SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20062
         (635 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z97195-2|CAI19055.1|  859|Homo sapiens dynamin 3 protein.             161   1e-39
Z97195-1|CAI19054.1|  869|Homo sapiens dynamin 3 protein.             161   1e-39
BC064546-1|AAH64546.1|  555|Homo sapiens DNM3 protein protein.        161   1e-39
AL512843-3|CAH71040.1|  859|Homo sapiens dynamin 3 protein.           161   1e-39
AL512843-2|CAH71041.1|  869|Homo sapiens dynamin 3 protein.           161   1e-39
AL512843-1|CAH71039.1|  555|Homo sapiens dynamin 3 protein.           161   1e-39
AL445990-2|CAH69969.1|  859|Homo sapiens dynamin 3 protein.           161   1e-39
AL445990-1|CAH69970.1|  869|Homo sapiens dynamin 3 protein.           161   1e-39
AL137157-3|CAI19211.1|  859|Homo sapiens dynamin 3 protein.           161   1e-39
AL137157-2|CAI19212.1|  869|Homo sapiens dynamin 3 protein.           161   1e-39
AL137157-1|CAI19210.1|  555|Homo sapiens dynamin 3 protein.           161   1e-39
AL133514-2|CAH74079.1|  859|Homo sapiens dynamin 3 protein.           161   1e-39
AL133514-1|CAH74080.1|  869|Homo sapiens dynamin 3 protein.           161   1e-39
AL121984-3|CAH71952.1|  859|Homo sapiens dynamin 3 protein.           161   1e-39
AL121984-2|CAH71951.1|  869|Homo sapiens dynamin 3 protein.           161   1e-39
AL121984-1|CAH71950.1|  555|Homo sapiens dynamin 3 protein.           161   1e-39
AL031864-9|CAI22007.1|  859|Homo sapiens dynamin 3 protein.           161   1e-39
AL031864-8|CAI22008.1|  869|Homo sapiens dynamin 3 protein.           161   1e-39
AL031864-7|CAI22006.1|  555|Homo sapiens dynamin 3 protein.           161   1e-39
AB020627-1|BAA74843.2|  892|Homo sapiens KIAA0820 protein protein.    161   1e-39
BC054501-1|AAH54501.1|  866|Homo sapiens dynamin 2 protein.           158   1e-38
BC039596-1|AAH39596.1|  870|Homo sapiens dynamin 2 protein.           158   1e-38
AB209213-1|BAD92450.1|  487|Homo sapiens dynamin 2 isoform 4 var...   158   1e-38
L36983-1|AAA88025.1|  866|Homo sapiens dynamin protein.               156   5e-38
L07807-1|AAA02803.1|  864|Homo sapiens dynamin protein.               155   2e-37
BC063850-1|AAH63850.1|  851|Homo sapiens dynamin 1 protein.           155   2e-37
BC050279-1|AAH50279.2|  851|Homo sapiens dynamin 1 protein.           155   2e-37
AL590708-18|CAI13837.1|  864|Homo sapiens dynamin 1 protein.          155   2e-37
AL590708-17|CAI13839.2|  851|Homo sapiens dynamin 1 protein.          155   2e-37
AB209124-1|BAD92361.1|  600|Homo sapiens dynamin 1 isoform 2 var...   155   2e-37
BC107763-1|AAI07764.1|  575|Homo sapiens DNM1L protein protein.       117   3e-26
BC024590-1|AAH24590.1|  710|Homo sapiens dynamin 1-like protein.      117   3e-26
BC000136-1|AAH00136.1|  710|Homo sapiens Unknown (protein for IM...   117   3e-26
AF151685-1|AAD39541.1|  725|Homo sapiens dynamin-like protein DY...   117   3e-26
AF061795-1|AAC35283.1|  699|Homo sapiens dynamin-like protein Dy...   117   3e-26
AF000430-1|AAC23724.1|  736|Homo sapiens dynamin-like protein pr...   117   3e-26
AB209070-1|BAD92307.1|  751|Homo sapiens Dynamin-like protein DY...   117   3e-26
AB006965-1|BAA22193.1|  736|Homo sapiens Dnm1p/Vps1p-like protei...   117   3e-26
M33883-1|AAA36459.1|  687|Homo sapiens protein ( Human p78-relat...    85   3e-16
M30818-1|AAA36338.1|  715|Homo sapiens interferon-induced Mx pro...    85   3e-16
BC035293-1|AAH35293.1|  715|Homo sapiens myxovirus (influenza vi...    85   3e-16
AL163285-2|CAB90555.1|  715|Homo sapiens human interferon-regula...    85   3e-16
M33882-1|AAA36458.1|  662|Homo sapiens protein ( Human p78 prote...    82   2e-15
M30817-1|AAA36337.1|  662|Homo sapiens interferon-induced Mx pro...    82   2e-15
BC032602-1|AAH32602.1|  662|Homo sapiens myxovirus (influenza vi...    82   2e-15
BC014222-1|AAH14222.2|  578|Homo sapiens MX1 protein protein.          82   2e-15
AL163285-3|CAB90556.1|  662|Homo sapiens human interferon-regula...    82   2e-15
AK093008-1|BAC04017.1|  662|Homo sapiens protein ( Homo sapiens ...    82   2e-15
AF135187-1|AAD43063.1|  662|Homo sapiens interferon-induced prot...    82   2e-15
AC004508-1|AAC08448.1|  262|Homo sapiens MX2 protein.                  53   7e-07
BC075805-1|AAH75805.1|  960|Homo sapiens optic atrophy 1 (autoso...    47   6e-05
AB011139-1|BAA25493.1|  978|Homo sapiens KIAA0567 protein protein.     47   6e-05
AC004497-1|AAC08451.1|  424|Homo sapiens MX2 protein.                  34   0.49 
AJ001057-1|CAA04507.1| 1299|Homo sapiens NrCAM protein protein.        31   2.6  
U55258-1|AAC50765.1| 1299|Homo sapiens hBRAVO/Nr-CAM precursor p...    30   7.9  
BX538010-1|CAD97960.1| 1183|Homo sapiens hypothetical protein pr...    30   7.9  
BC115736-1|AAI15737.1| 1192|Homo sapiens NRCAM protein protein.        30   7.9  
BC114570-1|AAI14571.1| 1180|Homo sapiens NRCAM protein protein.        30   7.9  
AF172277-2|AAF22283.1| 1236|Homo sapiens NgCAM-related related c...    30   7.9  
AF172277-1|AAF22282.1| 1308|Homo sapiens NgCAM-related related c...    30   7.9  
AB002341-1|BAA20801.2| 1187|Homo sapiens KIAA0343 protein.             30   7.9  

>Z97195-2|CAI19055.1|  859|Homo sapiens dynamin 3 protein.
          Length = 859

 Score =  161 bits (392), Expect = 1e-39
 Identities = 78/88 (88%), Positives = 83/88 (94%)
 Frame = +1

Query: 259 QIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT 438
           QI+ MI QFI RE+CLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT
Sbjct: 155 QIREMIMQFITRENCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT 214

Query: 439 DARDVLENKLLPLRRGYIGVVNRCRKTL 522
           DARDVLENKLLPLRRGY+GVVNR +K +
Sbjct: 215 DARDVLENKLLPLRRGYVGVVNRSQKDI 242



 Score =  146 bits (355), Expect = 4e-35
 Identities = 67/81 (82%), Positives = 73/81 (90%)
 Frame = +2

Query: 11  QLINGNTEYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLN 190
           QL+    EYAEFLHCKGKKFTDF+EVR EIEAETDRVTG NKGIS +PINLRVYSP+VLN
Sbjct: 72  QLVTSKAEYAEFLHCKGKKFTDFDEVRLEIEAETDRVTGMNKGISSIPINLRVYSPHVLN 131

Query: 191 LTLIDLPGLTKVPIGDQPIDI 253
           LTLIDLPG+TKVP+GDQP DI
Sbjct: 132 LTLIDLPGITKVPVGDQPPDI 152



 Score = 69.3 bits (162), Expect = 1e-11
 Identities = 29/36 (80%), Positives = 34/36 (94%)
 Frame = +3

Query: 510 QKDIDGRKDIAAALAAERKFFLSHPSYRHLADRLGT 617
           QKDIDG+KDI AA+ AERKFFLSHP+YRH+ADR+GT
Sbjct: 239 QKDIDGKKDIKAAMLAERKFFLSHPAYRHIADRMGT 274


>Z97195-1|CAI19054.1|  869|Homo sapiens dynamin 3 protein.
          Length = 869

 Score =  161 bits (392), Expect = 1e-39
 Identities = 78/88 (88%), Positives = 83/88 (94%)
 Frame = +1

Query: 259 QIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT 438
           QI+ MI QFI RE+CLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT
Sbjct: 155 QIREMIMQFITRENCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT 214

Query: 439 DARDVLENKLLPLRRGYIGVVNRCRKTL 522
           DARDVLENKLLPLRRGY+GVVNR +K +
Sbjct: 215 DARDVLENKLLPLRRGYVGVVNRSQKDI 242



 Score =  146 bits (355), Expect = 4e-35
 Identities = 67/81 (82%), Positives = 73/81 (90%)
 Frame = +2

Query: 11  QLINGNTEYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLN 190
           QL+    EYAEFLHCKGKKFTDF+EVR EIEAETDRVTG NKGIS +PINLRVYSP+VLN
Sbjct: 72  QLVTSKAEYAEFLHCKGKKFTDFDEVRLEIEAETDRVTGMNKGISSIPINLRVYSPHVLN 131

Query: 191 LTLIDLPGLTKVPIGDQPIDI 253
           LTLIDLPG+TKVP+GDQP DI
Sbjct: 132 LTLIDLPGITKVPVGDQPPDI 152



 Score = 69.3 bits (162), Expect = 1e-11
 Identities = 29/36 (80%), Positives = 34/36 (94%)
 Frame = +3

Query: 510 QKDIDGRKDIAAALAAERKFFLSHPSYRHLADRLGT 617
           QKDIDG+KDI AA+ AERKFFLSHP+YRH+ADR+GT
Sbjct: 239 QKDIDGKKDIKAAMLAERKFFLSHPAYRHIADRMGT 274


>BC064546-1|AAH64546.1|  555|Homo sapiens DNM3 protein protein.
          Length = 555

 Score =  161 bits (392), Expect = 1e-39
 Identities = 78/88 (88%), Positives = 83/88 (94%)
 Frame = +1

Query: 259 QIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT 438
           QI+ MI QFI RE+CLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT
Sbjct: 155 QIREMIMQFITRENCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT 214

Query: 439 DARDVLENKLLPLRRGYIGVVNRCRKTL 522
           DARDVLENKLLPLRRGY+GVVNR +K +
Sbjct: 215 DARDVLENKLLPLRRGYVGVVNRSQKDI 242



 Score =  146 bits (355), Expect = 4e-35
 Identities = 67/81 (82%), Positives = 73/81 (90%)
 Frame = +2

Query: 11  QLINGNTEYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLN 190
           QL+    EYAEFLHCKGKKFTDF+EVR EIEAETDRVTG NKGIS +PINLRVYSP+VLN
Sbjct: 72  QLVTSKAEYAEFLHCKGKKFTDFDEVRLEIEAETDRVTGMNKGISSIPINLRVYSPHVLN 131

Query: 191 LTLIDLPGLTKVPIGDQPIDI 253
           LTLIDLPG+TKVP+GDQP DI
Sbjct: 132 LTLIDLPGITKVPVGDQPPDI 152



 Score = 69.3 bits (162), Expect = 1e-11
 Identities = 29/36 (80%), Positives = 34/36 (94%)
 Frame = +3

Query: 510 QKDIDGRKDIAAALAAERKFFLSHPSYRHLADRLGT 617
           QKDIDG+KDI AA+ AERKFFLSHP+YRH+ADR+GT
Sbjct: 239 QKDIDGKKDIKAAMLAERKFFLSHPAYRHIADRMGT 274


>AL512843-3|CAH71040.1|  859|Homo sapiens dynamin 3 protein.
          Length = 859

 Score =  161 bits (392), Expect = 1e-39
 Identities = 78/88 (88%), Positives = 83/88 (94%)
 Frame = +1

Query: 259 QIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT 438
           QI+ MI QFI RE+CLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT
Sbjct: 155 QIREMIMQFITRENCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT 214

Query: 439 DARDVLENKLLPLRRGYIGVVNRCRKTL 522
           DARDVLENKLLPLRRGY+GVVNR +K +
Sbjct: 215 DARDVLENKLLPLRRGYVGVVNRSQKDI 242



 Score =  146 bits (355), Expect = 4e-35
 Identities = 67/81 (82%), Positives = 73/81 (90%)
 Frame = +2

Query: 11  QLINGNTEYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLN 190
           QL+    EYAEFLHCKGKKFTDF+EVR EIEAETDRVTG NKGIS +PINLRVYSP+VLN
Sbjct: 72  QLVTSKAEYAEFLHCKGKKFTDFDEVRLEIEAETDRVTGMNKGISSIPINLRVYSPHVLN 131

Query: 191 LTLIDLPGLTKVPIGDQPIDI 253
           LTLIDLPG+TKVP+GDQP DI
Sbjct: 132 LTLIDLPGITKVPVGDQPPDI 152



 Score = 69.3 bits (162), Expect = 1e-11
 Identities = 29/36 (80%), Positives = 34/36 (94%)
 Frame = +3

Query: 510 QKDIDGRKDIAAALAAERKFFLSHPSYRHLADRLGT 617
           QKDIDG+KDI AA+ AERKFFLSHP+YRH+ADR+GT
Sbjct: 239 QKDIDGKKDIKAAMLAERKFFLSHPAYRHIADRMGT 274


>AL512843-2|CAH71041.1|  869|Homo sapiens dynamin 3 protein.
          Length = 869

 Score =  161 bits (392), Expect = 1e-39
 Identities = 78/88 (88%), Positives = 83/88 (94%)
 Frame = +1

Query: 259 QIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT 438
           QI+ MI QFI RE+CLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT
Sbjct: 155 QIREMIMQFITRENCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT 214

Query: 439 DARDVLENKLLPLRRGYIGVVNRCRKTL 522
           DARDVLENKLLPLRRGY+GVVNR +K +
Sbjct: 215 DARDVLENKLLPLRRGYVGVVNRSQKDI 242



 Score =  146 bits (355), Expect = 4e-35
 Identities = 67/81 (82%), Positives = 73/81 (90%)
 Frame = +2

Query: 11  QLINGNTEYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLN 190
           QL+    EYAEFLHCKGKKFTDF+EVR EIEAETDRVTG NKGIS +PINLRVYSP+VLN
Sbjct: 72  QLVTSKAEYAEFLHCKGKKFTDFDEVRLEIEAETDRVTGMNKGISSIPINLRVYSPHVLN 131

Query: 191 LTLIDLPGLTKVPIGDQPIDI 253
           LTLIDLPG+TKVP+GDQP DI
Sbjct: 132 LTLIDLPGITKVPVGDQPPDI 152



 Score = 69.3 bits (162), Expect = 1e-11
 Identities = 29/36 (80%), Positives = 34/36 (94%)
 Frame = +3

Query: 510 QKDIDGRKDIAAALAAERKFFLSHPSYRHLADRLGT 617
           QKDIDG+KDI AA+ AERKFFLSHP+YRH+ADR+GT
Sbjct: 239 QKDIDGKKDIKAAMLAERKFFLSHPAYRHIADRMGT 274


>AL512843-1|CAH71039.1|  555|Homo sapiens dynamin 3 protein.
          Length = 555

 Score =  161 bits (392), Expect = 1e-39
 Identities = 78/88 (88%), Positives = 83/88 (94%)
 Frame = +1

Query: 259 QIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT 438
           QI+ MI QFI RE+CLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT
Sbjct: 155 QIREMIMQFITRENCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT 214

Query: 439 DARDVLENKLLPLRRGYIGVVNRCRKTL 522
           DARDVLENKLLPLRRGY+GVVNR +K +
Sbjct: 215 DARDVLENKLLPLRRGYVGVVNRSQKDI 242



 Score =  146 bits (355), Expect = 4e-35
 Identities = 67/81 (82%), Positives = 73/81 (90%)
 Frame = +2

Query: 11  QLINGNTEYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLN 190
           QL+    EYAEFLHCKGKKFTDF+EVR EIEAETDRVTG NKGIS +PINLRVYSP+VLN
Sbjct: 72  QLVTSKAEYAEFLHCKGKKFTDFDEVRLEIEAETDRVTGMNKGISSIPINLRVYSPHVLN 131

Query: 191 LTLIDLPGLTKVPIGDQPIDI 253
           LTLIDLPG+TKVP+GDQP DI
Sbjct: 132 LTLIDLPGITKVPVGDQPPDI 152



 Score = 69.3 bits (162), Expect = 1e-11
 Identities = 29/36 (80%), Positives = 34/36 (94%)
 Frame = +3

Query: 510 QKDIDGRKDIAAALAAERKFFLSHPSYRHLADRLGT 617
           QKDIDG+KDI AA+ AERKFFLSHP+YRH+ADR+GT
Sbjct: 239 QKDIDGKKDIKAAMLAERKFFLSHPAYRHIADRMGT 274


>AL445990-2|CAH69969.1|  859|Homo sapiens dynamin 3 protein.
          Length = 859

 Score =  161 bits (392), Expect = 1e-39
 Identities = 78/88 (88%), Positives = 83/88 (94%)
 Frame = +1

Query: 259 QIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT 438
           QI+ MI QFI RE+CLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT
Sbjct: 155 QIREMIMQFITRENCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT 214

Query: 439 DARDVLENKLLPLRRGYIGVVNRCRKTL 522
           DARDVLENKLLPLRRGY+GVVNR +K +
Sbjct: 215 DARDVLENKLLPLRRGYVGVVNRSQKDI 242



 Score =  146 bits (355), Expect = 4e-35
 Identities = 67/81 (82%), Positives = 73/81 (90%)
 Frame = +2

Query: 11  QLINGNTEYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLN 190
           QL+    EYAEFLHCKGKKFTDF+EVR EIEAETDRVTG NKGIS +PINLRVYSP+VLN
Sbjct: 72  QLVTSKAEYAEFLHCKGKKFTDFDEVRLEIEAETDRVTGMNKGISSIPINLRVYSPHVLN 131

Query: 191 LTLIDLPGLTKVPIGDQPIDI 253
           LTLIDLPG+TKVP+GDQP DI
Sbjct: 132 LTLIDLPGITKVPVGDQPPDI 152



 Score = 69.3 bits (162), Expect = 1e-11
 Identities = 29/36 (80%), Positives = 34/36 (94%)
 Frame = +3

Query: 510 QKDIDGRKDIAAALAAERKFFLSHPSYRHLADRLGT 617
           QKDIDG+KDI AA+ AERKFFLSHP+YRH+ADR+GT
Sbjct: 239 QKDIDGKKDIKAAMLAERKFFLSHPAYRHIADRMGT 274


>AL445990-1|CAH69970.1|  869|Homo sapiens dynamin 3 protein.
          Length = 869

 Score =  161 bits (392), Expect = 1e-39
 Identities = 78/88 (88%), Positives = 83/88 (94%)
 Frame = +1

Query: 259 QIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT 438
           QI+ MI QFI RE+CLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT
Sbjct: 155 QIREMIMQFITRENCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT 214

Query: 439 DARDVLENKLLPLRRGYIGVVNRCRKTL 522
           DARDVLENKLLPLRRGY+GVVNR +K +
Sbjct: 215 DARDVLENKLLPLRRGYVGVVNRSQKDI 242



 Score =  146 bits (355), Expect = 4e-35
 Identities = 67/81 (82%), Positives = 73/81 (90%)
 Frame = +2

Query: 11  QLINGNTEYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLN 190
           QL+    EYAEFLHCKGKKFTDF+EVR EIEAETDRVTG NKGIS +PINLRVYSP+VLN
Sbjct: 72  QLVTSKAEYAEFLHCKGKKFTDFDEVRLEIEAETDRVTGMNKGISSIPINLRVYSPHVLN 131

Query: 191 LTLIDLPGLTKVPIGDQPIDI 253
           LTLIDLPG+TKVP+GDQP DI
Sbjct: 132 LTLIDLPGITKVPVGDQPPDI 152



 Score = 69.3 bits (162), Expect = 1e-11
 Identities = 29/36 (80%), Positives = 34/36 (94%)
 Frame = +3

Query: 510 QKDIDGRKDIAAALAAERKFFLSHPSYRHLADRLGT 617
           QKDIDG+KDI AA+ AERKFFLSHP+YRH+ADR+GT
Sbjct: 239 QKDIDGKKDIKAAMLAERKFFLSHPAYRHIADRMGT 274


>AL137157-3|CAI19211.1|  859|Homo sapiens dynamin 3 protein.
          Length = 859

 Score =  161 bits (392), Expect = 1e-39
 Identities = 78/88 (88%), Positives = 83/88 (94%)
 Frame = +1

Query: 259 QIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT 438
           QI+ MI QFI RE+CLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT
Sbjct: 155 QIREMIMQFITRENCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT 214

Query: 439 DARDVLENKLLPLRRGYIGVVNRCRKTL 522
           DARDVLENKLLPLRRGY+GVVNR +K +
Sbjct: 215 DARDVLENKLLPLRRGYVGVVNRSQKDI 242



 Score =  146 bits (355), Expect = 4e-35
 Identities = 67/81 (82%), Positives = 73/81 (90%)
 Frame = +2

Query: 11  QLINGNTEYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLN 190
           QL+    EYAEFLHCKGKKFTDF+EVR EIEAETDRVTG NKGIS +PINLRVYSP+VLN
Sbjct: 72  QLVTSKAEYAEFLHCKGKKFTDFDEVRLEIEAETDRVTGMNKGISSIPINLRVYSPHVLN 131

Query: 191 LTLIDLPGLTKVPIGDQPIDI 253
           LTLIDLPG+TKVP+GDQP DI
Sbjct: 132 LTLIDLPGITKVPVGDQPPDI 152



 Score = 69.3 bits (162), Expect = 1e-11
 Identities = 29/36 (80%), Positives = 34/36 (94%)
 Frame = +3

Query: 510 QKDIDGRKDIAAALAAERKFFLSHPSYRHLADRLGT 617
           QKDIDG+KDI AA+ AERKFFLSHP+YRH+ADR+GT
Sbjct: 239 QKDIDGKKDIKAAMLAERKFFLSHPAYRHIADRMGT 274


>AL137157-2|CAI19212.1|  869|Homo sapiens dynamin 3 protein.
          Length = 869

 Score =  161 bits (392), Expect = 1e-39
 Identities = 78/88 (88%), Positives = 83/88 (94%)
 Frame = +1

Query: 259 QIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT 438
           QI+ MI QFI RE+CLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT
Sbjct: 155 QIREMIMQFITRENCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT 214

Query: 439 DARDVLENKLLPLRRGYIGVVNRCRKTL 522
           DARDVLENKLLPLRRGY+GVVNR +K +
Sbjct: 215 DARDVLENKLLPLRRGYVGVVNRSQKDI 242



 Score =  146 bits (355), Expect = 4e-35
 Identities = 67/81 (82%), Positives = 73/81 (90%)
 Frame = +2

Query: 11  QLINGNTEYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLN 190
           QL+    EYAEFLHCKGKKFTDF+EVR EIEAETDRVTG NKGIS +PINLRVYSP+VLN
Sbjct: 72  QLVTSKAEYAEFLHCKGKKFTDFDEVRLEIEAETDRVTGMNKGISSIPINLRVYSPHVLN 131

Query: 191 LTLIDLPGLTKVPIGDQPIDI 253
           LTLIDLPG+TKVP+GDQP DI
Sbjct: 132 LTLIDLPGITKVPVGDQPPDI 152



 Score = 69.3 bits (162), Expect = 1e-11
 Identities = 29/36 (80%), Positives = 34/36 (94%)
 Frame = +3

Query: 510 QKDIDGRKDIAAALAAERKFFLSHPSYRHLADRLGT 617
           QKDIDG+KDI AA+ AERKFFLSHP+YRH+ADR+GT
Sbjct: 239 QKDIDGKKDIKAAMLAERKFFLSHPAYRHIADRMGT 274


>AL137157-1|CAI19210.1|  555|Homo sapiens dynamin 3 protein.
          Length = 555

 Score =  161 bits (392), Expect = 1e-39
 Identities = 78/88 (88%), Positives = 83/88 (94%)
 Frame = +1

Query: 259 QIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT 438
           QI+ MI QFI RE+CLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT
Sbjct: 155 QIREMIMQFITRENCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT 214

Query: 439 DARDVLENKLLPLRRGYIGVVNRCRKTL 522
           DARDVLENKLLPLRRGY+GVVNR +K +
Sbjct: 215 DARDVLENKLLPLRRGYVGVVNRSQKDI 242



 Score =  146 bits (355), Expect = 4e-35
 Identities = 67/81 (82%), Positives = 73/81 (90%)
 Frame = +2

Query: 11  QLINGNTEYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLN 190
           QL+    EYAEFLHCKGKKFTDF+EVR EIEAETDRVTG NKGIS +PINLRVYSP+VLN
Sbjct: 72  QLVTSKAEYAEFLHCKGKKFTDFDEVRLEIEAETDRVTGMNKGISSIPINLRVYSPHVLN 131

Query: 191 LTLIDLPGLTKVPIGDQPIDI 253
           LTLIDLPG+TKVP+GDQP DI
Sbjct: 132 LTLIDLPGITKVPVGDQPPDI 152



 Score = 69.3 bits (162), Expect = 1e-11
 Identities = 29/36 (80%), Positives = 34/36 (94%)
 Frame = +3

Query: 510 QKDIDGRKDIAAALAAERKFFLSHPSYRHLADRLGT 617
           QKDIDG+KDI AA+ AERKFFLSHP+YRH+ADR+GT
Sbjct: 239 QKDIDGKKDIKAAMLAERKFFLSHPAYRHIADRMGT 274


>AL133514-2|CAH74079.1|  859|Homo sapiens dynamin 3 protein.
          Length = 859

 Score =  161 bits (392), Expect = 1e-39
 Identities = 78/88 (88%), Positives = 83/88 (94%)
 Frame = +1

Query: 259 QIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT 438
           QI+ MI QFI RE+CLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT
Sbjct: 155 QIREMIMQFITRENCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT 214

Query: 439 DARDVLENKLLPLRRGYIGVVNRCRKTL 522
           DARDVLENKLLPLRRGY+GVVNR +K +
Sbjct: 215 DARDVLENKLLPLRRGYVGVVNRSQKDI 242



 Score =  146 bits (355), Expect = 4e-35
 Identities = 67/81 (82%), Positives = 73/81 (90%)
 Frame = +2

Query: 11  QLINGNTEYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLN 190
           QL+    EYAEFLHCKGKKFTDF+EVR EIEAETDRVTG NKGIS +PINLRVYSP+VLN
Sbjct: 72  QLVTSKAEYAEFLHCKGKKFTDFDEVRLEIEAETDRVTGMNKGISSIPINLRVYSPHVLN 131

Query: 191 LTLIDLPGLTKVPIGDQPIDI 253
           LTLIDLPG+TKVP+GDQP DI
Sbjct: 132 LTLIDLPGITKVPVGDQPPDI 152



 Score = 69.3 bits (162), Expect = 1e-11
 Identities = 29/36 (80%), Positives = 34/36 (94%)
 Frame = +3

Query: 510 QKDIDGRKDIAAALAAERKFFLSHPSYRHLADRLGT 617
           QKDIDG+KDI AA+ AERKFFLSHP+YRH+ADR+GT
Sbjct: 239 QKDIDGKKDIKAAMLAERKFFLSHPAYRHIADRMGT 274


>AL133514-1|CAH74080.1|  869|Homo sapiens dynamin 3 protein.
          Length = 869

 Score =  161 bits (392), Expect = 1e-39
 Identities = 78/88 (88%), Positives = 83/88 (94%)
 Frame = +1

Query: 259 QIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT 438
           QI+ MI QFI RE+CLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT
Sbjct: 155 QIREMIMQFITRENCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT 214

Query: 439 DARDVLENKLLPLRRGYIGVVNRCRKTL 522
           DARDVLENKLLPLRRGY+GVVNR +K +
Sbjct: 215 DARDVLENKLLPLRRGYVGVVNRSQKDI 242



 Score =  146 bits (355), Expect = 4e-35
 Identities = 67/81 (82%), Positives = 73/81 (90%)
 Frame = +2

Query: 11  QLINGNTEYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLN 190
           QL+    EYAEFLHCKGKKFTDF+EVR EIEAETDRVTG NKGIS +PINLRVYSP+VLN
Sbjct: 72  QLVTSKAEYAEFLHCKGKKFTDFDEVRLEIEAETDRVTGMNKGISSIPINLRVYSPHVLN 131

Query: 191 LTLIDLPGLTKVPIGDQPIDI 253
           LTLIDLPG+TKVP+GDQP DI
Sbjct: 132 LTLIDLPGITKVPVGDQPPDI 152



 Score = 69.3 bits (162), Expect = 1e-11
 Identities = 29/36 (80%), Positives = 34/36 (94%)
 Frame = +3

Query: 510 QKDIDGRKDIAAALAAERKFFLSHPSYRHLADRLGT 617
           QKDIDG+KDI AA+ AERKFFLSHP+YRH+ADR+GT
Sbjct: 239 QKDIDGKKDIKAAMLAERKFFLSHPAYRHIADRMGT 274


>AL121984-3|CAH71952.1|  859|Homo sapiens dynamin 3 protein.
          Length = 859

 Score =  161 bits (392), Expect = 1e-39
 Identities = 78/88 (88%), Positives = 83/88 (94%)
 Frame = +1

Query: 259 QIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT 438
           QI+ MI QFI RE+CLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT
Sbjct: 155 QIREMIMQFITRENCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT 214

Query: 439 DARDVLENKLLPLRRGYIGVVNRCRKTL 522
           DARDVLENKLLPLRRGY+GVVNR +K +
Sbjct: 215 DARDVLENKLLPLRRGYVGVVNRSQKDI 242



 Score =  146 bits (355), Expect = 4e-35
 Identities = 67/81 (82%), Positives = 73/81 (90%)
 Frame = +2

Query: 11  QLINGNTEYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLN 190
           QL+    EYAEFLHCKGKKFTDF+EVR EIEAETDRVTG NKGIS +PINLRVYSP+VLN
Sbjct: 72  QLVTSKAEYAEFLHCKGKKFTDFDEVRLEIEAETDRVTGMNKGISSIPINLRVYSPHVLN 131

Query: 191 LTLIDLPGLTKVPIGDQPIDI 253
           LTLIDLPG+TKVP+GDQP DI
Sbjct: 132 LTLIDLPGITKVPVGDQPPDI 152



 Score = 69.3 bits (162), Expect = 1e-11
 Identities = 29/36 (80%), Positives = 34/36 (94%)
 Frame = +3

Query: 510 QKDIDGRKDIAAALAAERKFFLSHPSYRHLADRLGT 617
           QKDIDG+KDI AA+ AERKFFLSHP+YRH+ADR+GT
Sbjct: 239 QKDIDGKKDIKAAMLAERKFFLSHPAYRHIADRMGT 274


>AL121984-2|CAH71951.1|  869|Homo sapiens dynamin 3 protein.
          Length = 869

 Score =  161 bits (392), Expect = 1e-39
 Identities = 78/88 (88%), Positives = 83/88 (94%)
 Frame = +1

Query: 259 QIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT 438
           QI+ MI QFI RE+CLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT
Sbjct: 155 QIREMIMQFITRENCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT 214

Query: 439 DARDVLENKLLPLRRGYIGVVNRCRKTL 522
           DARDVLENKLLPLRRGY+GVVNR +K +
Sbjct: 215 DARDVLENKLLPLRRGYVGVVNRSQKDI 242



 Score =  146 bits (355), Expect = 4e-35
 Identities = 67/81 (82%), Positives = 73/81 (90%)
 Frame = +2

Query: 11  QLINGNTEYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLN 190
           QL+    EYAEFLHCKGKKFTDF+EVR EIEAETDRVTG NKGIS +PINLRVYSP+VLN
Sbjct: 72  QLVTSKAEYAEFLHCKGKKFTDFDEVRLEIEAETDRVTGMNKGISSIPINLRVYSPHVLN 131

Query: 191 LTLIDLPGLTKVPIGDQPIDI 253
           LTLIDLPG+TKVP+GDQP DI
Sbjct: 132 LTLIDLPGITKVPVGDQPPDI 152



 Score = 69.3 bits (162), Expect = 1e-11
 Identities = 29/36 (80%), Positives = 34/36 (94%)
 Frame = +3

Query: 510 QKDIDGRKDIAAALAAERKFFLSHPSYRHLADRLGT 617
           QKDIDG+KDI AA+ AERKFFLSHP+YRH+ADR+GT
Sbjct: 239 QKDIDGKKDIKAAMLAERKFFLSHPAYRHIADRMGT 274


>AL121984-1|CAH71950.1|  555|Homo sapiens dynamin 3 protein.
          Length = 555

 Score =  161 bits (392), Expect = 1e-39
 Identities = 78/88 (88%), Positives = 83/88 (94%)
 Frame = +1

Query: 259 QIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT 438
           QI+ MI QFI RE+CLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT
Sbjct: 155 QIREMIMQFITRENCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT 214

Query: 439 DARDVLENKLLPLRRGYIGVVNRCRKTL 522
           DARDVLENKLLPLRRGY+GVVNR +K +
Sbjct: 215 DARDVLENKLLPLRRGYVGVVNRSQKDI 242



 Score =  146 bits (355), Expect = 4e-35
 Identities = 67/81 (82%), Positives = 73/81 (90%)
 Frame = +2

Query: 11  QLINGNTEYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLN 190
           QL+    EYAEFLHCKGKKFTDF+EVR EIEAETDRVTG NKGIS +PINLRVYSP+VLN
Sbjct: 72  QLVTSKAEYAEFLHCKGKKFTDFDEVRLEIEAETDRVTGMNKGISSIPINLRVYSPHVLN 131

Query: 191 LTLIDLPGLTKVPIGDQPIDI 253
           LTLIDLPG+TKVP+GDQP DI
Sbjct: 132 LTLIDLPGITKVPVGDQPPDI 152



 Score = 69.3 bits (162), Expect = 1e-11
 Identities = 29/36 (80%), Positives = 34/36 (94%)
 Frame = +3

Query: 510 QKDIDGRKDIAAALAAERKFFLSHPSYRHLADRLGT 617
           QKDIDG+KDI AA+ AERKFFLSHP+YRH+ADR+GT
Sbjct: 239 QKDIDGKKDIKAAMLAERKFFLSHPAYRHIADRMGT 274


>AL031864-9|CAI22007.1|  859|Homo sapiens dynamin 3 protein.
          Length = 859

 Score =  161 bits (392), Expect = 1e-39
 Identities = 78/88 (88%), Positives = 83/88 (94%)
 Frame = +1

Query: 259 QIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT 438
           QI+ MI QFI RE+CLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT
Sbjct: 155 QIREMIMQFITRENCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT 214

Query: 439 DARDVLENKLLPLRRGYIGVVNRCRKTL 522
           DARDVLENKLLPLRRGY+GVVNR +K +
Sbjct: 215 DARDVLENKLLPLRRGYVGVVNRSQKDI 242



 Score =  146 bits (355), Expect = 4e-35
 Identities = 67/81 (82%), Positives = 73/81 (90%)
 Frame = +2

Query: 11  QLINGNTEYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLN 190
           QL+    EYAEFLHCKGKKFTDF+EVR EIEAETDRVTG NKGIS +PINLRVYSP+VLN
Sbjct: 72  QLVTSKAEYAEFLHCKGKKFTDFDEVRLEIEAETDRVTGMNKGISSIPINLRVYSPHVLN 131

Query: 191 LTLIDLPGLTKVPIGDQPIDI 253
           LTLIDLPG+TKVP+GDQP DI
Sbjct: 132 LTLIDLPGITKVPVGDQPPDI 152



 Score = 69.3 bits (162), Expect = 1e-11
 Identities = 29/36 (80%), Positives = 34/36 (94%)
 Frame = +3

Query: 510 QKDIDGRKDIAAALAAERKFFLSHPSYRHLADRLGT 617
           QKDIDG+KDI AA+ AERKFFLSHP+YRH+ADR+GT
Sbjct: 239 QKDIDGKKDIKAAMLAERKFFLSHPAYRHIADRMGT 274


>AL031864-8|CAI22008.1|  869|Homo sapiens dynamin 3 protein.
          Length = 869

 Score =  161 bits (392), Expect = 1e-39
 Identities = 78/88 (88%), Positives = 83/88 (94%)
 Frame = +1

Query: 259 QIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT 438
           QI+ MI QFI RE+CLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT
Sbjct: 155 QIREMIMQFITRENCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT 214

Query: 439 DARDVLENKLLPLRRGYIGVVNRCRKTL 522
           DARDVLENKLLPLRRGY+GVVNR +K +
Sbjct: 215 DARDVLENKLLPLRRGYVGVVNRSQKDI 242



 Score =  146 bits (355), Expect = 4e-35
 Identities = 67/81 (82%), Positives = 73/81 (90%)
 Frame = +2

Query: 11  QLINGNTEYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLN 190
           QL+    EYAEFLHCKGKKFTDF+EVR EIEAETDRVTG NKGIS +PINLRVYSP+VLN
Sbjct: 72  QLVTSKAEYAEFLHCKGKKFTDFDEVRLEIEAETDRVTGMNKGISSIPINLRVYSPHVLN 131

Query: 191 LTLIDLPGLTKVPIGDQPIDI 253
           LTLIDLPG+TKVP+GDQP DI
Sbjct: 132 LTLIDLPGITKVPVGDQPPDI 152



 Score = 69.3 bits (162), Expect = 1e-11
 Identities = 29/36 (80%), Positives = 34/36 (94%)
 Frame = +3

Query: 510 QKDIDGRKDIAAALAAERKFFLSHPSYRHLADRLGT 617
           QKDIDG+KDI AA+ AERKFFLSHP+YRH+ADR+GT
Sbjct: 239 QKDIDGKKDIKAAMLAERKFFLSHPAYRHIADRMGT 274


>AL031864-7|CAI22006.1|  555|Homo sapiens dynamin 3 protein.
          Length = 555

 Score =  161 bits (392), Expect = 1e-39
 Identities = 78/88 (88%), Positives = 83/88 (94%)
 Frame = +1

Query: 259 QIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT 438
           QI+ MI QFI RE+CLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT
Sbjct: 155 QIREMIMQFITRENCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT 214

Query: 439 DARDVLENKLLPLRRGYIGVVNRCRKTL 522
           DARDVLENKLLPLRRGY+GVVNR +K +
Sbjct: 215 DARDVLENKLLPLRRGYVGVVNRSQKDI 242



 Score =  146 bits (355), Expect = 4e-35
 Identities = 67/81 (82%), Positives = 73/81 (90%)
 Frame = +2

Query: 11  QLINGNTEYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLN 190
           QL+    EYAEFLHCKGKKFTDF+EVR EIEAETDRVTG NKGIS +PINLRVYSP+VLN
Sbjct: 72  QLVTSKAEYAEFLHCKGKKFTDFDEVRLEIEAETDRVTGMNKGISSIPINLRVYSPHVLN 131

Query: 191 LTLIDLPGLTKVPIGDQPIDI 253
           LTLIDLPG+TKVP+GDQP DI
Sbjct: 132 LTLIDLPGITKVPVGDQPPDI 152



 Score = 69.3 bits (162), Expect = 1e-11
 Identities = 29/36 (80%), Positives = 34/36 (94%)
 Frame = +3

Query: 510 QKDIDGRKDIAAALAAERKFFLSHPSYRHLADRLGT 617
           QKDIDG+KDI AA+ AERKFFLSHP+YRH+ADR+GT
Sbjct: 239 QKDIDGKKDIKAAMLAERKFFLSHPAYRHIADRMGT 274


>AB020627-1|BAA74843.2|  892|Homo sapiens KIAA0820 protein protein.
          Length = 892

 Score =  161 bits (392), Expect = 1e-39
 Identities = 78/88 (88%), Positives = 83/88 (94%)
 Frame = +1

Query: 259 QIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT 438
           QI+ MI QFI RE+CLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT
Sbjct: 188 QIREMIMQFITRENCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT 247

Query: 439 DARDVLENKLLPLRRGYIGVVNRCRKTL 522
           DARDVLENKLLPLRRGY+GVVNR +K +
Sbjct: 248 DARDVLENKLLPLRRGYVGVVNRSQKDI 275



 Score =  146 bits (355), Expect = 4e-35
 Identities = 67/81 (82%), Positives = 73/81 (90%)
 Frame = +2

Query: 11  QLINGNTEYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLN 190
           QL+    EYAEFLHCKGKKFTDF+EVR EIEAETDRVTG NKGIS +PINLRVYSP+VLN
Sbjct: 105 QLVTSKAEYAEFLHCKGKKFTDFDEVRLEIEAETDRVTGMNKGISSIPINLRVYSPHVLN 164

Query: 191 LTLIDLPGLTKVPIGDQPIDI 253
           LTLIDLPG+TKVP+GDQP DI
Sbjct: 165 LTLIDLPGITKVPVGDQPPDI 185



 Score = 69.3 bits (162), Expect = 1e-11
 Identities = 29/36 (80%), Positives = 34/36 (94%)
 Frame = +3

Query: 510 QKDIDGRKDIAAALAAERKFFLSHPSYRHLADRLGT 617
           QKDIDG+KDI AA+ AERKFFLSHP+YRH+ADR+GT
Sbjct: 272 QKDIDGKKDIKAAMLAERKFFLSHPAYRHIADRMGT 307


>BC054501-1|AAH54501.1|  866|Homo sapiens dynamin 2 protein.
          Length = 866

 Score =  158 bits (384), Expect = 1e-38
 Identities = 79/88 (89%), Positives = 81/88 (92%)
 Frame = +1

Query: 259 QIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT 438
           QIK MI QFI RES LILAVTPAN DLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT
Sbjct: 155 QIKDMILQFISRESSLILAVTPANMDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT 214

Query: 439 DARDVLENKLLPLRRGYIGVVNRCRKTL 522
           DARDVLENKLLPLRRGYIGVVNR +K +
Sbjct: 215 DARDVLENKLLPLRRGYIGVVNRSQKDI 242



 Score =  149 bits (360), Expect = 1e-35
 Identities = 69/81 (85%), Positives = 75/81 (92%)
 Frame = +2

Query: 11  QLINGNTEYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLN 190
           QLI   TE+AEFLHCK KKFTDF+EVR EIEAETDRVTG+NKGISPVPINLRVYSP+VLN
Sbjct: 72  QLIFSKTEHAEFLHCKSKKFTDFDEVRQEIEAETDRVTGTNKGISPVPINLRVYSPHVLN 131

Query: 191 LTLIDLPGLTKVPIGDQPIDI 253
           LTLIDLPG+TKVP+GDQP DI
Sbjct: 132 LTLIDLPGITKVPVGDQPPDI 152



 Score = 70.5 bits (165), Expect = 5e-12
 Identities = 30/36 (83%), Positives = 35/36 (97%)
 Frame = +3

Query: 510 QKDIDGRKDIAAALAAERKFFLSHPSYRHLADRLGT 617
           QKDI+G+KDI AALAAERKFFLSHP+YRH+ADR+GT
Sbjct: 239 QKDIEGKKDIRAALAAERKFFLSHPAYRHMADRMGT 274


>BC039596-1|AAH39596.1|  870|Homo sapiens dynamin 2 protein.
          Length = 870

 Score =  158 bits (384), Expect = 1e-38
 Identities = 79/88 (89%), Positives = 81/88 (92%)
 Frame = +1

Query: 259 QIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT 438
           QIK MI QFI RES LILAVTPAN DLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT
Sbjct: 155 QIKDMILQFISRESSLILAVTPANMDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT 214

Query: 439 DARDVLENKLLPLRRGYIGVVNRCRKTL 522
           DARDVLENKLLPLRRGYIGVVNR +K +
Sbjct: 215 DARDVLENKLLPLRRGYIGVVNRSQKDI 242



 Score =  149 bits (360), Expect = 1e-35
 Identities = 69/81 (85%), Positives = 75/81 (92%)
 Frame = +2

Query: 11  QLINGNTEYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLN 190
           QLI   TE+AEFLHCK KKFTDF+EVR EIEAETDRVTG+NKGISPVPINLRVYSP+VLN
Sbjct: 72  QLIFSKTEHAEFLHCKSKKFTDFDEVRQEIEAETDRVTGTNKGISPVPINLRVYSPHVLN 131

Query: 191 LTLIDLPGLTKVPIGDQPIDI 253
           LTLIDLPG+TKVP+GDQP DI
Sbjct: 132 LTLIDLPGITKVPVGDQPPDI 152



 Score = 70.5 bits (165), Expect = 5e-12
 Identities = 30/36 (83%), Positives = 35/36 (97%)
 Frame = +3

Query: 510 QKDIDGRKDIAAALAAERKFFLSHPSYRHLADRLGT 617
           QKDI+G+KDI AALAAERKFFLSHP+YRH+ADR+GT
Sbjct: 239 QKDIEGKKDIRAALAAERKFFLSHPAYRHMADRMGT 274


>AB209213-1|BAD92450.1|  487|Homo sapiens dynamin 2 isoform 4
           variant protein.
          Length = 487

 Score =  158 bits (384), Expect = 1e-38
 Identities = 79/88 (89%), Positives = 81/88 (92%)
 Frame = +1

Query: 259 QIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT 438
           QIK MI QFI RES LILAVTPAN DLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT
Sbjct: 144 QIKDMILQFISRESSLILAVTPANMDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT 203

Query: 439 DARDVLENKLLPLRRGYIGVVNRCRKTL 522
           DARDVLENKLLPLRRGYIGVVNR +K +
Sbjct: 204 DARDVLENKLLPLRRGYIGVVNRSQKDI 231



 Score =  149 bits (360), Expect = 1e-35
 Identities = 69/81 (85%), Positives = 75/81 (92%)
 Frame = +2

Query: 11  QLINGNTEYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLN 190
           QLI   TE+AEFLHCK KKFTDF+EVR EIEAETDRVTG+NKGISPVPINLRVYSP+VLN
Sbjct: 61  QLIFSKTEHAEFLHCKSKKFTDFDEVRQEIEAETDRVTGTNKGISPVPINLRVYSPHVLN 120

Query: 191 LTLIDLPGLTKVPIGDQPIDI 253
           LTLIDLPG+TKVP+GDQP DI
Sbjct: 121 LTLIDLPGITKVPVGDQPPDI 141



 Score = 70.5 bits (165), Expect = 5e-12
 Identities = 30/36 (83%), Positives = 35/36 (97%)
 Frame = +3

Query: 510 QKDIDGRKDIAAALAAERKFFLSHPSYRHLADRLGT 617
           QKDI+G+KDI AALAAERKFFLSHP+YRH+ADR+GT
Sbjct: 228 QKDIEGKKDIRAALAAERKFFLSHPAYRHMADRMGT 263


>L36983-1|AAA88025.1|  866|Homo sapiens dynamin protein.
          Length = 866

 Score =  156 bits (379), Expect = 5e-38
 Identities = 77/88 (87%), Positives = 81/88 (92%)
 Frame = +1

Query: 259 QIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT 438
           ++K MI QFI RES LILAVTPAN DLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT
Sbjct: 155 RVKDMILQFISRESSLILAVTPANMDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT 214

Query: 439 DARDVLENKLLPLRRGYIGVVNRCRKTL 522
           DARDVLENKLLPLRRGYIGVVNR +K +
Sbjct: 215 DARDVLENKLLPLRRGYIGVVNRSQKDI 242



 Score =  149 bits (360), Expect = 1e-35
 Identities = 69/81 (85%), Positives = 75/81 (92%)
 Frame = +2

Query: 11  QLINGNTEYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLN 190
           QLI   TE+AEFLHCK KKFTDF+EVR EIEAETDRVTG+NKGISPVPINLRVYSP+VLN
Sbjct: 72  QLIFSKTEHAEFLHCKSKKFTDFDEVRQEIEAETDRVTGTNKGISPVPINLRVYSPHVLN 131

Query: 191 LTLIDLPGLTKVPIGDQPIDI 253
           LTLIDLPG+TKVP+GDQP DI
Sbjct: 132 LTLIDLPGITKVPVGDQPPDI 152



 Score = 70.5 bits (165), Expect = 5e-12
 Identities = 30/36 (83%), Positives = 35/36 (97%)
 Frame = +3

Query: 510 QKDIDGRKDIAAALAAERKFFLSHPSYRHLADRLGT 617
           QKDI+G+KDI AALAAERKFFLSHP+YRH+ADR+GT
Sbjct: 239 QKDIEGKKDIRAALAAERKFFLSHPAYRHMADRMGT 274


>L07807-1|AAA02803.1|  864|Homo sapiens dynamin protein.
          Length = 864

 Score =  155 bits (375), Expect = 2e-37
 Identities = 70/81 (86%), Positives = 76/81 (93%)
 Frame = +2

Query: 11  QLINGNTEYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLN 190
           QL+N  TEYAEFLHCKGKKFTDF EVR EIEAETDRVTG+NKGISPVPINLRVYSP+VLN
Sbjct: 72  QLVNATTEYAEFLHCKGKKFTDFEEVRLEIEAETDRVTGTNKGISPVPINLRVYSPHVLN 131

Query: 191 LTLIDLPGLTKVPIGDQPIDI 253
           LTL+DLPG+TKVP+GDQP DI
Sbjct: 132 LTLVDLPGMTKVPVGDQPPDI 152



 Score =  153 bits (371), Expect = 5e-37
 Identities = 72/88 (81%), Positives = 82/88 (93%)
 Frame = +1

Query: 259 QIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT 438
           QI+ M+ QF+ +E+CLILAV+PAN+DLANSDALK+AKEVDPQG RTIGVITKLDLMDEGT
Sbjct: 155 QIRDMLMQFVTKENCLILAVSPANSDLANSDALKVAKEVDPQGQRTIGVITKLDLMDEGT 214

Query: 439 DARDVLENKLLPLRRGYIGVVNRCRKTL 522
           DARDVLENKLLPLRRGYIGVVNR +K +
Sbjct: 215 DARDVLENKLLPLRRGYIGVVNRSQKDI 242



 Score = 74.5 bits (175), Expect = 3e-13
 Identities = 33/36 (91%), Positives = 35/36 (97%)
 Frame = +3

Query: 510 QKDIDGRKDIAAALAAERKFFLSHPSYRHLADRLGT 617
           QKDIDG+KDI AALAAERKFFLSHPSYRHLADR+GT
Sbjct: 239 QKDIDGKKDITAALAAERKFFLSHPSYRHLADRMGT 274


>BC063850-1|AAH63850.1|  851|Homo sapiens dynamin 1 protein.
          Length = 851

 Score =  155 bits (375), Expect = 2e-37
 Identities = 70/81 (86%), Positives = 76/81 (93%)
 Frame = +2

Query: 11  QLINGNTEYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLN 190
           QL+N  TEYAEFLHCKGKKFTDF EVR EIEAETDRVTG+NKGISPVPINLRVYSP+VLN
Sbjct: 72  QLVNATTEYAEFLHCKGKKFTDFEEVRLEIEAETDRVTGTNKGISPVPINLRVYSPHVLN 131

Query: 191 LTLIDLPGLTKVPIGDQPIDI 253
           LTL+DLPG+TKVP+GDQP DI
Sbjct: 132 LTLVDLPGMTKVPVGDQPPDI 152



 Score =  153 bits (371), Expect = 5e-37
 Identities = 72/88 (81%), Positives = 82/88 (93%)
 Frame = +1

Query: 259 QIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT 438
           QI+ M+ QF+ +E+CLILAV+PAN+DLANSDALK+AKEVDPQG RTIGVITKLDLMDEGT
Sbjct: 155 QIRDMLMQFVTKENCLILAVSPANSDLANSDALKVAKEVDPQGQRTIGVITKLDLMDEGT 214

Query: 439 DARDVLENKLLPLRRGYIGVVNRCRKTL 522
           DARDVLENKLLPLRRGYIGVVNR +K +
Sbjct: 215 DARDVLENKLLPLRRGYIGVVNRSQKDI 242



 Score = 74.5 bits (175), Expect = 3e-13
 Identities = 33/36 (91%), Positives = 35/36 (97%)
 Frame = +3

Query: 510 QKDIDGRKDIAAALAAERKFFLSHPSYRHLADRLGT 617
           QKDIDG+KDI AALAAERKFFLSHPSYRHLADR+GT
Sbjct: 239 QKDIDGKKDITAALAAERKFFLSHPSYRHLADRMGT 274


>BC050279-1|AAH50279.2|  851|Homo sapiens dynamin 1 protein.
          Length = 851

 Score =  155 bits (375), Expect = 2e-37
 Identities = 70/81 (86%), Positives = 76/81 (93%)
 Frame = +2

Query: 11  QLINGNTEYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLN 190
           QL+N  TEYAEFLHCKGKKFTDF EVR EIEAETDRVTG+NKGISPVPINLRVYSP+VLN
Sbjct: 72  QLVNATTEYAEFLHCKGKKFTDFEEVRLEIEAETDRVTGTNKGISPVPINLRVYSPHVLN 131

Query: 191 LTLIDLPGLTKVPIGDQPIDI 253
           LTL+DLPG+TKVP+GDQP DI
Sbjct: 132 LTLVDLPGMTKVPVGDQPPDI 152



 Score =  151 bits (367), Expect = 2e-36
 Identities = 71/88 (80%), Positives = 82/88 (93%)
 Frame = +1

Query: 259 QIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT 438
           QI+ M+ QF+ +E+CLILAV+PAN+DLANSDAL++AKEVDPQG RTIGVITKLDLMDEGT
Sbjct: 155 QIRDMLMQFVTKENCLILAVSPANSDLANSDALEVAKEVDPQGQRTIGVITKLDLMDEGT 214

Query: 439 DARDVLENKLLPLRRGYIGVVNRCRKTL 522
           DARDVLENKLLPLRRGYIGVVNR +K +
Sbjct: 215 DARDVLENKLLPLRRGYIGVVNRSQKDI 242



 Score = 74.5 bits (175), Expect = 3e-13
 Identities = 33/36 (91%), Positives = 35/36 (97%)
 Frame = +3

Query: 510 QKDIDGRKDIAAALAAERKFFLSHPSYRHLADRLGT 617
           QKDIDG+KDI AALAAERKFFLSHPSYRHLADR+GT
Sbjct: 239 QKDIDGKKDITAALAAERKFFLSHPSYRHLADRMGT 274


>AL590708-18|CAI13837.1|  864|Homo sapiens dynamin 1 protein.
          Length = 864

 Score =  155 bits (375), Expect = 2e-37
 Identities = 70/81 (86%), Positives = 76/81 (93%)
 Frame = +2

Query: 11  QLINGNTEYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLN 190
           QL+N  TEYAEFLHCKGKKFTDF EVR EIEAETDRVTG+NKGISPVPINLRVYSP+VLN
Sbjct: 72  QLVNATTEYAEFLHCKGKKFTDFEEVRLEIEAETDRVTGTNKGISPVPINLRVYSPHVLN 131

Query: 191 LTLIDLPGLTKVPIGDQPIDI 253
           LTL+DLPG+TKVP+GDQP DI
Sbjct: 132 LTLVDLPGMTKVPVGDQPPDI 152



 Score =  153 bits (371), Expect = 5e-37
 Identities = 72/88 (81%), Positives = 82/88 (93%)
 Frame = +1

Query: 259 QIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT 438
           QI+ M+ QF+ +E+CLILAV+PAN+DLANSDALK+AKEVDPQG RTIGVITKLDLMDEGT
Sbjct: 155 QIRDMLMQFVTKENCLILAVSPANSDLANSDALKVAKEVDPQGQRTIGVITKLDLMDEGT 214

Query: 439 DARDVLENKLLPLRRGYIGVVNRCRKTL 522
           DARDVLENKLLPLRRGYIGVVNR +K +
Sbjct: 215 DARDVLENKLLPLRRGYIGVVNRSQKDI 242



 Score = 74.5 bits (175), Expect = 3e-13
 Identities = 33/36 (91%), Positives = 35/36 (97%)
 Frame = +3

Query: 510 QKDIDGRKDIAAALAAERKFFLSHPSYRHLADRLGT 617
           QKDIDG+KDI AALAAERKFFLSHPSYRHLADR+GT
Sbjct: 239 QKDIDGKKDITAALAAERKFFLSHPSYRHLADRMGT 274


>AL590708-17|CAI13839.2|  851|Homo sapiens dynamin 1 protein.
          Length = 851

 Score =  155 bits (375), Expect = 2e-37
 Identities = 70/81 (86%), Positives = 76/81 (93%)
 Frame = +2

Query: 11  QLINGNTEYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLN 190
           QL+N  TEYAEFLHCKGKKFTDF EVR EIEAETDRVTG+NKGISPVPINLRVYSP+VLN
Sbjct: 72  QLVNATTEYAEFLHCKGKKFTDFEEVRLEIEAETDRVTGTNKGISPVPINLRVYSPHVLN 131

Query: 191 LTLIDLPGLTKVPIGDQPIDI 253
           LTL+DLPG+TKVP+GDQP DI
Sbjct: 132 LTLVDLPGMTKVPVGDQPPDI 152



 Score =  153 bits (371), Expect = 5e-37
 Identities = 72/88 (81%), Positives = 82/88 (93%)
 Frame = +1

Query: 259 QIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT 438
           QI+ M+ QF+ +E+CLILAV+PAN+DLANSDALK+AKEVDPQG RTIGVITKLDLMDEGT
Sbjct: 155 QIRDMLMQFVTKENCLILAVSPANSDLANSDALKVAKEVDPQGQRTIGVITKLDLMDEGT 214

Query: 439 DARDVLENKLLPLRRGYIGVVNRCRKTL 522
           DARDVLENKLLPLRRGYIGVVNR +K +
Sbjct: 215 DARDVLENKLLPLRRGYIGVVNRSQKDI 242



 Score = 74.5 bits (175), Expect = 3e-13
 Identities = 33/36 (91%), Positives = 35/36 (97%)
 Frame = +3

Query: 510 QKDIDGRKDIAAALAAERKFFLSHPSYRHLADRLGT 617
           QKDIDG+KDI AALAAERKFFLSHPSYRHLADR+GT
Sbjct: 239 QKDIDGKKDITAALAAERKFFLSHPSYRHLADRMGT 274


>AB209124-1|BAD92361.1|  600|Homo sapiens dynamin 1 isoform 2
           variant protein.
          Length = 600

 Score =  155 bits (375), Expect = 2e-37
 Identities = 70/81 (86%), Positives = 76/81 (93%)
 Frame = +2

Query: 11  QLINGNTEYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLN 190
           QL+N  TEYAEFLHCKGKKFTDF EVR EIEAETDRVTG+NKGISPVPINLRVYSP+VLN
Sbjct: 5   QLVNATTEYAEFLHCKGKKFTDFEEVRLEIEAETDRVTGTNKGISPVPINLRVYSPHVLN 64

Query: 191 LTLIDLPGLTKVPIGDQPIDI 253
           LTL+DLPG+TKVP+GDQP DI
Sbjct: 65  LTLVDLPGMTKVPVGDQPPDI 85



 Score =  153 bits (371), Expect = 5e-37
 Identities = 72/88 (81%), Positives = 82/88 (93%)
 Frame = +1

Query: 259 QIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT 438
           QI+ M+ QF+ +E+CLILAV+PAN+DLANSDALK+AKEVDPQG RTIGVITKLDLMDEGT
Sbjct: 88  QIRDMLMQFVTKENCLILAVSPANSDLANSDALKVAKEVDPQGQRTIGVITKLDLMDEGT 147

Query: 439 DARDVLENKLLPLRRGYIGVVNRCRKTL 522
           DARDVLENKLLPLRRGYIGVVNR +K +
Sbjct: 148 DARDVLENKLLPLRRGYIGVVNRSQKDI 175



 Score = 74.5 bits (175), Expect = 3e-13
 Identities = 33/36 (91%), Positives = 35/36 (97%)
 Frame = +3

Query: 510 QKDIDGRKDIAAALAAERKFFLSHPSYRHLADRLGT 617
           QKDIDG+KDI AALAAERKFFLSHPSYRHLADR+GT
Sbjct: 172 QKDIDGKKDITAALAAERKFFLSHPSYRHLADRMGT 207


>BC107763-1|AAI07764.1|  575|Homo sapiens DNM1L protein protein.
          Length = 575

 Score =  117 bits (282), Expect = 3e-26
 Identities = 48/74 (64%), Positives = 66/74 (89%)
 Frame = +2

Query: 32  EYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTLIDLP 211
           E+ +FLH K K +TDF+E+R EIE ET+R++G+NKG+SP PI+L+++SPNV+NLTL+DLP
Sbjct: 89  EWGKFLHTKNKLYTDFDEIRQEIENETERISGNNKGVSPEPIHLKIFSPNVVNLTLVDLP 148

Query: 212 GLTKVPIGDQPIDI 253
           G+TKVP+GDQP DI
Sbjct: 149 GMTKVPVGDQPKDI 162



 Score =  108 bits (259), Expect = 2e-23
 Identities = 51/83 (61%), Positives = 66/83 (79%)
 Frame = +1

Query: 259 QIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT 438
           QI+ +I +FI   + +ILAVT ANTD+A S+ALK+++EVDP G RT+ VITKLDLMD GT
Sbjct: 165 QIRELILRFISNPNSIILAVTAANTDMATSEALKISREVDPDGRRTLAVITKLDLMDAGT 224

Query: 439 DARDVLENKLLPLRRGYIGVVNR 507
           DA DVL  K++P++ G IGVVNR
Sbjct: 225 DAMDVLMGKVIPVKLGIIGVVNR 247


>BC024590-1|AAH24590.1|  710|Homo sapiens dynamin 1-like protein.
          Length = 710

 Score =  117 bits (282), Expect = 3e-26
 Identities = 48/74 (64%), Positives = 66/74 (89%)
 Frame = +2

Query: 32  EYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTLIDLP 211
           E+ +FLH K K +TDF+E+R EIE ET+R++G+NKG+SP PI+L+++SPNV+NLTL+DLP
Sbjct: 89  EWGKFLHTKNKLYTDFDEIRQEIENETERISGNNKGVSPEPIHLKIFSPNVVNLTLVDLP 148

Query: 212 GLTKVPIGDQPIDI 253
           G+TKVP+GDQP DI
Sbjct: 149 GMTKVPVGDQPKDI 162



 Score =  107 bits (256), Expect = 4e-23
 Identities = 50/83 (60%), Positives = 66/83 (79%)
 Frame = +1

Query: 259 QIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT 438
           QI+ +I +FI   + +ILAVT ANTD+A S+ALK+++EVDP G RT+ VITKLDLMD GT
Sbjct: 165 QIRELILRFISNPNSIILAVTAANTDMATSEALKISREVDPDGRRTLAVITKLDLMDAGT 224

Query: 439 DARDVLENKLLPLRRGYIGVVNR 507
           DA DVL  +++P++ G IGVVNR
Sbjct: 225 DAMDVLMGRVIPVKLGIIGVVNR 247


>BC000136-1|AAH00136.1|  710|Homo sapiens Unknown (protein for
           IMAGE:2984922) protein.
          Length = 710

 Score =  117 bits (282), Expect = 3e-26
 Identities = 48/74 (64%), Positives = 66/74 (89%)
 Frame = +2

Query: 32  EYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTLIDLP 211
           E+ +FLH K K +TDF+E+R EIE ET+R++G+NKG+SP PI+L+++SPNV+NLTL+DLP
Sbjct: 63  EWGKFLHTKNKLYTDFDEIRQEIENETERISGNNKGVSPEPIHLKIFSPNVVNLTLVDLP 122

Query: 212 GLTKVPIGDQPIDI 253
           G+TKVP+GDQP DI
Sbjct: 123 GMTKVPVGDQPKDI 136



 Score =  107 bits (256), Expect = 4e-23
 Identities = 50/83 (60%), Positives = 66/83 (79%)
 Frame = +1

Query: 259 QIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT 438
           QI+ +I +FI   + +ILAVT ANTD+A S+ALK+++EVDP G RT+ VITKLDLMD GT
Sbjct: 139 QIRELILRFISNPNSIILAVTAANTDMATSEALKISREVDPDGRRTLAVITKLDLMDAGT 198

Query: 439 DARDVLENKLLPLRRGYIGVVNR 507
           DA DVL  +++P++ G IGVVNR
Sbjct: 199 DAMDVLMGRVIPVKLGIIGVVNR 221


>AF151685-1|AAD39541.1|  725|Homo sapiens dynamin-like protein
           DYNIV-11 protein.
          Length = 725

 Score =  117 bits (282), Expect = 3e-26
 Identities = 48/74 (64%), Positives = 66/74 (89%)
 Frame = +2

Query: 32  EYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTLIDLP 211
           E+ +FLH K K +TDF+E+R EIE ET+R++G+NKG+SP PI+L+++SPNV+NLTL+DLP
Sbjct: 89  EWGKFLHTKNKLYTDFDEIRQEIENETERISGNNKGVSPEPIHLKIFSPNVVNLTLVDLP 148

Query: 212 GLTKVPIGDQPIDI 253
           G+TKVP+GDQP DI
Sbjct: 149 GMTKVPVGDQPKDI 162



 Score =  107 bits (257), Expect = 3e-23
 Identities = 50/83 (60%), Positives = 66/83 (79%)
 Frame = +1

Query: 259 QIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT 438
           QI+ +I +FI   + +ILAVT ANTD+A S+ALK+++EVDP G RT+ VITKLDLMD GT
Sbjct: 165 QIRELILRFISNPNSIILAVTAANTDMATSEALKISREVDPDGCRTLAVITKLDLMDAGT 224

Query: 439 DARDVLENKLLPLRRGYIGVVNR 507
           DA DVL  +++P++ G IGVVNR
Sbjct: 225 DAMDVLMGRVIPVKLGIIGVVNR 247


>AF061795-1|AAC35283.1|  699|Homo sapiens dynamin-like protein
           Dymple isoform protein.
          Length = 699

 Score =  117 bits (282), Expect = 3e-26
 Identities = 48/74 (64%), Positives = 66/74 (89%)
 Frame = +2

Query: 32  EYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTLIDLP 211
           E+ +FLH K K +TDF+E+R EIE ET+R++G+NKG+SP PI+L+++SPNV+NLTL+DLP
Sbjct: 89  EWGKFLHTKNKLYTDFDEIRQEIENETERISGNNKGVSPEPIHLKIFSPNVVNLTLVDLP 148

Query: 212 GLTKVPIGDQPIDI 253
           G+TKVP+GDQP DI
Sbjct: 149 GMTKVPVGDQPKDI 162



 Score =  107 bits (257), Expect = 3e-23
 Identities = 50/83 (60%), Positives = 66/83 (79%)
 Frame = +1

Query: 259 QIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT 438
           QI+ +I +FI   + +ILAVT ANTD+A S+ALK+++EVDP G RT+ VITKLDLMD GT
Sbjct: 165 QIRELILRFISNPNSIILAVTAANTDMATSEALKISREVDPDGCRTLAVITKLDLMDAGT 224

Query: 439 DARDVLENKLLPLRRGYIGVVNR 507
           DA DVL  +++P++ G IGVVNR
Sbjct: 225 DAMDVLMGRVIPVKLGIIGVVNR 247


>AF000430-1|AAC23724.1|  736|Homo sapiens dynamin-like protein
           protein.
          Length = 736

 Score =  117 bits (282), Expect = 3e-26
 Identities = 48/74 (64%), Positives = 66/74 (89%)
 Frame = +2

Query: 32  EYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTLIDLP 211
           E+ +FLH K K +TDF+E+R EIE ET+R++G+NKG+SP PI+L+++SPNV+NLTL+DLP
Sbjct: 89  EWGKFLHTKNKLYTDFDEIRQEIENETERISGNNKGVSPEPIHLKIFSPNVVNLTLVDLP 148

Query: 212 GLTKVPIGDQPIDI 253
           G+TKVP+GDQP DI
Sbjct: 149 GMTKVPVGDQPKDI 162



 Score =  107 bits (256), Expect = 4e-23
 Identities = 50/83 (60%), Positives = 66/83 (79%)
 Frame = +1

Query: 259 QIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT 438
           QI+ +I +FI   + +ILAVT ANTD+A S+ALK+++EVDP G RT+ VITKLDLMD GT
Sbjct: 165 QIRELILRFISNPNSIILAVTAANTDMATSEALKISREVDPDGRRTLAVITKLDLMDAGT 224

Query: 439 DARDVLENKLLPLRRGYIGVVNR 507
           DA DVL  +++P++ G IGVVNR
Sbjct: 225 DAMDVLMGRVIPVKLGIIGVVNR 247


>AB209070-1|BAD92307.1|  751|Homo sapiens Dynamin-like protein
           DYNIV-11 variant protein.
          Length = 751

 Score =  117 bits (282), Expect = 3e-26
 Identities = 48/74 (64%), Positives = 66/74 (89%)
 Frame = +2

Query: 32  EYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTLIDLP 211
           E+ +FLH K K +TDF+E+R EIE ET+R++G+NKG+SP PI+L+++SPNV+NLTL+DLP
Sbjct: 115 EWGKFLHTKNKLYTDFDEIRQEIENETERISGNNKGVSPEPIHLKIFSPNVVNLTLVDLP 174

Query: 212 GLTKVPIGDQPIDI 253
           G+TKVP+GDQP DI
Sbjct: 175 GMTKVPVGDQPKDI 188



 Score =  107 bits (256), Expect = 4e-23
 Identities = 50/83 (60%), Positives = 66/83 (79%)
 Frame = +1

Query: 259 QIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT 438
           QI+ +I +FI   + +ILAVT ANTD+A S+ALK+++EVDP G RT+ VITKLDLMD GT
Sbjct: 191 QIRELILRFISNPNSIILAVTAANTDMATSEALKISREVDPDGRRTLAVITKLDLMDAGT 250

Query: 439 DARDVLENKLLPLRRGYIGVVNR 507
           DA DVL  +++P++ G IGVVNR
Sbjct: 251 DAMDVLMGRVIPVKLGIIGVVNR 273


>AB006965-1|BAA22193.1|  736|Homo sapiens Dnm1p/Vps1p-like protein
           protein.
          Length = 736

 Score =  117 bits (282), Expect = 3e-26
 Identities = 48/74 (64%), Positives = 66/74 (89%)
 Frame = +2

Query: 32  EYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTLIDLP 211
           E+ +FLH K K +TDF+E+R EIE ET+R++G+NKG+SP PI+L+++SPNV+NLTL+DLP
Sbjct: 89  EWGKFLHTKNKLYTDFDEIRQEIENETERISGNNKGVSPEPIHLKIFSPNVVNLTLVDLP 148

Query: 212 GLTKVPIGDQPIDI 253
           G+TKVP+GDQP DI
Sbjct: 149 GMTKVPVGDQPKDI 162



 Score =  107 bits (256), Expect = 4e-23
 Identities = 50/83 (60%), Positives = 66/83 (79%)
 Frame = +1

Query: 259 QIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT 438
           QI+ +I +FI   + +ILAVT ANTD+A S+ALK+++EVDP G RT+ VITKLDLMD GT
Sbjct: 165 QIRELILRFISNPNSIILAVTAANTDMATSEALKISREVDPDGRRTLAVITKLDLMDAGT 224

Query: 439 DARDVLENKLLPLRRGYIGVVNR 507
           DA DVL  +++P++ G IGVVNR
Sbjct: 225 DAMDVLMGRVIPVKLGIIGVVNR 247


>M33883-1|AAA36459.1|  687|Homo sapiens protein ( Human p78-related
           protein mRNA, complete cds. ).
          Length = 687

 Score = 84.6 bits (200), Expect = 3e-16
 Identities = 41/91 (45%), Positives = 63/91 (69%), Gaps = 2/91 (2%)
 Frame = +1

Query: 259 QIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT 438
           QIK +I ++I+R+  + L V P N D+A ++AL +A EVDP+G RTIG++TK DLMD GT
Sbjct: 216 QIKALIKKYIQRQQTINLVVVPCNVDIATTEALSMAHEVDPEGDRTIGILTKPDLMDRGT 275

Query: 439 D--ARDVLENKLLPLRRGYIGVVNRCRKTLT 525
           +    +V+ N   PL++GY+ V  R ++ +T
Sbjct: 276 EKSVMNVVRNLTYPLKKGYMIVKCRGQQEIT 306



 Score = 53.2 bits (122), Expect = 7e-07
 Identities = 26/60 (43%), Positives = 39/60 (65%)
 Frame = +2

Query: 74  DFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTLIDLPGLTKVPIGDQPIDI 253
           D  +V  EI    + + G+ +GIS   I+L + SP V +LT+IDLPG+T+V + +QP DI
Sbjct: 154 DPGQVEKEIHKAQNVMAGNGRGISHELISLEITSPEVPDLTIIDLPGITRVAVDNQPRDI 213


>M30818-1|AAA36338.1|  715|Homo sapiens interferon-induced Mx
           protein protein.
          Length = 715

 Score = 84.6 bits (200), Expect = 3e-16
 Identities = 41/91 (45%), Positives = 63/91 (69%), Gaps = 2/91 (2%)
 Frame = +1

Query: 259 QIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT 438
           QIK +I ++I+R+  + L V P N D+A ++AL +A EVDP+G RTIG++TK DLMD GT
Sbjct: 244 QIKALIKKYIQRQQTINLVVVPCNVDIATTEALSMAHEVDPEGDRTIGILTKPDLMDRGT 303

Query: 439 D--ARDVLENKLLPLRRGYIGVVNRCRKTLT 525
           +    +V+ N   PL++GY+ V  R ++ +T
Sbjct: 304 EKSVMNVVRNLTYPLKKGYMIVKCRGQQEIT 334



 Score = 53.2 bits (122), Expect = 7e-07
 Identities = 26/60 (43%), Positives = 39/60 (65%)
 Frame = +2

Query: 74  DFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTLIDLPGLTKVPIGDQPIDI 253
           D  +V  EI    + + G+ +GIS   I+L + SP V +LT+IDLPG+T+V + +QP DI
Sbjct: 182 DPGQVEKEIHKAQNVMAGNGRGISHELISLEITSPEVPDLTIIDLPGITRVAVDNQPRDI 241


>BC035293-1|AAH35293.1|  715|Homo sapiens myxovirus (influenza
           virus) resistance 2 (mouse) protein.
          Length = 715

 Score = 84.6 bits (200), Expect = 3e-16
 Identities = 41/91 (45%), Positives = 63/91 (69%), Gaps = 2/91 (2%)
 Frame = +1

Query: 259 QIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT 438
           QIK +I ++I+R+  + L V P N D+A ++AL +A EVDP+G RTIG++TK DLMD GT
Sbjct: 244 QIKALIKKYIQRQQTINLVVVPCNVDIATTEALSMAHEVDPEGDRTIGILTKPDLMDRGT 303

Query: 439 D--ARDVLENKLLPLRRGYIGVVNRCRKTLT 525
           +    +V+ N   PL++GY+ V  R ++ +T
Sbjct: 304 EKSVMNVVRNLTYPLKKGYMIVKCRGQQEIT 334



 Score = 53.2 bits (122), Expect = 7e-07
 Identities = 26/60 (43%), Positives = 39/60 (65%)
 Frame = +2

Query: 74  DFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTLIDLPGLTKVPIGDQPIDI 253
           D  +V  EI    + + G+ +GIS   I+L + SP V +LT+IDLPG+T+V + +QP DI
Sbjct: 182 DPGQVEKEIHKAQNVMAGNGRGISHELISLEITSPEVPDLTIIDLPGITRVAVDNQPRDI 241


>AL163285-2|CAB90555.1|  715|Homo sapiens human interferon-regulated
           resistance GTP-bindinge protein.
          Length = 715

 Score = 84.6 bits (200), Expect = 3e-16
 Identities = 41/91 (45%), Positives = 63/91 (69%), Gaps = 2/91 (2%)
 Frame = +1

Query: 259 QIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT 438
           QIK +I ++I+R+  + L V P N D+A ++AL +A EVDP+G RTIG++TK DLMD GT
Sbjct: 244 QIKALIKKYIQRQQTINLVVVPCNVDIATTEALSMAHEVDPEGDRTIGILTKPDLMDRGT 303

Query: 439 D--ARDVLENKLLPLRRGYIGVVNRCRKTLT 525
           +    +V+ N   PL++GY+ V  R ++ +T
Sbjct: 304 EKSVMNVVRNLTYPLKKGYMIVKCRGQQEIT 334



 Score = 53.2 bits (122), Expect = 7e-07
 Identities = 26/60 (43%), Positives = 39/60 (65%)
 Frame = +2

Query: 74  DFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTLIDLPGLTKVPIGDQPIDI 253
           D  +V  EI    + + G+ +GIS   I+L + SP V +LT+IDLPG+T+V + +QP DI
Sbjct: 182 DPGQVEKEIHKAQNVMAGNGRGISHELISLEITSPEVPDLTIIDLPGITRVAVDNQPRDI 241


>M33882-1|AAA36458.1|  662|Homo sapiens protein ( Human p78 protein
           mRNA, complete cds. ).
          Length = 662

 Score = 81.8 bits (193), Expect = 2e-15
 Identities = 38/87 (43%), Positives = 65/87 (74%), Gaps = 2/87 (2%)
 Frame = +1

Query: 259 QIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT 438
           +IK +I ++I+R+  + L V P+N D+A ++AL +A+EVDP+G RTIG++TK DL+D+GT
Sbjct: 197 KIKTLIKKYIQRQETISLVVVPSNVDIATTEALSMAQEVDPEGDRTIGILTKPDLVDKGT 256

Query: 439 DAR--DVLENKLLPLRRGYIGVVNRCR 513
           + +  DV+ N +  L++GY  ++ +CR
Sbjct: 257 EDKVVDVVRNLVFHLKKGY--MIVKCR 281



 Score = 57.2 bits (132), Expect = 5e-08
 Identities = 28/63 (44%), Positives = 40/63 (63%)
 Frame = +2

Query: 65  KFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTLIDLPGLTKVPIGDQP 244
           + +D +EV  EI    + + G   GIS   I L + S +V +LTLIDLPG+T+V +G+QP
Sbjct: 132 EISDASEVEKEINKAQNAIAGEGMGISHELITLEISSRDVPDLTLIDLPGITRVAVGNQP 191

Query: 245 IDI 253
            DI
Sbjct: 192 ADI 194


>M30817-1|AAA36337.1|  662|Homo sapiens interferon-induced Mx
           protein protein.
          Length = 662

 Score = 81.8 bits (193), Expect = 2e-15
 Identities = 38/87 (43%), Positives = 65/87 (74%), Gaps = 2/87 (2%)
 Frame = +1

Query: 259 QIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT 438
           +IK +I ++I+R+  + L V P+N D+A ++AL +A+EVDP+G RTIG++TK DL+D+GT
Sbjct: 197 KIKTLIKKYIQRQETISLVVVPSNVDIATTEALSMAQEVDPEGDRTIGILTKPDLVDKGT 256

Query: 439 DAR--DVLENKLLPLRRGYIGVVNRCR 513
           + +  DV+ N +  L++GY  ++ +CR
Sbjct: 257 EDKVVDVVRNLVFHLKKGY--MIVKCR 281



 Score = 54.8 bits (126), Expect = 2e-07
 Identities = 27/63 (42%), Positives = 39/63 (61%)
 Frame = +2

Query: 65  KFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTLIDLPGLTKVPIGDQP 244
           + +D +EV  EI    + + G   GIS   I   + S +V +LTLIDLPG+T+V +G+QP
Sbjct: 132 EISDASEVEKEINKAQNAIAGEGMGISHELITREISSRDVPDLTLIDLPGITRVAVGNQP 191

Query: 245 IDI 253
            DI
Sbjct: 192 ADI 194


>BC032602-1|AAH32602.1|  662|Homo sapiens myxovirus (influenza
           virus) resistance 1, interferon-inducible protein p78
           (mou protein.
          Length = 662

 Score = 81.8 bits (193), Expect = 2e-15
 Identities = 38/87 (43%), Positives = 65/87 (74%), Gaps = 2/87 (2%)
 Frame = +1

Query: 259 QIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT 438
           +IK +I ++I+R+  + L V P+N D+A ++AL +A+EVDP+G RTIG++TK DL+D+GT
Sbjct: 197 KIKTLIKKYIQRQETISLVVVPSNVDIATTEALSMAQEVDPEGDRTIGILTKPDLVDKGT 256

Query: 439 DAR--DVLENKLLPLRRGYIGVVNRCR 513
           + +  DV+ N +  L++GY  ++ +CR
Sbjct: 257 EDKVVDVVRNLVFHLKKGY--MIVKCR 281



 Score = 57.2 bits (132), Expect = 5e-08
 Identities = 28/63 (44%), Positives = 40/63 (63%)
 Frame = +2

Query: 65  KFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTLIDLPGLTKVPIGDQP 244
           + +D +EV  EI    + + G   GIS   I L + S +V +LTLIDLPG+T+V +G+QP
Sbjct: 132 EISDASEVEKEINKAQNAIAGEGMGISHELITLEISSRDVPDLTLIDLPGITRVAVGNQP 191

Query: 245 IDI 253
            DI
Sbjct: 192 ADI 194


>BC014222-1|AAH14222.2|  578|Homo sapiens MX1 protein protein.
          Length = 578

 Score = 81.8 bits (193), Expect = 2e-15
 Identities = 38/87 (43%), Positives = 65/87 (74%), Gaps = 2/87 (2%)
 Frame = +1

Query: 259 QIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT 438
           +IK +I ++I+R+  + L V P+N D+A ++AL +A+EVDP+G RTIG++TK DL+D+GT
Sbjct: 113 KIKTLIKKYIQRQETISLVVVPSNVDIATTEALSMAQEVDPEGDRTIGILTKPDLVDKGT 172

Query: 439 DAR--DVLENKLLPLRRGYIGVVNRCR 513
           + +  DV+ N +  L++GY  ++ +CR
Sbjct: 173 EDKVVDVVRNLVFHLKKGY--MIVKCR 197



 Score = 57.2 bits (132), Expect = 5e-08
 Identities = 28/63 (44%), Positives = 40/63 (63%)
 Frame = +2

Query: 65  KFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTLIDLPGLTKVPIGDQP 244
           + +D +EV  EI    + + G   GIS   I L + S +V +LTLIDLPG+T+V +G+QP
Sbjct: 48  EISDASEVEKEINKAQNAIAGEGMGISHELITLEISSRDVPDLTLIDLPGITRVAVGNQP 107

Query: 245 IDI 253
            DI
Sbjct: 108 ADI 110


>AL163285-3|CAB90556.1|  662|Homo sapiens human interferon-regulated
           resistance GTP-bindingNA 2900024C23 gene protein.
          Length = 662

 Score = 81.8 bits (193), Expect = 2e-15
 Identities = 38/87 (43%), Positives = 65/87 (74%), Gaps = 2/87 (2%)
 Frame = +1

Query: 259 QIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT 438
           +IK +I ++I+R+  + L V P+N D+A ++AL +A+EVDP+G RTIG++TK DL+D+GT
Sbjct: 197 KIKTLIKKYIQRQETISLVVVPSNVDIATTEALSMAQEVDPEGDRTIGILTKPDLVDKGT 256

Query: 439 DAR--DVLENKLLPLRRGYIGVVNRCR 513
           + +  DV+ N +  L++GY  ++ +CR
Sbjct: 257 EDKVVDVVRNLVFHLKKGY--MIVKCR 281



 Score = 57.2 bits (132), Expect = 5e-08
 Identities = 28/63 (44%), Positives = 40/63 (63%)
 Frame = +2

Query: 65  KFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTLIDLPGLTKVPIGDQP 244
           + +D +EV  EI    + + G   GIS   I L + S +V +LTLIDLPG+T+V +G+QP
Sbjct: 132 EISDASEVEKEINKAQNAIAGEGMGISHELITLEISSRDVPDLTLIDLPGITRVAVGNQP 191

Query: 245 IDI 253
            DI
Sbjct: 192 ADI 194


>AK093008-1|BAC04017.1|  662|Homo sapiens protein ( Homo sapiens
           cDNA FLJ35689 fis, clone SPLEN2019379, highly similar to
           INTERFERON-REGULATED RESISTANCE GTP-BINDING PROTEIN MXA.
           ).
          Length = 662

 Score = 81.8 bits (193), Expect = 2e-15
 Identities = 38/87 (43%), Positives = 65/87 (74%), Gaps = 2/87 (2%)
 Frame = +1

Query: 259 QIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT 438
           +IK +I ++I+R+  + L V P+N D+A ++AL +A+EVDP+G RTIG++TK DL+D+GT
Sbjct: 197 KIKTLIKKYIQRQETISLVVVPSNVDIATTEALSMAQEVDPEGDRTIGILTKPDLVDKGT 256

Query: 439 DAR--DVLENKLLPLRRGYIGVVNRCR 513
           + +  DV+ N +  L++GY  ++ +CR
Sbjct: 257 EDKVVDVVRNLVFHLKKGY--MIVKCR 281



 Score = 57.2 bits (132), Expect = 5e-08
 Identities = 28/63 (44%), Positives = 40/63 (63%)
 Frame = +2

Query: 65  KFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTLIDLPGLTKVPIGDQP 244
           + +D +EV  EI    + + G   GIS   I L + S +V +LTLIDLPG+T+V +G+QP
Sbjct: 132 EISDASEVEKEINKAQNAIAGEGMGISHELITLEISSRDVPDLTLIDLPGITRVAVGNQP 191

Query: 245 IDI 253
            DI
Sbjct: 192 ADI 194


>AF135187-1|AAD43063.1|  662|Homo sapiens interferon-induced protein
           p78 protein.
          Length = 662

 Score = 81.8 bits (193), Expect = 2e-15
 Identities = 38/87 (43%), Positives = 65/87 (74%), Gaps = 2/87 (2%)
 Frame = +1

Query: 259 QIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT 438
           +IK +I ++I+R+  + L V P+N D+A ++AL +A+EVDP+G RTIG++TK DL+D+GT
Sbjct: 197 KIKTLIKKYIQRQETISLVVVPSNVDIATTEALSMAQEVDPEGDRTIGILTKPDLVDKGT 256

Query: 439 DAR--DVLENKLLPLRRGYIGVVNRCR 513
           + +  DV+ N +  L++GY  ++ +CR
Sbjct: 257 EDKVVDVVRNLVFHLKKGY--MIVKCR 281



 Score = 57.2 bits (132), Expect = 5e-08
 Identities = 28/63 (44%), Positives = 40/63 (63%)
 Frame = +2

Query: 65  KFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTLIDLPGLTKVPIGDQP 244
           + +D +EV  EI    + + G   GIS   I L + S +V +LTLIDLPG+T+V +G+QP
Sbjct: 132 EISDASEVEKEINKAQNAIAGEGMGISHELITLEISSRDVPDLTLIDLPGITRVAVGNQP 191

Query: 245 IDI 253
            DI
Sbjct: 192 ADI 194


>AC004508-1|AAC08448.1|  262|Homo sapiens MX2 protein.
          Length = 262

 Score = 53.2 bits (122), Expect = 7e-07
 Identities = 26/60 (43%), Positives = 39/60 (65%)
 Frame = +2

Query: 74  DFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTLIDLPGLTKVPIGDQPIDI 253
           D  +V  EI    + + G+ +GIS   I+L + SP V +LT+IDLPG+T+V + +QP DI
Sbjct: 154 DPGQVEKEIHKAQNVMAGNGRGISHELISLEITSPEVPDLTIIDLPGITRVAVDNQPRDI 213



 Score = 52.4 bits (120), Expect = 1e-06
 Identities = 23/47 (48%), Positives = 34/47 (72%)
 Frame = +1

Query: 259 QIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTI 399
           QIK +I ++I+R+  + L V P N D+A ++AL +A EVDP+G RTI
Sbjct: 216 QIKALIKKYIQRQQTINLVVVPCNVDIATTEALSMAHEVDPEGDRTI 262


>BC075805-1|AAH75805.1|  960|Homo sapiens optic atrophy 1 (autosomal
           dominant) protein.
          Length = 960

 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 24/78 (30%), Positives = 43/78 (55%), Gaps = 5/78 (6%)
 Frame = +1

Query: 283 FIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDA----RD 450
           +++  + +IL +   + D   S    L  ++DP G RTI V+TK+DL ++   +    + 
Sbjct: 425 YMQNPNAIILCIQDGSVDAERSIVTDLVSQMDPHGRRTIFVLTKVDLAEKNVASPSRIQQ 484

Query: 451 VLENKLLPLRR-GYIGVV 501
           ++E KL P++  GY  VV
Sbjct: 485 IIEGKLFPMKALGYFAVV 502



 Score = 32.7 bits (71), Expect = 1.1
 Identities = 17/51 (33%), Positives = 25/51 (49%)
 Frame = +2

Query: 65  KFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTLIDLPGL 217
           K  D   +R EIE    +       +SP  I+L V  P +  + L+DLPG+
Sbjct: 352 KEEDLAALRHEIELRMRKNVKEGCTVSPETISLNVKGPGLQRMVLVDLPGV 402


>AB011139-1|BAA25493.1|  978|Homo sapiens KIAA0567 protein protein.
          Length = 978

 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 24/78 (30%), Positives = 43/78 (55%), Gaps = 5/78 (6%)
 Frame = +1

Query: 283 FIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDA----RD 450
           +++  + +IL +   + D   S    L  ++DP G RTI V+TK+DL ++   +    + 
Sbjct: 443 YMQNPNAIILCIQDGSVDAERSIVTDLVSQMDPHGRRTIFVLTKVDLAEKNVASPSRIQQ 502

Query: 451 VLENKLLPLRR-GYIGVV 501
           ++E KL P++  GY  VV
Sbjct: 503 IIEGKLFPMKALGYFAVV 520



 Score = 32.7 bits (71), Expect = 1.1
 Identities = 17/51 (33%), Positives = 25/51 (49%)
 Frame = +2

Query: 65  KFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTLIDLPGL 217
           K  D   +R EIE    +       +SP  I+L V  P +  + L+DLPG+
Sbjct: 370 KEEDLAALRHEIELRMRKNVKEGCTVSPETISLNVKGPGLQRMVLVDLPGV 420


>AC004497-1|AAC08451.1|  424|Homo sapiens MX2 protein.
          Length = 424

 Score = 33.9 bits (74), Expect = 0.49
 Identities = 17/43 (39%), Positives = 28/43 (65%), Gaps = 2/43 (4%)
 Frame = +1

Query: 403 VITKLDLMDEGTD--ARDVLENKLLPLRRGYIGVVNRCRKTLT 525
           ++TK DLMD GT+    +V+ N   PL++GY+ V  R ++ +T
Sbjct: 1   ILTKPDLMDRGTEKSVMNVVRNLTYPLKKGYMIVKCRGQQEIT 43


>AJ001057-1|CAA04507.1| 1299|Homo sapiens NrCAM protein protein.
          Length = 1299

 Score = 31.5 bits (68), Expect = 2.6
 Identities = 14/37 (37%), Positives = 24/37 (64%)
 Frame = +2

Query: 89   RGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTL 199
            +GE  A  DRV  + +G+  VP +L++ +P + +LTL
Sbjct: 929  KGEGPASPDRVFNTPEGVPSVPSSLKIVNPTLDSLTL 965


>U55258-1|AAC50765.1| 1299|Homo sapiens hBRAVO/Nr-CAM precursor
            protein.
          Length = 1299

 Score = 29.9 bits (64), Expect = 7.9
 Identities = 13/37 (35%), Positives = 23/37 (62%)
 Frame = +2

Query: 89   RGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTL 199
            +GE  A  DRV  + +G+   P +L++ +P + +LTL
Sbjct: 929  KGEGPASPDRVFNTPEGVPSAPSSLKIVNPTLDSLTL 965


>BX538010-1|CAD97960.1| 1183|Homo sapiens hypothetical protein
            protein.
          Length = 1183

 Score = 29.9 bits (64), Expect = 7.9
 Identities = 13/37 (35%), Positives = 23/37 (62%)
 Frame = +2

Query: 89   RGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTL 199
            +GE  A  DRV  + +G+   P +L++ +P + +LTL
Sbjct: 918  KGEGPASPDRVFNTPEGVPSAPSSLKIVNPTLDSLTL 954


>BC115736-1|AAI15737.1| 1192|Homo sapiens NRCAM protein protein.
          Length = 1192

 Score = 29.9 bits (64), Expect = 7.9
 Identities = 13/37 (35%), Positives = 23/37 (62%)
 Frame = +2

Query: 89   RGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTL 199
            +GE  A  DRV  + +G+   P +L++ +P + +LTL
Sbjct: 915  KGEGPASPDRVFNTPEGVPSAPSSLKIVNPTLDSLTL 951


>BC114570-1|AAI14571.1| 1180|Homo sapiens NRCAM protein protein.
          Length = 1180

 Score = 29.9 bits (64), Expect = 7.9
 Identities = 13/37 (35%), Positives = 23/37 (62%)
 Frame = +2

Query: 89   RGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTL 199
            +GE  A  DRV  + +G+   P +L++ +P + +LTL
Sbjct: 915  KGEGPASPDRVFNTPEGVPSAPSSLKIVNPTLDSLTL 951


>AF172277-2|AAF22283.1| 1236|Homo sapiens NgCAM-related related cell
            adhesion molecule /alternative carboxyl terminus protein.
          Length = 1236

 Score = 29.9 bits (64), Expect = 7.9
 Identities = 13/37 (35%), Positives = 23/37 (62%)
 Frame = +2

Query: 89   RGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTL 199
            +GE  A  DRV  + +G+   P +L++ +P + +LTL
Sbjct: 934  KGEGPASPDRVFNTPEGVPSAPSSLKIVNPTLDSLTL 970


>AF172277-1|AAF22282.1| 1308|Homo sapiens NgCAM-related related cell
            adhesion molecule protein.
          Length = 1308

 Score = 29.9 bits (64), Expect = 7.9
 Identities = 13/37 (35%), Positives = 23/37 (62%)
 Frame = +2

Query: 89   RGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTL 199
            +GE  A  DRV  + +G+   P +L++ +P + +LTL
Sbjct: 934  KGEGPASPDRVFNTPEGVPSAPSSLKIVNPTLDSLTL 970


>AB002341-1|BAA20801.2| 1187|Homo sapiens KIAA0343 protein.
          Length = 1187

 Score = 29.9 bits (64), Expect = 7.9
 Identities = 13/37 (35%), Positives = 23/37 (62%)
 Frame = +2

Query: 89   RGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTL 199
            +GE  A  DRV  + +G+   P +L++ +P + +LTL
Sbjct: 922  KGEGPASPDRVFNTPEGVPSAPSSLKIVNPTLDSLTL 958


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 89,099,200
Number of Sequences: 237096
Number of extensions: 1779632
Number of successful extensions: 3322
Number of sequences better than 10.0: 61
Number of HSP's better than 10.0 without gapping: 3084
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3316
length of database: 76,859,062
effective HSP length: 87
effective length of database: 56,231,710
effective search space used: 6972732040
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -