423...    30   8.8  
BC112315-1|AAI12316.1| 1284|Homo sapiens zinc finger protein 423...    30   8.8  
AJ301497-1|CAC34202.1|   76|Homo sapiens T-cell receptor beta ch...    30   8.8  
AF221712-1|AAF28354.1| 1224|Homo sapiens Smad- and Olf-interacti...    30   8.8  
AB018303-1|BAA34480.2| 1224|Homo sapiens KIAA0760 protein protein.     30   8.8  

>M58458-1|AAA63255.1|  263|Homo sapiens ribosomal protein S4X
           isoform protein.
          Length = 263

 Score =  158 bits (383), Expect = 2e-38
 Identities = 77/134 (57%), Positives = 89/134 (66%)
 Frame = +3

Query: 249 KGDGKVRTDPTYPAGFMDVVSIEKTNELFRLIYDVKGRFTIHRITPEEAKYKLCKVKRVA 428
           K DGKVRTD TYPAGFMDV+SI+KT E FRLIYD KGRF +HRITPEEAKYKLCKV+++ 
Sbjct: 71  KIDGKVRTDITYPAGFMDVISIDKTGENFRLIYDTKGRFAVHRITPEEAKYKLCKVRKIF 130

Query: 429 TGPKNVPYLVTHDGRTIRYPDPLIKVKIPSS*TLQLRRLWTSSSLSPGTCV*SREAVTWG 608
            G K +P+LVTHD RTIRYPDPLIKV       L+  ++        G           G
Sbjct: 131 VGTKGIPHLVTHDARTIRYPDPLIKVNDTIQIDLETGKITDFIKFDTGNLCMVTGGANLG 190

Query: 609 VWAPSCSRERHPGS 650
                 +RERHPGS
Sbjct: 191 RIGVITNRERHPGS 204



 Score =  135 bits (327), Expect = 1e-31
 Identities = 62/75 (82%), Positives = 67/75 (89%)
 Frame = +1

Query: 40  MARGPKKHLKRLNAPKAWMLDKLGGVYAPRPSTGPHKLRECLPLVIFLRNRLKYALTGNE 219
           MARGPKKHLKR+ APK WMLDKL GV+APRPSTGPHKLRECLPL+IFLRNRLKYALTG+E
Sbjct: 1   MARGPKKHLKRVAAPKHWMLDKLTGVFAPRPSTGPHKLRECLPLIIFLRNRLKYALTGDE 60

Query: 220 VLKIVKQRLIKVMGK 264
           V KI  QR IK+ GK
Sbjct: 61  VKKICMQRFIKIDGK 75



 Score = 77.8 bits (183), Expect = 3e-14
 Identities = 33/62 (53%), Positives = 44/62 (70%)
 Frame = +2

Query: 491 PTYQSQDSIQLDIATTKIMDFIKFESGNLCMITGGRNLGRVGTIVFPRETSRLFDIVHIK 670
           P  +  D+IQ+D+ T KI DFIKF++GNLCM+TGG NLGR+G I         FD+VH+K
Sbjct: 152 PLIKVNDTIQIDLETGKITDFIKFDTGNLCMVTGGANLGRIGVITNRERHPGSFDVVHVK 211

Query: 671 DS 676
           D+
Sbjct: 212 DA 213


>M22146-1|AAA36597.1|  244|Homo sapiens protein ( Human scar protein
           mRNA, complete cds. ).
          Length = 244

 Score =  158 bits (383), Expect = 2e-38
 Identities = 77/134 (57%), Positives = 89/134 (66%)
 Frame = +3

Query: 249 KGDGKVRTDPTYPAGFMDVVSIEKTNELFRLIYDVKGRFTIHRITPEEAKYKLCKVKRVA 428
           K DGKVRTD TYPAGFMDV+SI+KT E FRLIYD KGRF +HRITPEEAKYKLCKV+++ 
Sbjct: 52  KIDGKVRTDITYPAGFMDVISIDKTGENFRLIYDTKGRFAVHRITPEEAKYKLCKVRKIF 111

Query: 429 TGPKNVPYLVTHDGRTIRYPDPLIKVKIPSS*TLQLRRLWTSSSLSPGTCV*SREAVTWG 608
            G K +P+LVTHD RTIRYPDPLIKV       L+  ++        G           G
Sbjct: 112 VGTKGIPHLVTHDARTIRYPDPLIKVNDTIQIDLETGKITDFIKFDTGNLCMVTGGANLG 171

Query: 609 VWAPSCSRERHPGS 650
                 +RERHPGS
Sbjct: 172 RIGVITNRERHPGS 185



 Score = 95.9 bits (228), Expect = 1e-19
 Identities = 46/57 (80%), Positives = 50/57 (87%)
 Frame = +1

Query: 94  MLDKLGGVYAPRPSTGPHKLRECLPLVIFLRNRLKYALTGNEVLKIVKQRLIKVMGK 264
           MLDKL GV+APRPS GPHKLRECLPL+IFLRNRLKYALTG+EV KI  QR IK+ GK
Sbjct: 1   MLDKLTGVFAPRPS-GPHKLRECLPLIIFLRNRLKYALTGDEVKKICMQRFIKIDGK 56



 Score = 77.8 bits (183), Expect = 3e-14
 Identities = 33/62 (53%), Positives = 44/62 (70%)
 Frame = +2

Query: 491 PTYQSQDSIQLDIATTKIMDFIKFESGNLCMITGGRNLGRVGTIVFPRETSRLFDIVHIK 670
           P  +  D+IQ+D+ T KI DFIKF++GNLCM+TGG NLGR+G I         FD+VH+K
Sbjct: 133 PLIKVNDTIQIDLETGKITDFIKFDTGNLCMVTGGANLGRIGVITNRERHPGSFDVVHVK 192

Query: 671 DS 676
           D+
Sbjct: 193 DA 194


>CR456735-1|CAG33016.1|  263|Homo sapiens RPS4X protein.
          Length = 263

 Score =  158 bits (383), Expect = 2e-38
 Identities = 77/134 (57%), Positives = 89/134 (66%)
 Frame = +3

Query: 249 KGDGKVRTDPTYPAGFMDVVSIEKTNELFRLIYDVKGRFTIHRITPEEAKYKLCKVKRVA 428
           K DGKVRTD TYPAGFMDV+SI+KT E FRLIYD KGRF +HRITPEEAKYKLCKV+++ 
Sbjct: 71  KIDGKVRTDITYPAGFMDVISIDKTGENFRLIYDTKGRFAVHRITPEEAKYKLCKVRKIF 130

Query: 429 TGPKNVPYLVTHDGRTIRYPDPLIKVKIPSS*TLQLRRLWTSSSLSPGTCV*SREAVTWG 608
            G K +P+LVTHD RTIRYPDPLIKV       L+  ++        G           G
Sbjct: 131 VGTKGIPHLVTHDARTIRYPDPLIKVNDTIQIDLETGKITDFIKFDTGNLCMVTGGANLG 190

Query: 609 VWAPSCSRERHPGS 650
                 +RERHPGS
Sbjct: 191 RIGVITNRERHPGS 204



 Score =  135 bits (327), Expect = 1e-31
 Identities = 62/75 (82%), Positives = 67/75 (89%)
 Frame = +1

Query: 40  MARGPKKHLKRLNAPKAWMLDKLGGVYAPRPSTGPHKLRECLPLVIFLRNRLKYALTGNE 219
           MARGPKKHLKR+ APK WMLDKL GV+APRPSTGPHKLRECLPL+IFLRNRLKYALTG+E
Sbjct: 1   MARGPKKHLKRVAAPKHWMLDKLTGVFAPRPSTGPHKLRECLPLIIFLRNRLKYALTGDE 60

Query: 220 VLKIVKQRLIKVMGK 264
           V KI  QR IK+ GK
Sbjct: 61  VKKICMQRFIKIDGK 75



 Score = 77.8 bits (183), Expect = 3e-14
 Identities = 33/62 (53%), Positives = 44/62 (70%)
 Frame = +2

Query: 491 PTYQSQDSIQLDIATTKIMDFIKFESGNLCMITGGRNLGRVGTIVFPRETSRLFDIVHIK 670
           P  +  D+IQ+D+ T KI DFIKF++GNLCM+TGG NLGR+G I         FD+VH+K
Sbjct: 152 PLIKVNDTIQIDLETGKITDFIKFDTGNLCMVTGGANLGRIGVITNRERHPGSFDVVHVK 211

Query: 671 DS 676
           D+
Sbjct: 212 DA 213


>BC100904-1|AAI00905.1|  263|Homo sapiens RPS4X protein protein.
          Length = 263

 Score =  158 bits (383), Expect = 2e-38
 Identities = 77/134 (57%), Positives = 89/134 (66%)
 Frame = +3

Query: 249 KGDGKVRTDPTYPAGFMDVVSIEKTNELFRLIYDVKGRFTIHRITPEEAKYKLCKVKRVA 428
           K DGKVRTD TYPAGFMDV+SI+KT E FRLIYD KGRF +HRITPEEAKYKLCKV+++ 
Sbjct: 71  KIDGKVRTDITYPAGFMDVISIDKTGENFRLIYDTKGRFAVHRITPEEAKYKLCKVRKIF 130

Query: 429 TGPKNVPYLVTHDGRTIRYPDPLIKVKIPSS*TLQLRRLWTSSSLSPGTCV*SREAVTWG 608
            G K +P+LVTHD RTIRYPDPLIKV       L+  ++        G           G
Sbjct: 131 VGTKGIPHLVTHDARTIRYPDPLIKVNDTIQIDLETGKITDFIKFDTGNLCMVTGGANLG 190

Query: 609 VWAPSCSRERHPGS 650
                 +RERHPGS
Sbjct: 191 RIGVITNRERHPGS 204



 Score =  135 bits (327), Expect = 1e-31
 Identities = 62/75 (82%), Positives = 67/75 (89%)
 Frame = +1

Query: 40  MARGPKKHLKRLNAPKAWMLDKLGGVYAPRPSTGPHKLRECLPLVIFLRNRLKYALTGNE 219
           MARGPKKHLKR+ APK WMLDKL GV+APRPSTGPHKLRECLPL+IFLRNRLKYALTG+E
Sbjct: 1   MARGPKKHLKRVAAPKHWMLDKLTGVFAPRPSTGPHKLRECLPLIIFLRNRLKYALTGDE 60

Query: 220 VLKIVKQRLIKVMGK 264
           V KI  QR IK+ GK
Sbjct: 61  VKKICMQRFIKIDGK 75



 Score = 77.8 bits (183), Expect = 3e-14
 Identities = 33/62 (53%), Positives = 44/62 (70%)
 Frame = +2

Query: 491 PTYQSQDSIQLDIATTKIMDFIKFESGNLCMITGGRNLGRVGTIVFPRETSRLFDIVHIK 670
           P  +  D+IQ+D+ T KI DFIKF++GNLCM+TGG NLGR+G I         FD+VH+K
Sbjct: 152 PLIKVNDTIQIDLETGKITDFIKFDTGNLCMVTGGANLGRIGVITNRERHPGSFDVVHVK 211

Query: 671 DS 676
           D+
Sbjct: 212 DA 213


>BC100903-1|AAI00904.1|  263|Homo sapiens RPS4X protein protein.
          Length = 263

 Score =  158 bits (383), Expect = 2e-38
 Identities = 77/134 (57%), Positives = 89/134 (66%)
 Frame = +3

Query: 249 KGDGKVRTDPTYPAGFMDVVSIEKTNELFRLIYDVKGRFTIHRITPEEAKYKLCKVKRVA 428
           K DGKVRTD TYPAGFMDV+SI+KT E FRLIYD KGRF +HRITPEEAKYKLCKV+++ 
Sbjct: 71  KIDGKVRTDITYPAGFMDVISIDKTGENFRLIYDTKGRFAVHRITPEEAKYKLCKVRKIF 130

Query: 429 TGPKNVPYLVTHDGRTIRYPDPLIKVKIPSS*TLQLRRLWTSSSLSPGTCV*SREAVTWG 608
            G K +P+LVTHD RTIRYPDPLIKV       L+  ++        G           G
Sbjct: 131 VGTKGIPHLVTHDARTIRYPDPLIKVNDTIQIDLETGKITDFIKFDTGNLCMVTGGANLG 190

Query: 609 VWAPSCSRERHPGS 650
                 +RERHPGS
Sbjct: 191 RIGVITNRERHPGS 204



 Score =  135 bits (327), Expect = 1e-31
 Identities = 62/75 (82%), Positives = 67/75 (89%)
 Frame = +1

Query: 40  MARGPKKHLKRLNAPKAWMLDKLGGVYAPRPSTGPHKLRECLPLVIFLRNRLKYALTGNE 219
           MARGPKKHLKR+ APK WMLDKL GV+APRPSTGPHKLRECLPL+IFLRNRLKYALTG+E
Sbjct: 1   MARGPKKHLKRVAAPKHWMLDKLTGVFAPRPSTGPHKLRECLPLIIFLRNRLKYALTGDE 60

Query: 220 VLKIVKQRLIKVMGK 264
           V KI  QR IK+ GK
Sbjct: 61  VKKICMQRFIKIDGK 75



 Score = 77.8 bits (183), Expect = 3e-14
 Identities = 33/62 (53%), Positives = 44/62 (70%)
 Frame = +2

Query: 491 PTYQSQDSIQLDIATTKIMDFIKFESGNLCMITGGRNLGRVGTIVFPRETSRLFDIVHIK 670
           P  +  D+IQ+D+ T KI DFIKF++GNLCM+TGG NLGR+G I         FD+VH+K
Sbjct: 152 PLIKVNDTIQIDLETGKITDFIKFDTGNLCMVTGGANLGRIGVITNRERHPGSFDVVHVK 211

Query: 671 DS 676
           D+
Sbjct: 212 DA 213


>BC071662-1|AAH71662.1|  263|Homo sapiens ribosomal protein S4,
           X-linked protein.
          Length = 263

 Score =  158 bits (383), Expect = 2e-38
 Identities = 77/134 (57%), Positives = 89/134 (66%)
 Frame = +3

Query: 249 KGDGKVRTDPTYPAGFMDVVSIEKTNELFRLIYDVKGRFTIHRITPEEAKYKLCKVKRVA 428
           K DGKVRTD TYPAGFMDV+SI+KT E FRLIYD KGRF +HRITPEEAKYKLCKV+++ 
Sbjct: 71  KIDGKVRTDITYPAGFMDVISIDKTGENFRLIYDTKGRFAVHRITPEEAKYKLCKVRKIF 130

Query: 429 TGPKNVPYLVTHDGRTIRYPDPLIKVKIPSS*TLQLRRLWTSSSLSPGTCV*SREAVTWG 608
            G K +P+LVTHD RTIRYPDPLIKV       L+  ++        G           G
Sbjct: 131 VGTKGIPHLVTHDARTIRYPDPLIKVNDTIQIDLETGKITDFIKFDTGNLCMVTGGANLG 190

Query: 609 VWAPSCSRERHPGS 650
                 +RERHPGS
Sbjct: 191 RIGVITNRERHPGS 204



 Score =  135 bits (327), Expect = 1e-31
 Identities = 62/75 (82%), Positives = 67/75 (89%)
 Frame = +1

Query: 40  MARGPKKHLKRLNAPKAWMLDKLGGVYAPRPSTGPHKLRECLPLVIFLRNRLKYALTGNE 219
           MARGPKKHLKR+ APK WMLDKL GV+APRPSTGPHKLRECLPL+IFLRNRLKYALTG+E
Sbjct: 1   MARGPKKHLKRVAAPKHWMLDKLTGVFAPRPSTGPHKLRECLPLIIFLRNRLKYALTGDE 60

Query: 220 VLKIVKQRLIKVMGK 264
           V KI  QR IK+ GK
Sbjct: 61  VKKICMQRFIKIDGK 75



 Score = 77.8 bits (183), Expect = 3e-14
 Identities = 33/62 (53%), Positives = 44/62 (70%)
 Frame = +2

Query: 491 PTYQSQDSIQLDIATTKIMDFIKFESGNLCMITGGRNLGRVGTIVFPRETSRLFDIVHIK 670
           P  +  D+IQ+D+ T KI DFIKF++GNLCM+TGG NLGR+G I         FD+VH+K
Sbjct: 152 PLIKVNDTIQIDLETGKITDFIKFDTGNLCMVTGGANLGRIGVITNRERHPGSFDVVHVK 211

Query: 671 DS 676
           D+
Sbjct: 212 DA 213


>BC007308-1|AAH07308.2|  243|Homo sapiens RPS4X protein protein.
          Length = 243

 Score =  158 bits (383), Expect = 2e-38
 Identities = 77/134 (57%), Positives = 89/134 (66%)
 Frame = +3

Query: 249 KGDGKVRTDPTYPAGFMDVVSIEKTNELFRLIYDVKGRFTIHRITPEEAKYKLCKVKRVA 428
           K DGKVRTD TYPAGFMDV+SI+KT E FRLIYD KGRF +HRITPEEAKYKLCKV+++ 
Sbjct: 51  KIDGKVRTDITYPAGFMDVISIDKTGENFRLIYDTKGRFAVHRITPEEAKYKLCKVRKIF 110

Query: 429 TGPKNVPYLVTHDGRTIRYPDPLIKVKIPSS*TLQLRRLWTSSSLSPGTCV*SREAVTWG 608
            G K +P+LVTHD RTIRYPDPLIKV       L+  ++        G           G
Sbjct: 111 VGTKGIPHLVTHDARTIRYPDPLIKVNDTIQIDLETGKITDFIKFDTGNLCMVTGGANLG 170

Query: 609 VWAPSCSRERHPGS 650
                 +RERHPGS
Sbjct: 171 RIGVITNRERHPGS 184



 Score = 98.7 bits (235), Expect = 2e-20
 Identities = 45/55 (81%), Positives = 49/55 (89%)
 Frame = +1

Query: 100 DKLGGVYAPRPSTGPHKLRECLPLVIFLRNRLKYALTGNEVLKIVKQRLIKVMGK 264
           DKL GV+APRPSTGPHKLRECLPL+IFLRNRLKYALTG+EV KI  QR IK+ GK
Sbjct: 1   DKLTGVFAPRPSTGPHKLRECLPLIIFLRNRLKYALTGDEVKKICMQRFIKIDGK 55



 Score = 77.8 bits (183), Expect = 3e-14
 Identities = 33/62 (53%), Positives = 44/62 (70%)
 Frame = +2

Query: 491 PTYQSQDSIQLDIATTKIMDFIKFESGNLCMITGGRNLGRVGTIVFPRETSRLFDIVHIK 670
           P  +  D+IQ+D+ T KI DFIKF++GNLCM+TGG NLGR+G I         FD+VH+K
Sbjct: 132 PLIKVNDTIQIDLETGKITDFIKFDTGNLCMVTGGANLGRIGVITNRERHPGSFDVVHVK 191

Query: 671 DS 676
           D+
Sbjct: 192 DA 193


>BC000472-1|AAH00472.1|  263|Homo sapiens ribosomal protein S4,
           X-linked protein.
          Length = 263

 Score =  158 bits (383), Expect = 2e-38
 Identities = 77/134 (57%), Positives = 89/134 (66%)
 Frame = +3

Query: 249 KGDGKVRTDPTYPAGFMDVVSIEKTNELFRLIYDVKGRFTIHRITPEEAKYKLCKVKRVA 428
           K DGKVRTD TYPAGFMDV+SI+KT E FRLIYD KGRF +HRITPEEAKYKLCKV+++ 
Sbjct: 71  KIDGKVRTDITYPAGFMDVISIDKTGENFRLIYDTKGRFAVHRITPEEAKYKLCKVRKIF 130

Query: 429 TGPKNVPYLVTHDGRTIRYPDPLIKVKIPSS*TLQLRRLWTSSSLSPGTCV*SREAVTWG 608
            G K +P+LVTHD RTIRYPDPLIKV       L+  ++        G           G
Sbjct: 131 VGTKGIPHLVTHDARTIRYPDPLIKVNDTIQIDLETGKITDFIKFDTGNLCMVTGGANLG 190

Query: 609 VWAPSCSRERHPGS 650
                 +RERHPGS
Sbjct: 191 RIGVITNRERHPGS 204



 Score =  135 bits (327), Expect = 1e-31
 Identities = 62/75 (82%), Positives = 67/75 (89%)
 Frame = +1

Query: 40  MARGPKKHLKRLNAPKAWMLDKLGGVYAPRPSTGPHKLRECLPLVIFLRNRLKYALTGNE 219
           MARGPKKHLKR+ APK WMLDKL GV+APRPSTGPHKLRECLPL+IFLRNRLKYALTG+E
Sbjct: 1   MARGPKKHLKRVAAPKHWMLDKLTGVFAPRPSTGPHKLRECLPLIIFLRNRLKYALTGDE 60

Query: 220 VLKIVKQRLIKVMGK 264
           V KI  QR IK+ GK
Sbjct: 61  VKKICMQRFIKIDGK 75



 Score = 77.8 bits (183), Expect = 3e-14
 Identities = 33/62 (53%), Positives = 44/62 (70%)
 Frame = +2

Query: 491 PTYQSQDSIQLDIATTKIMDFIKFESGNLCMITGGRNLGRVGTIVFPRETSRLFDIVHIK 670
           P  +  D+IQ+D+ T KI DFIKF++GNLCM+TGG NLGR+G I         FD+VH+K
Sbjct: 152 PLIKVNDTIQIDLETGKITDFIKFDTGNLCMVTGGANLGRIGVITNRERHPGSFDVVHVK 211

Query: 671 DS 676
           D+
Sbjct: 212 DA 213


>AK222479-1|BAD96199.1|  263|Homo sapiens ribosomal protein S4,
           X-linked X isoform variant protein.
          Length = 263

 Score =  158 bits (383), Expect = 2e-38
 Identities = 77/134 (57%), Positives = 89/134 (66%)
 Frame = +3

Query: 249 KGDGKVRTDPTYPAGFMDVVSIEKTNELFRLIYDVKGRFTIHRITPEEAKYKLCKVKRVA 428
           K DGKVRTD TYPAGFMDV+SI+KT E FRLIYD KGRF +HRITPEEAKYKLCKV+++ 
Sbjct: 71  KIDGKVRTDITYPAGFMDVISIDKTGENFRLIYDTKGRFAVHRITPEEAKYKLCKVRKIF 130

Query: 429 TGPKNVPYLVTHDGRTIRYPDPLIKVKIPSS*TLQLRRLWTSSSLSPGTCV*SREAVTWG 608
            G K +P+LVTHD RTIRYPDPLIKV       L+  ++        G           G
Sbjct: 131 VGTKGIPHLVTHDARTIRYPDPLIKVNDTIQIDLETGKITDFIKFDTGNLCMVTGGANLG 190

Query: 609 VWAPSCSRERHPGS 650
                 +RERHPGS
Sbjct: 191 RIGVITNRERHPGS 204



 Score =  133 bits (322), Expect = 5e-31
 Identities = 61/75 (81%), Positives = 66/75 (88%)
 Frame = +1

Query: 40  MARGPKKHLKRLNAPKAWMLDKLGGVYAPRPSTGPHKLRECLPLVIFLRNRLKYALTGNE 219
           MARGPKKHLKR+ APK WMLDKL GV+AP PSTGPHKLRECLPL+IFLRNRLKYALTG+E
Sbjct: 1   MARGPKKHLKRVAAPKHWMLDKLTGVFAPHPSTGPHKLRECLPLIIFLRNRLKYALTGDE 60

Query: 220 VLKIVKQRLIKVMGK 264
           V KI  QR IK+ GK
Sbjct: 61  VKKICMQRFIKIDGK 75



 Score = 77.8 bits (183), Expect = 3e-14
 Identities = 33/62 (53%), Positives = 44/62 (70%)
 Frame = +2

Query: 491 PTYQSQDSIQLDIATTKIMDFIKFESGNLCMITGGRNLGRVGTIVFPRETSRLFDIVHIK 670
           P  +  D+IQ+D+ T KI DFIKF++GNLCM+TGG NLGR+G I         FD+VH+K
Sbjct: 152 PLIKVNDTIQIDLETGKITDFIKFDTGNLCMVTGGANLGRIGVITNRERHPGSFDVVHVK 211

Query: 671 DS 676
           D+
Sbjct: 212 DA 213


>AF041428-1|AAB96968.1|  263|Homo sapiens ribosomal protein s4 X
           isoform protein.
          Length = 263

 Score =  158 bits (383), Expect = 2e-38
 Identities = 77/134 (57%), Positives = 89/134 (66%)
 Frame = +3

Query: 249 KGDGKVRTDPTYPAGFMDVVSIEKTNELFRLIYDVKGRFTIHRITPEEAKYKLCKVKRVA 428
           K DGKVRTD TYPAGFMDV+SI+KT E FRLIYD KGRF +HRITPEEAKYKLCKV+++ 
Sbjct: 71  KIDGKVRTDITYPAGFMDVISIDKTGENFRLIYDTKGRFAVHRITPEEAKYKLCKVRKIF 130

Query: 429 TGPKNVPYLVTHDGRTIRYPDPLIKVKIPSS*TLQLRRLWTSSSLSPGTCV*SREAVTWG 608
            G K +P+LVTHD RTIRYPDPLIKV       L+  ++        G           G
Sbjct: 131 VGTKGIPHLVTHDARTIRYPDPLIKVNDTIQIDLETGKITDFIKFDTGNLCMVTGGANLG 190

Query: 609 VWAPSCSRERHPGS 650
                 +RERHPGS
Sbjct: 191 RIGVITNRERHPGS 204



 Score =  135 bits (327), Expect = 1e-31
 Identities = 62/75 (82%), Positives = 67/75 (89%)
 Frame = +1

Query: 40  MARGPKKHLKRLNAPKAWMLDKLGGVYAPRPSTGPHKLRECLPLVIFLRNRLKYALTGNE 219
           MARGPKKHLKR+ APK WMLDKL GV+APRPSTGPHKLRECLPL+IFLRNRLKYALTG+E
Sbjct: 1   MARGPKKHLKRVAAPKHWMLDKLTGVFAPRPSTGPHKLRECLPLIIFLRNRLKYALTGDE 60

Query: 220 VLKIVKQRLIKVMGK 264
           V KI  QR IK+ GK
Sbjct: 61  VKKICMQRFIKIDGK 75



 Score = 77.8 bits (183), Expect = 3e-14
 Identities = 33/62 (53%), Positives = 44/62 (70%)
 Frame = +2

Query: 491 PTYQSQDSIQLDIATTKIMDFIKFESGNLCMITGGRNLGRVGTIVFPRETSRLFDIVHIK 670
           P  +  D+IQ+D+ T KI DFIKF++GNLCM+TGG NLGR+G I         FD+VH+K
Sbjct: 152 PLIKVNDTIQIDLETGKITDFIKFDTGNLCMVTGGANLGRIGVITNRERHPGSFDVVHVK 211

Query: 671 DS 676
           D+
Sbjct: 212 DA 213


>M58459-1|AAA63256.1|  263|Homo sapiens ribosomal protein S4Y
           isoform protein.
          Length = 263

 Score =  150 bits (364), Expect = 4e-36
 Identities = 74/134 (55%), Positives = 86/134 (64%)
 Frame = +3

Query: 249 KGDGKVRTDPTYPAGFMDVVSIEKTNELFRLIYDVKGRFTIHRITPEEAKYKLCKVKRVA 428
           K DGKVR D TYPAGFMDV+SIEKT E FRL+YD KGRF +HRIT EEAKYKLCKV+++ 
Sbjct: 71  KIDGKVRVDVTYPAGFMDVISIEKTGEHFRLVYDTKGRFAVHRITVEEAKYKLCKVRKIT 130

Query: 429 TGPKNVPYLVTHDGRTIRYPDPLIKVKIPSS*TLQLRRLWTSSSLSPGTCV*SREAVTWG 608
            G K +P+LVTHD RTIRYPDP+IKV       L   ++        G           G
Sbjct: 131 VGVKGIPHLVTHDARTIRYPDPVIKVNDTVQIDLGTGKIINFIKFDTGNLCMVIGGANLG 190

Query: 609 VWAPSCSRERHPGS 650
                 +RERHPGS
Sbjct: 191 RVGVITNRERHPGS 204



 Score =  135 bits (326), Expect = 2e-31
 Identities = 61/75 (81%), Positives = 67/75 (89%)
 Frame = +1

Query: 40  MARGPKKHLKRLNAPKAWMLDKLGGVYAPRPSTGPHKLRECLPLVIFLRNRLKYALTGNE 219
           MARGPKKHLKR+ APK WMLDKL GV+APRPSTGPHKLRECLPL++FLRNRLKYALTG+E
Sbjct: 1   MARGPKKHLKRVAAPKHWMLDKLTGVFAPRPSTGPHKLRECLPLIVFLRNRLKYALTGDE 60

Query: 220 VLKIVKQRLIKVMGK 264
           V KI  QR IK+ GK
Sbjct: 61  VKKICMQRFIKIDGK 75



 Score = 74.9 bits (176), Expect = 2e-13
 Identities = 31/62 (50%), Positives = 44/62 (70%)
 Frame = +2

Query: 491 PTYQSQDSIQLDIATTKIMDFIKFESGNLCMITGGRNLGRVGTIVFPRETSRLFDIVHIK 670
           P  +  D++Q+D+ T KI++FIKF++GNLCM+ GG NLGRVG I         FD+VH+K
Sbjct: 152 PVIKVNDTVQIDLGTGKIINFIKFDTGNLCMVIGGANLGRVGVITNRERHPGSFDVVHVK 211

Query: 671 DS 676
           D+
Sbjct: 212 DA 213


>BC100906-1|AAI00907.1|  262|Homo sapiens RPS4Y1 protein protein.
          Length = 262

 Score =  150 bits (364), Expect = 4e-36
 Identities = 74/134 (55%), Positives = 86/134 (64%)
 Frame = +3

Query: 249 KGDGKVRTDPTYPAGFMDVVSIEKTNELFRLIYDVKGRFTIHRITPEEAKYKLCKVKRVA 428
           K DGKVR D TYPAGFMDV+SIEKT E FRL+YD KGRF +HRIT EEAKYKLCKV+++ 
Sbjct: 70  KIDGKVRVDVTYPAGFMDVISIEKTGEHFRLVYDTKGRFAVHRITVEEAKYKLCKVRKIT 129

Query: 429 TGPKNVPYLVTHDGRTIRYPDPLIKVKIPSS*TLQLRRLWTSSSLSPGTCV*SREAVTWG 608
            G K +P+LVTHD RTIRYPDP+IKV       L   ++        G           G
Sbjct: 130 VGVKGIPHLVTHDARTIRYPDPVIKVNDTVQIDLGTGKIINFIKFDTGNLCMVIGGANLG 189

Query: 609 VWAPSCSRERHPGS 650
                 +RERHPGS
Sbjct: 190 RVGVITNRERHPGS 203



 Score =  133 bits (321), Expect = 6e-31
 Identities = 60/74 (81%), Positives = 66/74 (89%)
 Frame = +1

Query: 43  ARGPKKHLKRLNAPKAWMLDKLGGVYAPRPSTGPHKLRECLPLVIFLRNRLKYALTGNEV 222
           ARGPKKHLKR+ APK WMLDKL GV+APRPSTGPHKLRECLPL++FLRNRLKYALTG+EV
Sbjct: 1   ARGPKKHLKRVAAPKHWMLDKLTGVFAPRPSTGPHKLRECLPLIVFLRNRLKYALTGDEV 60

Query: 223 LKIVKQRLIKVMGK 264
            KI  QR IK+ GK
Sbjct: 61  KKICMQRFIKIDGK 74



 Score = 74.9 bits (176), Expect = 2e-13
 Identities = 31/62 (50%), Positives = 44/62 (70%)
 Frame = +2

Query: 491 PTYQSQDSIQLDIATTKIMDFIKFESGNLCMITGGRNLGRVGTIVFPRETSRLFDIVHIK 670
           P  +  D++Q+D+ T KI++FIKF++GNLCM+ GG NLGRVG I         FD+VH+K
Sbjct: 151 PVIKVNDTVQIDLGTGKIINFIKFDTGNLCMVIGGANLGRVGVITNRERHPGSFDVVHVK 210

Query: 671 DS 676
           D+
Sbjct: 211 DA 212


>BC100905-1|AAI00906.1|  263|Homo sapiens ribosomal protein S4,
           Y-linked 1 protein.
          Length = 263

 Score =  150 bits (364), Expect = 4e-36
 Identities = 74/134 (55%), Positives = 86/134 (64%)
 Frame = +3

Query: 249 KGDGKVRTDPTYPAGFMDVVSIEKTNELFRLIYDVKGRFTIHRITPEEAKYKLCKVKRVA 428
           K DGKVR D TYPAGFMDV+SIEKT E FRL+YD KGRF +HRIT EEAKYKLCKV+++ 
Sbjct: 71  KIDGKVRVDVTYPAGFMDVISIEKTGEHFRLVYDTKGRFAVHRITVEEAKYKLCKVRKIT 130

Query: 429 TGPKNVPYLVTHDGRTIRYPDPLIKVKIPSS*TLQLRRLWTSSSLSPGTCV*SREAVTWG 608
            G K +P+LVTHD RTIRYPDP+IKV       L   ++        G           G
Sbjct: 131 VGVKGIPHLVTHDARTIRYPDPVIKVNDTVQIDLGTGKIINFIKFDTGNLCMVIGGANLG 190

Query: 609 VWAPSCSRERHPGS 650
                 +RERHPGS
Sbjct: 191 RVGVITNRERHPGS 204



 Score =  135 bits (326), Expect = 2e-31
 Identities = 61/75 (81%), Positives = 67/75 (89%)
 Frame = +1

Query: 40  MARGPKKHLKRLNAPKAWMLDKLGGVYAPRPSTGPHKLRECLPLVIFLRNRLKYALTGNE 219
           MARGPKKHLKR+ APK WMLDKL GV+APRPSTGPHKLRECLPL++FLRNRLKYALTG+E
Sbjct: 1   MARGPKKHLKRVAAPKHWMLDKLTGVFAPRPSTGPHKLRECLPLIVFLRNRLKYALTGDE 60

Query: 220 VLKIVKQRLIKVMGK 264
           V KI  QR IK+ GK
Sbjct: 61  VKKICMQRFIKIDGK 75



 Score = 74.9 bits (176), Expect = 2e-13
 Identities = 31/62 (50%), Positives = 44/62 (70%)
 Frame = +2

Query: 491 PTYQSQDSIQLDIATTKIMDFIKFESGNLCMITGGRNLGRVGTIVFPRETSRLFDIVHIK 670
           P  +  D++Q+D+ T KI++FIKF++GNLCM+ GG NLGRVG I         FD+VH+K
Sbjct: 152 PVIKVNDTVQIDLGTGKIINFIKFDTGNLCMVIGGANLGRVGVITNRERHPGSFDVVHVK 211

Query: 671 DS 676
           D+
Sbjct: 212 DA 213


>BC010286-1|AAH10286.1|  263|Homo sapiens ribosomal protein S4,
           Y-linked 1 protein.
          Length = 263

 Score =  150 bits (364), Expect = 4e-36
 Identities = 74/134 (55%), Positives = 86/134 (64%)
 Frame = +3

Query: 249 KGDGKVRTDPTYPAGFMDVVSIEKTNELFRLIYDVKGRFTIHRITPEEAKYKLCKVKRVA 428
           K DGKVR D TYPAGFMDV+SIEKT E FRL+YD KGRF +HRIT EEAKYKLCKV+++ 
Sbjct: 71  KIDGKVRVDVTYPAGFMDVISIEKTGEHFRLVYDTKGRFAVHRITVEEAKYKLCKVRKIT 130

Query: 429 TGPKNVPYLVTHDGRTIRYPDPLIKVKIPSS*TLQLRRLWTSSSLSPGTCV*SREAVTWG 608
            G K +P+LVTHD RTIRYPDP+IKV       L   ++        G           G
Sbjct: 131 VGVKGIPHLVTHDARTIRYPDPVIKVNDTVQIDLGTGKIINFIKFDTGNLCMVIGGANLG 190

Query: 609 VWAPSCSRERHPGS 650
                 +RERHPGS
Sbjct: 191 RVGVITNRERHPGS 204



 Score =  135 bits (326), Expect = 2e-31
 Identities = 61/75 (81%), Positives = 67/75 (89%)
 Frame = +1

Query: 40  MARGPKKHLKRLNAPKAWMLDKLGGVYAPRPSTGPHKLRECLPLVIFLRNRLKYALTGNE 219
           MARGPKKHLKR+ APK WMLDKL GV+APRPSTGPHKLRECLPL++FLRNRLKYALTG+E
Sbjct: 1   MARGPKKHLKRVAAPKHWMLDKLTGVFAPRPSTGPHKLRECLPLIVFLRNRLKYALTGDE 60

Query: 220 VLKIVKQRLIKVMGK 264
           V KI  QR IK+ GK
Sbjct: 61  VKKICMQRFIKIDGK 75



 Score = 74.9 bits (176), Expect = 2e-13
 Identities = 31/62 (50%), Positives = 44/62 (70%)
 Frame = +2

Query: 491 PTYQSQDSIQLDIATTKIMDFIKFESGNLCMITGGRNLGRVGTIVFPRETSRLFDIVHIK 670
           P  +  D++Q+D+ T KI++FIKF++GNLCM+ GG NLGRVG I         FD+VH+K
Sbjct: 152 PVIKVNDTVQIDLGTGKIINFIKFDTGNLCMVIGGANLGRVGVITNRERHPGSFDVVHVK 211

Query: 671 DS 676
           D+
Sbjct: 212 DA 213


>AK222594-1|BAD96314.1|  263|Homo sapiens ribosomal protein S4,
           Y-linked 1 Y isoform variant protein.
          Length = 263

 Score =  150 bits (364), Expect = 4e-36
 Identities = 74/134 (55%), Positives = 86/134 (64%)
 Frame = +3

Query: 249 KGDGKVRTDPTYPAGFMDVVSIEKTNELFRLIYDVKGRFTIHRITPEEAKYKLCKVKRVA 428
           K DGKVR D TYPAGFMDV+SIEKT E FRL+YD KGRF +HRIT EEAKYKLCKV+++ 
Sbjct: 71  KIDGKVRVDVTYPAGFMDVISIEKTGEHFRLVYDTKGRFAVHRITVEEAKYKLCKVRKIT 130

Query: 429 TGPKNVPYLVTHDGRTIRYPDPLIKVKIPSS*TLQLRRLWTSSSLSPGTCV*SREAVTWG 608
            G K +P+LVTHD RTIRYPDP+IKV       L   ++        G           G
Sbjct: 131 VGVKGIPHLVTHDARTIRYPDPVIKVNDTVQIDLGTGKIINFIKFDTGNLCMVIGGANLG 190

Query: 609 VWAPSCSRERHPGS 650
                 +RERHPGS
Sbjct: 191 RVGVITNRERHPGS 204



 Score =  135 bits (326), Expect = 2e-31
 Identities = 61/75 (81%), Positives = 67/75 (89%)
 Frame = +1

Query: 40  MARGPKKHLKRLNAPKAWMLDKLGGVYAPRPSTGPHKLRECLPLVIFLRNRLKYALTGNE 219
           MARGPKKHLKR+ APK WMLDKL GV+APRPSTGPHKLRECLPL++FLRNRLKYALTG+E
Sbjct: 1   MARGPKKHLKRVAAPKHWMLDKLTGVFAPRPSTGPHKLRECLPLIVFLRNRLKYALTGDE 60

Query: 220 VLKIVKQRLIKVMGK 264
           V KI  QR IK+ GK
Sbjct: 61  VKKICMQRFIKIDGK 75



 Score = 72.1 bits (169), Expect = 2e-12
 Identities = 30/62 (48%), Positives = 43/62 (69%)
 Frame = +2

Query: 491 PTYQSQDSIQLDIATTKIMDFIKFESGNLCMITGGRNLGRVGTIVFPRETSRLFDIVHIK 670
           P  +  D++Q+D+ T KI++FIKF++GNLCM+ GG NLGRVG I         F +VH+K
Sbjct: 152 PVIKVNDTVQIDLGTGKIINFIKFDTGNLCMVIGGANLGRVGVITNRERHPGSFGVVHVK 211

Query: 671 DS 676
           D+
Sbjct: 212 DA 213


>AF041427-1|AAB96967.1|  263|Homo sapiens ribosomal protein s4 Y
           isoform protein.
          Length = 263

 Score =  150 bits (364), Expect = 4e-36
 Identities = 74/134 (55%), Positives = 86/134 (64%)
 Frame = +3

Query: 249 KGDGKVRTDPTYPAGFMDVVSIEKTNELFRLIYDVKGRFTIHRITPEEAKYKLCKVKRVA 428
           K DGKVR D TYPAGFMDV+SIEKT E FRL+YD KGRF +HRIT EEAKYKLCKV+++ 
Sbjct: 71  KIDGKVRVDVTYPAGFMDVISIEKTGEHFRLVYDTKGRFAVHRITVEEAKYKLCKVRKIT 130

Query: 429 TGPKNVPYLVTHDGRTIRYPDPLIKVKIPSS*TLQLRRLWTSSSLSPGTCV*SREAVTWG 608
            G K +P+LVTHD RTIRYPDP+IKV       L   ++        G           G
Sbjct: 131 VGVKGIPHLVTHDARTIRYPDPVIKVNDTVQIDLGTGKIINFIKFDTGNLCMVIGGANLG 190

Query: 609 VWAPSCSRERHPGS 650
                 +RERHPGS
Sbjct: 191 RVGVITNRERHPGS 204



 Score =  135 bits (326), Expect = 2e-31
 Identities = 61/75 (81%), Positives = 67/75 (89%)
 Frame = +1

Query: 40  MARGPKKHLKRLNAPKAWMLDKLGGVYAPRPSTGPHKLRECLPLVIFLRNRLKYALTGNE 219
           MARGPKKHLKR+ APK WMLDKL GV+APRPSTGPHKLRECLPL++FLRNRLKYALTG+E
Sbjct: 1   MARGPKKHLKRVAAPKHWMLDKLTGVFAPRPSTGPHKLRECLPLIVFLRNRLKYALTGDE 60

Query: 220 VLKIVKQRLIKVMGK 264
           V KI  QR IK+ GK
Sbjct: 61  VKKICMQRFIKIDGK 75



 Score = 74.9 bits (176), Expect = 2e-13
 Identities = 31/62 (50%), Positives = 44/62 (70%)
 Frame = +2

Query: 491 PTYQSQDSIQLDIATTKIMDFIKFESGNLCMITGGRNLGRVGTIVFPRETSRLFDIVHIK 670
           P  +  D++Q+D+ T KI++FIKF++GNLCM+ GG NLGRVG I         FD+VH+K
Sbjct: 152 PVIKVNDTVQIDLGTGKIINFIKFDTGNLCMVIGGANLGRVGVITNRERHPGSFDVVHVK 211

Query: 671 DS 676
           D+
Sbjct: 212 DA 213


>AF497481-1|AAM18074.1|  263|Homo sapiens ribosomal protein S4
           protein.
          Length = 263

 Score =  146 bits (353), Expect = 8e-35
 Identities = 72/134 (53%), Positives = 86/134 (64%)
 Frame = +3

Query: 249 KGDGKVRTDPTYPAGFMDVVSIEKTNELFRLIYDVKGRFTIHRITPEEAKYKLCKVKRVA 428
           K DGKVR D TYPAGF+DV+SIEKT E FRL+Y+ KG F +HRIT EEAKYKLCKV+++ 
Sbjct: 71  KIDGKVRVDITYPAGFIDVISIEKTGEHFRLVYNTKGCFAVHRITVEEAKYKLCKVRKIT 130

Query: 429 TGPKNVPYLVTHDGRTIRYPDPLIKVKIPSS*TLQLRRLWTSSSLSPGTCV*SREAVTWG 608
            G K +P+LVTHD RTIRYPDPLIKV       L   ++ +      G           G
Sbjct: 131 VGTKGIPHLVTHDARTIRYPDPLIKVNDTVQIDLGTGKITSFIKFDTGNVCMVIAGANLG 190

Query: 609 VWAPSCSRERHPGS 650
                 +RERHPGS
Sbjct: 191 RVGVITNRERHPGS 204



 Score =  132 bits (319), Expect = 1e-30
 Identities = 59/75 (78%), Positives = 66/75 (88%)
 Frame = +1

Query: 40  MARGPKKHLKRLNAPKAWMLDKLGGVYAPRPSTGPHKLRECLPLVIFLRNRLKYALTGNE 219
           MARGPKKHLKR+ APK WMLDKL GV+APRPSTGPHKLRECLPL++FLRNRLKYALTG+E
Sbjct: 1   MARGPKKHLKRVAAPKHWMLDKLTGVFAPRPSTGPHKLRECLPLIVFLRNRLKYALTGDE 60

Query: 220 VLKIVKQRLIKVMGK 264
           V KI  Q  +K+ GK
Sbjct: 61  VKKICMQHFLKIDGK 75



 Score = 66.5 bits (155), Expect = 8e-11
 Identities = 28/62 (45%), Positives = 40/62 (64%)
 Frame = +2

Query: 491 PTYQSQDSIQLDIATTKIMDFIKFESGNLCMITGGRNLGRVGTIVFPRETSRLFDIVHIK 670
           P  +  D++Q+D+ T KI  FIKF++GN+CM+  G NLGRVG I          D+VH+K
Sbjct: 152 PLIKVNDTVQIDLGTGKITSFIKFDTGNVCMVIAGANLGRVGVITNRERHPGSCDVVHVK 211

Query: 671 DS 676
           D+
Sbjct: 212 DA 213


>Z70767-1|CAA94808.1|   59|Homo sapiens ribosomal protein S4
           protein.
          Length = 59

 Score =  113 bits (271), Expect = 7e-25
 Identities = 50/56 (89%), Positives = 53/56 (94%)
 Frame = +1

Query: 40  MARGPKKHLKRLNAPKAWMLDKLGGVYAPRPSTGPHKLRECLPLVIFLRNRLKYAL 207
           MARGPKKHLKR+ APK WMLDKL GV+APRPSTGPHKLRECLPL+IFLRNRLKYAL
Sbjct: 1   MARGPKKHLKRVAAPKHWMLDKLTGVFAPRPSTGPHKLRECLPLIIFLRNRLKYAL 56


>AY358764-1|AAQ89124.1|  182|Homo sapiens EPQL1862 protein.
          Length = 182

 Score = 32.3 bits (70), Expect = 1.6
 Identities = 15/49 (30%), Positives = 25/49 (51%)
 Frame = +3

Query: 279 TYPAGFMDVVSIEKTNELFRLIYDVKGRFTIHRITPEEAKYKLCKVKRV 425
           +YPA + D   I +  E+FRL+   +   +  RI    +  K C ++RV
Sbjct: 96  SYPANYSDDSKIWRPVEIFRLVSKYQNEISDRRICASASAPKTCSIERV 144


>BC131489-1|AAI31490.1|  604|Homo sapiens USP35 protein protein.
          Length = 604

 Score = 31.5 bits (68), Expect = 2.9
 Identities = 19/53 (35%), Positives = 29/53 (54%)
 Frame = +3

Query: 177 FPEESSEVCFDRKRSPENCETTPHKGDGKVRTDPTYPAGFMDVVSIEKTNELF 335
           FP++++ V F R+R  E  E     G  +VRT+PT     M+ +S  K N L+
Sbjct: 499 FPKDTAYVLFYRQRPREGPEA--ELGSSRVRTEPTLHKDLMEAIS--KDNILY 547


>AJ586137-1|CAE51937.1| 1017|Homo sapiens ubiquitin-specific
            proteinase 35 protein.
          Length = 1017

 Score = 31.5 bits (68), Expect = 2.9
 Identities = 19/53 (35%), Positives = 29/53 (54%)
 Frame = +3

Query: 177  FPEESSEVCFDRKRSPENCETTPHKGDGKVRTDPTYPAGFMDVVSIEKTNELF 335
            FP++++ V F R+R  E  E     G  +VRT+PT     M+ +S  K N L+
Sbjct: 912  FPKDTAYVLFYRQRPREGPEA--ELGSSRVRTEPTLHKDLMEAIS--KDNILY 960


>AB037793-1|BAA92610.1|  773|Homo sapiens KIAA1372 protein protein.
          Length = 773

 Score = 31.5 bits (68), Expect = 2.9
 Identities = 19/53 (35%), Positives = 29/53 (54%)
 Frame = +3

Query: 177 FPEESSEVCFDRKRSPENCETTPHKGDGKVRTDPTYPAGFMDVVSIEKTNELF 335
           FP++++ V F R+R  E  E     G  +VRT+PT     M+ +S  K N L+
Sbjct: 668 FPKDTAYVLFYRQRPREGPEA--ELGSSRVRTEPTLHKDLMEAIS--KDNILY 716


>AK024165-1|BAB14843.1|  182|Homo sapiens protein ( Homo sapiens
           cDNA FLJ14103 fis, clone MAMMA1001073. ).
          Length = 182

 Score = 31.1 bits (67), Expect = 3.8
 Identities = 14/49 (28%), Positives = 25/49 (51%)
 Frame = +3

Query: 279 TYPAGFMDVVSIEKTNELFRLIYDVKGRFTIHRITPEEAKYKLCKVKRV 425
           +YPA + D   I +  E+FRL+   +   +  +I    +  K C ++RV
Sbjct: 96  SYPANYSDDSKIWRPVEIFRLVSKYQNEISDRKICASASAPKTCSIERV 144


>BC112317-1|AAI12318.1| 1284|Homo sapiens zinc finger protein 423
            protein.
          Length = 1284

 Score = 29.9 bits (64), Expect = 8.8
 Identities = 16/43 (37%), Positives = 21/43 (48%)
 Frame = +3

Query: 450  YLVTHDGRTIRYPDPLIKVKIPSS*TLQLRRLWTSSSLSPGTC 578
            +L TH G    Y  P+   + PS  TL   ++  S SL  GTC
Sbjct: 948  HLQTHRGPAKHYMCPICGERFPSLLTLTEHKVTHSKSLDTGTC 990


>BC112315-1|AAI12316.1| 1284|Homo sapiens zinc finger protein 423
            protein.
          Length = 1284

 Score = 29.9 bits (64), Expect = 8.8
 Identities = 16/43 (37%), Positives = 21/43 (48%)
 Frame = +3

Query: 450  YLVTHDGRTIRYPDPLIKVKIPSS*TLQLRRLWTSSSLSPGTC 578
            +L TH G    Y  P+   + PS  TL   ++  S SL  GTC
Sbjct: 948  HLQTHRGPAKHYMCPICGERFPSLLTLTEHKVTHSKSLDTGTC 990


>AJ301497-1|CAC34202.1|   76|Homo sapiens T-cell receptor beta chain
           VJ region protein.
          Length = 76

 Score = 29.9 bits (64), Expect = 8.8
 Identities = 18/56 (32%), Positives = 29/56 (51%), Gaps = 1/56 (1%)
 Frame = +3

Query: 270 TDPTYPAGFM-DVVSIEKTNELFRLIYDVKGRFTIHRITPEEAKYKLCKVKRVATG 434
           ++ TY +GF+ D   I + N  F  +       T+  ++PE++   LC V RV TG
Sbjct: 10  SEATYESGFVIDKFPISRPNLTFSTL-------TVSNMSPEDSSIYLCSVLRVVTG 58


>AF221712-1|AAF28354.1| 1224|Homo sapiens Smad- and Olf-interacting
            zinc finger protein protein.
          Length = 1224

 Score = 29.9 bits (64), Expect = 8.8
 Identities = 16/43 (37%), Positives = 21/43 (48%)
 Frame = +3

Query: 450  YLVTHDGRTIRYPDPLIKVKIPSS*TLQLRRLWTSSSLSPGTC 578
            +L TH G    Y  P+   + PS  TL   ++  S SL  GTC
Sbjct: 888  HLQTHRGPAKHYMCPICGERFPSLLTLTEHKVTHSKSLDTGTC 930


>AB018303-1|BAA34480.2| 1224|Homo sapiens KIAA0760 protein protein.
          Length = 1224

 Score = 29.9 bits (64), Expect = 8.8
 Identities = 16/43 (37%), Positives = 21/43 (48%)
 Frame = +3

Query: 450  YLVTHDGRTIRYPDPLIKVKIPSS*TLQLRRLWTSSSLSPGTC 578
            +L TH G    Y  P+   + PS  TL   ++  S SL  GTC
Sbjct: 888  HLQTHRGPAKHYMCPICGERFPSLLTLTEHKVTHSKSLDTGTC 930


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 111,564,794
Number of Sequences: 237096
Number of extensions: 2627350
Number of successful extensions: 19071
Number of sequences better than 10.0: 28
Number of HSP's better than 10.0 without gapping: 18696
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 19053
length of database: 76,859,062
effective HSP length: 88
effective length of database: 55,994,614
effective search space used: 7727256732
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -