SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20060
         (530 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

X89401-1|CAA61582.1|  160|Homo sapiens ribosomal protein L21 pro...   109   8e-24
U14967-1|AAA85655.1|  160|Homo sapiens ribosomal protein L21 pro...   109   8e-24
CR457032-1|CAG33313.1|  160|Homo sapiens RPL21 protein.               109   8e-24
BC104667-1|AAI04668.1|  160|Homo sapiens ribosomal protein L21 p...   109   8e-24
BC071902-1|AAH71902.1|  160|Homo sapiens ribosomal protein L21 p...   109   8e-24
BC070330-1|AAH70330.1|  160|Homo sapiens ribosomal protein L21 p...   109   8e-24
BC070323-1|AAH70323.1|  160|Homo sapiens ribosomal protein L21 p...   109   8e-24
BC070184-1|AAH70184.1|  160|Homo sapiens ribosomal protein L21 p...   109   8e-24
BC062981-1|AAH62981.1|  160|Homo sapiens ribosomal protein L21 p...   109   8e-24
BC007505-1|AAH07505.1|  160|Homo sapiens ribosomal protein L21 p...   109   8e-24
BC001603-1|AAH01603.1|  160|Homo sapiens ribosomal protein L21 p...   109   8e-24
AL159977-1|CAH73745.1|  160|Homo sapiens ribosomal protein L21 p...   109   8e-24
AB061826-1|BAB79464.1|  160|Homo sapiens ribosomal protein L21 p...   109   8e-24
L38826-1|AAA80462.1|  152|Homo sapiens L21 ribosomal protein pro...   108   1e-23
U25789-1|AAA93231.1|  160|Homo sapiens ribosomal protein L21 pro...   107   2e-23
AB209100-1|BAD92337.1|  163|Homo sapiens ribosomal protein L21 v...   105   1e-22
BC057822-1|AAH57822.1|  136|Homo sapiens similar to 60S ribosoma...    93   6e-19
AB007176-1|BAA25835.1|   31|Homo sapiens ribosomal protein L21 p...    36   0.12 
AK125861-1|BAC86325.1|  367|Homo sapiens protein ( Homo sapiens ...    31   3.3  
AK123780-1|BAC85690.1|  367|Homo sapiens protein ( Homo sapiens ...    31   3.3  
AK074159-1|BAB84985.1|  318|Homo sapiens FLJ00232 protein protein.     31   3.3  
BC130292-1|AAI30293.1|  418|Homo sapiens sprouty-related, EVH1 d...    29   7.7  
BC111495-1|AAI11496.1|  415|Homo sapiens SPRED2 protein protein.       29   7.7  
AY299090-1|AAP59415.1|  418|Homo sapiens SPRED2 protein.               29   7.7  

>X89401-1|CAA61582.1|  160|Homo sapiens ribosomal protein L21
           protein.
          Length = 160

 Score =  109 bits (261), Expect = 8e-24
 Identities = 50/83 (60%), Positives = 65/83 (78%), Gaps = 1/83 (1%)
 Frame = +2

Query: 254 QRVRGRIIPKRINIRVEHVKHSKCRQDFLKRVKENERLLKEAKAAGKTVNLKRQPAPPKA 433
           ++V+G+I+ KRIN+R+EH+KHSK R  FLKRVKEN++  KEAK  G  V LKRQPAPP+ 
Sbjct: 78  KQVKGKILAKRINVRIEHIKHSKSRDSFLKRVKENDQKKKEAKEKGTWVQLKRQPAPPRE 137

Query: 434 AHIV-SGTEKPVLLAPIPYEFVA 499
           AH V +  ++P LL PIPYEF+A
Sbjct: 138 AHFVRTNGKEPELLEPIPYEFMA 160



 Score =  108 bits (259), Expect = 1e-23
 Identities = 44/59 (74%), Positives = 52/59 (88%)
 Frame = +3

Query: 78  FRTHGTIPLSTYMKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGVIVN 254
           FR HG +PL+TYM++YK GDIVDI+G G VQKGMPHK YHGKTGRVYNVT HA+G++VN
Sbjct: 19  FRKHGVVPLATYMRIYKKGDIVDIKGMGTVQKGMPHKCYHGKTGRVYNVTQHAVGIVVN 77


>U14967-1|AAA85655.1|  160|Homo sapiens ribosomal protein L21
           protein.
          Length = 160

 Score =  109 bits (261), Expect = 8e-24
 Identities = 50/83 (60%), Positives = 65/83 (78%), Gaps = 1/83 (1%)
 Frame = +2

Query: 254 QRVRGRIIPKRINIRVEHVKHSKCRQDFLKRVKENERLLKEAKAAGKTVNLKRQPAPPKA 433
           ++V+G+I+ KRIN+R+EH+KHSK R  FLKRVKEN++  KEAK  G  V LKRQPAPP+ 
Sbjct: 78  KQVKGKILAKRINVRIEHIKHSKSRDSFLKRVKENDQKKKEAKEKGTWVQLKRQPAPPRE 137

Query: 434 AHIV-SGTEKPVLLAPIPYEFVA 499
           AH V +  ++P LL PIPYEF+A
Sbjct: 138 AHFVRTNGKEPELLEPIPYEFMA 160



 Score =  108 bits (259), Expect = 1e-23
 Identities = 44/59 (74%), Positives = 52/59 (88%)
 Frame = +3

Query: 78  FRTHGTIPLSTYMKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGVIVN 254
           FR HG +PL+TYM++YK GDIVDI+G G VQKGMPHK YHGKTGRVYNVT HA+G++VN
Sbjct: 19  FRKHGVVPLATYMRIYKKGDIVDIKGMGTVQKGMPHKCYHGKTGRVYNVTQHAVGIVVN 77


>CR457032-1|CAG33313.1|  160|Homo sapiens RPL21 protein.
          Length = 160

 Score =  109 bits (261), Expect = 8e-24
 Identities = 50/83 (60%), Positives = 65/83 (78%), Gaps = 1/83 (1%)
 Frame = +2

Query: 254 QRVRGRIIPKRINIRVEHVKHSKCRQDFLKRVKENERLLKEAKAAGKTVNLKRQPAPPKA 433
           ++V+G+I+ KRIN+R+EH+KHSK R  FLKRVKEN++  KEAK  G  V LKRQPAPP+ 
Sbjct: 78  KQVKGKILAKRINVRIEHIKHSKSRDSFLKRVKENDQKKKEAKEKGTWVQLKRQPAPPRE 137

Query: 434 AHIV-SGTEKPVLLAPIPYEFVA 499
           AH V +  ++P LL PIPYEF+A
Sbjct: 138 AHFVRTNGKEPELLEPIPYEFMA 160



 Score =  108 bits (259), Expect = 1e-23
 Identities = 44/59 (74%), Positives = 52/59 (88%)
 Frame = +3

Query: 78  FRTHGTIPLSTYMKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGVIVN 254
           FR HG +PL+TYM++YK GDIVDI+G G VQKGMPHK YHGKTGRVYNVT HA+G++VN
Sbjct: 19  FRKHGVVPLATYMRIYKKGDIVDIKGMGTVQKGMPHKCYHGKTGRVYNVTQHAVGIVVN 77


>BC104667-1|AAI04668.1|  160|Homo sapiens ribosomal protein L21
           protein.
          Length = 160

 Score =  109 bits (261), Expect = 8e-24
 Identities = 50/83 (60%), Positives = 65/83 (78%), Gaps = 1/83 (1%)
 Frame = +2

Query: 254 QRVRGRIIPKRINIRVEHVKHSKCRQDFLKRVKENERLLKEAKAAGKTVNLKRQPAPPKA 433
           ++V+G+I+ KRIN+R+EH+KHSK R  FLKRVKEN++  KEAK  G  V LKRQPAPP+ 
Sbjct: 78  KQVKGKILAKRINVRIEHIKHSKSRDSFLKRVKENDQKKKEAKEKGTWVQLKRQPAPPRE 137

Query: 434 AHIV-SGTEKPVLLAPIPYEFVA 499
           AH V +  ++P LL PIPYEF+A
Sbjct: 138 AHFVRTNGKEPELLEPIPYEFMA 160



 Score =  108 bits (259), Expect = 1e-23
 Identities = 44/59 (74%), Positives = 52/59 (88%)
 Frame = +3

Query: 78  FRTHGTIPLSTYMKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGVIVN 254
           FR HG +PL+TYM++YK GDIVDI+G G VQKGMPHK YHGKTGRVYNVT HA+G++VN
Sbjct: 19  FRKHGVVPLATYMRIYKKGDIVDIKGMGTVQKGMPHKCYHGKTGRVYNVTQHAVGIVVN 77


>BC071902-1|AAH71902.1|  160|Homo sapiens ribosomal protein L21
           protein.
          Length = 160

 Score =  109 bits (261), Expect = 8e-24
 Identities = 50/83 (60%), Positives = 65/83 (78%), Gaps = 1/83 (1%)
 Frame = +2

Query: 254 QRVRGRIIPKRINIRVEHVKHSKCRQDFLKRVKENERLLKEAKAAGKTVNLKRQPAPPKA 433
           ++V+G+I+ KRIN+R+EH+KHSK R  FLKRVKEN++  KEAK  G  V LKRQPAPP+ 
Sbjct: 78  KQVKGKILAKRINVRIEHIKHSKSRDSFLKRVKENDQKKKEAKEKGTWVQLKRQPAPPRE 137

Query: 434 AHIV-SGTEKPVLLAPIPYEFVA 499
           AH V +  ++P LL PIPYEF+A
Sbjct: 138 AHFVRTNGKEPELLEPIPYEFMA 160



 Score =  108 bits (259), Expect = 1e-23
 Identities = 44/59 (74%), Positives = 52/59 (88%)
 Frame = +3

Query: 78  FRTHGTIPLSTYMKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGVIVN 254
           FR HG +PL+TYM++YK GDIVDI+G G VQKGMPHK YHGKTGRVYNVT HA+G++VN
Sbjct: 19  FRKHGVVPLATYMRIYKKGDIVDIKGMGTVQKGMPHKCYHGKTGRVYNVTQHAVGIVVN 77


>BC070330-1|AAH70330.1|  160|Homo sapiens ribosomal protein L21
           protein.
          Length = 160

 Score =  109 bits (261), Expect = 8e-24
 Identities = 50/83 (60%), Positives = 65/83 (78%), Gaps = 1/83 (1%)
 Frame = +2

Query: 254 QRVRGRIIPKRINIRVEHVKHSKCRQDFLKRVKENERLLKEAKAAGKTVNLKRQPAPPKA 433
           ++V+G+I+ KRIN+R+EH+KHSK R  FLKRVKEN++  KEAK  G  V LKRQPAPP+ 
Sbjct: 78  KQVKGKILAKRINVRIEHIKHSKSRDSFLKRVKENDQKKKEAKEKGTWVQLKRQPAPPRE 137

Query: 434 AHIV-SGTEKPVLLAPIPYEFVA 499
           AH V +  ++P LL PIPYEF+A
Sbjct: 138 AHFVRTNGKEPELLEPIPYEFMA 160



 Score =  108 bits (259), Expect = 1e-23
 Identities = 44/59 (74%), Positives = 52/59 (88%)
 Frame = +3

Query: 78  FRTHGTIPLSTYMKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGVIVN 254
           FR HG +PL+TYM++YK GDIVDI+G G VQKGMPHK YHGKTGRVYNVT HA+G++VN
Sbjct: 19  FRKHGVVPLATYMRIYKKGDIVDIKGMGTVQKGMPHKCYHGKTGRVYNVTQHAVGIVVN 77


>BC070323-1|AAH70323.1|  160|Homo sapiens ribosomal protein L21
           protein.
          Length = 160

 Score =  109 bits (261), Expect = 8e-24
 Identities = 50/83 (60%), Positives = 65/83 (78%), Gaps = 1/83 (1%)
 Frame = +2

Query: 254 QRVRGRIIPKRINIRVEHVKHSKCRQDFLKRVKENERLLKEAKAAGKTVNLKRQPAPPKA 433
           ++V+G+I+ KRIN+R+EH+KHSK R  FLKRVKEN++  KEAK  G  V LKRQPAPP+ 
Sbjct: 78  KQVKGKILAKRINVRIEHIKHSKSRDSFLKRVKENDQKKKEAKEKGTWVQLKRQPAPPRE 137

Query: 434 AHIV-SGTEKPVLLAPIPYEFVA 499
           AH V +  ++P LL PIPYEF+A
Sbjct: 138 AHFVRTNGKEPELLEPIPYEFMA 160



 Score =  108 bits (259), Expect = 1e-23
 Identities = 44/59 (74%), Positives = 52/59 (88%)
 Frame = +3

Query: 78  FRTHGTIPLSTYMKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGVIVN 254
           FR HG +PL+TYM++YK GDIVDI+G G VQKGMPHK YHGKTGRVYNVT HA+G++VN
Sbjct: 19  FRKHGVVPLATYMRIYKKGDIVDIKGMGTVQKGMPHKCYHGKTGRVYNVTQHAVGIVVN 77


>BC070184-1|AAH70184.1|  160|Homo sapiens ribosomal protein L21
           protein.
          Length = 160

 Score =  109 bits (261), Expect = 8e-24
 Identities = 50/83 (60%), Positives = 65/83 (78%), Gaps = 1/83 (1%)
 Frame = +2

Query: 254 QRVRGRIIPKRINIRVEHVKHSKCRQDFLKRVKENERLLKEAKAAGKTVNLKRQPAPPKA 433
           ++V+G+I+ KRIN+R+EH+KHSK R  FLKRVKEN++  KEAK  G  V LKRQPAPP+ 
Sbjct: 78  KQVKGKILAKRINVRIEHIKHSKSRDSFLKRVKENDQKKKEAKEKGTWVQLKRQPAPPRE 137

Query: 434 AHIV-SGTEKPVLLAPIPYEFVA 499
           AH V +  ++P LL PIPYEF+A
Sbjct: 138 AHFVRTNGKEPELLEPIPYEFMA 160



 Score =  108 bits (259), Expect = 1e-23
 Identities = 44/59 (74%), Positives = 52/59 (88%)
 Frame = +3

Query: 78  FRTHGTIPLSTYMKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGVIVN 254
           FR HG +PL+TYM++YK GDIVDI+G G VQKGMPHK YHGKTGRVYNVT HA+G++VN
Sbjct: 19  FRKHGVVPLATYMRIYKKGDIVDIKGMGTVQKGMPHKCYHGKTGRVYNVTQHAVGIVVN 77


>BC062981-1|AAH62981.1|  160|Homo sapiens ribosomal protein L21
           protein.
          Length = 160

 Score =  109 bits (261), Expect = 8e-24
 Identities = 50/83 (60%), Positives = 65/83 (78%), Gaps = 1/83 (1%)
 Frame = +2

Query: 254 QRVRGRIIPKRINIRVEHVKHSKCRQDFLKRVKENERLLKEAKAAGKTVNLKRQPAPPKA 433
           ++V+G+I+ KRIN+R+EH+KHSK R  FLKRVKEN++  KEAK  G  V LKRQPAPP+ 
Sbjct: 78  KQVKGKILAKRINVRIEHIKHSKSRDSFLKRVKENDQKKKEAKEKGTWVQLKRQPAPPRE 137

Query: 434 AHIV-SGTEKPVLLAPIPYEFVA 499
           AH V +  ++P LL PIPYEF+A
Sbjct: 138 AHFVRTNGKEPELLEPIPYEFMA 160



 Score =  108 bits (259), Expect = 1e-23
 Identities = 44/59 (74%), Positives = 52/59 (88%)
 Frame = +3

Query: 78  FRTHGTIPLSTYMKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGVIVN 254
           FR HG +PL+TYM++YK GDIVDI+G G VQKGMPHK YHGKTGRVYNVT HA+G++VN
Sbjct: 19  FRKHGVVPLATYMRIYKKGDIVDIKGMGTVQKGMPHKCYHGKTGRVYNVTQHAVGIVVN 77


>BC007505-1|AAH07505.1|  160|Homo sapiens ribosomal protein L21
           protein.
          Length = 160

 Score =  109 bits (261), Expect = 8e-24
 Identities = 50/83 (60%), Positives = 65/83 (78%), Gaps = 1/83 (1%)
 Frame = +2

Query: 254 QRVRGRIIPKRINIRVEHVKHSKCRQDFLKRVKENERLLKEAKAAGKTVNLKRQPAPPKA 433
           ++V+G+I+ KRIN+R+EH+KHSK R  FLKRVKEN++  KEAK  G  V LKRQPAPP+ 
Sbjct: 78  KQVKGKILAKRINVRIEHIKHSKSRDSFLKRVKENDQKKKEAKEKGTWVQLKRQPAPPRE 137

Query: 434 AHIV-SGTEKPVLLAPIPYEFVA 499
           AH V +  ++P LL PIPYEF+A
Sbjct: 138 AHFVRTNGKEPELLEPIPYEFMA 160



 Score =  108 bits (259), Expect = 1e-23
 Identities = 44/59 (74%), Positives = 52/59 (88%)
 Frame = +3

Query: 78  FRTHGTIPLSTYMKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGVIVN 254
           FR HG +PL+TYM++YK GDIVDI+G G VQKGMPHK YHGKTGRVYNVT HA+G++VN
Sbjct: 19  FRKHGVVPLATYMRIYKKGDIVDIKGMGTVQKGMPHKCYHGKTGRVYNVTQHAVGIVVN 77


>BC001603-1|AAH01603.1|  160|Homo sapiens ribosomal protein L21
           protein.
          Length = 160

 Score =  109 bits (261), Expect = 8e-24
 Identities = 50/83 (60%), Positives = 65/83 (78%), Gaps = 1/83 (1%)
 Frame = +2

Query: 254 QRVRGRIIPKRINIRVEHVKHSKCRQDFLKRVKENERLLKEAKAAGKTVNLKRQPAPPKA 433
           ++V+G+I+ KRIN+R+EH+KHSK R  FLKRVKEN++  KEAK  G  V LKRQPAPP+ 
Sbjct: 78  KQVKGKILAKRINVRIEHIKHSKSRDSFLKRVKENDQKKKEAKEKGTWVQLKRQPAPPRE 137

Query: 434 AHIV-SGTEKPVLLAPIPYEFVA 499
           AH V +  ++P LL PIPYEF+A
Sbjct: 138 AHFVRTNGKEPELLEPIPYEFMA 160



 Score =  108 bits (259), Expect = 1e-23
 Identities = 44/59 (74%), Positives = 52/59 (88%)
 Frame = +3

Query: 78  FRTHGTIPLSTYMKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGVIVN 254
           FR HG +PL+TYM++YK GDIVDI+G G VQKGMPHK YHGKTGRVYNVT HA+G++VN
Sbjct: 19  FRKHGVVPLATYMRIYKKGDIVDIKGMGTVQKGMPHKCYHGKTGRVYNVTQHAVGIVVN 77


>AL159977-1|CAH73745.1|  160|Homo sapiens ribosomal protein L21
           protein.
          Length = 160

 Score =  109 bits (261), Expect = 8e-24
 Identities = 50/83 (60%), Positives = 65/83 (78%), Gaps = 1/83 (1%)
 Frame = +2

Query: 254 QRVRGRIIPKRINIRVEHVKHSKCRQDFLKRVKENERLLKEAKAAGKTVNLKRQPAPPKA 433
           ++V+G+I+ KRIN+R+EH+KHSK R  FLKRVKEN++  KEAK  G  V LKRQPAPP+ 
Sbjct: 78  KQVKGKILAKRINVRIEHIKHSKSRDSFLKRVKENDQKKKEAKEKGTWVQLKRQPAPPRE 137

Query: 434 AHIV-SGTEKPVLLAPIPYEFVA 499
           AH V +  ++P LL PIPYEF+A
Sbjct: 138 AHFVRTNGKEPELLEPIPYEFMA 160



 Score =  108 bits (259), Expect = 1e-23
 Identities = 44/59 (74%), Positives = 52/59 (88%)
 Frame = +3

Query: 78  FRTHGTIPLSTYMKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGVIVN 254
           FR HG +PL+TYM++YK GDIVDI+G G VQKGMPHK YHGKTGRVYNVT HA+G++VN
Sbjct: 19  FRKHGVVPLATYMRIYKKGDIVDIKGMGTVQKGMPHKCYHGKTGRVYNVTQHAVGIVVN 77


>AB061826-1|BAB79464.1|  160|Homo sapiens ribosomal protein L21
           protein.
          Length = 160

 Score =  109 bits (261), Expect = 8e-24
 Identities = 50/83 (60%), Positives = 65/83 (78%), Gaps = 1/83 (1%)
 Frame = +2

Query: 254 QRVRGRIIPKRINIRVEHVKHSKCRQDFLKRVKENERLLKEAKAAGKTVNLKRQPAPPKA 433
           ++V+G+I+ KRIN+R+EH+KHSK R  FLKRVKEN++  KEAK  G  V LKRQPAPP+ 
Sbjct: 78  KQVKGKILAKRINVRIEHIKHSKSRDSFLKRVKENDQKKKEAKEKGTWVQLKRQPAPPRE 137

Query: 434 AHIV-SGTEKPVLLAPIPYEFVA 499
           AH V +  ++P LL PIPYEF+A
Sbjct: 138 AHFVRTNGKEPELLEPIPYEFMA 160



 Score =  108 bits (259), Expect = 1e-23
 Identities = 44/59 (74%), Positives = 52/59 (88%)
 Frame = +3

Query: 78  FRTHGTIPLSTYMKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGVIVN 254
           FR HG +PL+TYM++YK GDIVDI+G G VQKGMPHK YHGKTGRVYNVT HA+G++VN
Sbjct: 19  FRKHGVVPLATYMRIYKKGDIVDIKGMGTVQKGMPHKCYHGKTGRVYNVTQHAVGIVVN 77


>L38826-1|AAA80462.1|  152|Homo sapiens L21 ribosomal protein
           protein.
          Length = 152

 Score =  108 bits (259), Expect = 1e-23
 Identities = 44/59 (74%), Positives = 52/59 (88%)
 Frame = +3

Query: 78  FRTHGTIPLSTYMKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGVIVN 254
           FR HG +PL+TYM++YK GDIVDI+G G VQKGMPHK YHGKTGRVYNVT HA+G++VN
Sbjct: 11  FRKHGVVPLATYMRIYKKGDIVDIKGMGTVQKGMPHKCYHGKTGRVYNVTQHAVGIVVN 69



 Score =  107 bits (256), Expect = 3e-23
 Identities = 49/83 (59%), Positives = 64/83 (77%), Gaps = 1/83 (1%)
 Frame = +2

Query: 254 QRVRGRIIPKRINIRVEHVKHSKCRQDFLKRVKENERLLKEAKAAGKTVNLKRQPAPPKA 433
           ++V+G+I+ KRIN+R+EH+KHSK R  FLKRVKEN++  KEAK  G  V LKR PAPP+ 
Sbjct: 70  KQVKGKILAKRINVRIEHIKHSKSRDSFLKRVKENDQKKKEAKEKGTWVQLKRHPAPPRE 129

Query: 434 AHIV-SGTEKPVLLAPIPYEFVA 499
           AH V +  ++P LL PIPYEF+A
Sbjct: 130 AHFVRTNGKEPELLEPIPYEFMA 152


>U25789-1|AAA93231.1|  160|Homo sapiens ribosomal protein L21
           protein.
          Length = 160

 Score =  107 bits (257), Expect = 2e-23
 Identities = 44/59 (74%), Positives = 51/59 (86%)
 Frame = +3

Query: 78  FRTHGTIPLSTYMKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGVIVN 254
           FR HG +PL+TYM++YK GDIVDI+G G VQKGMPHK YHGKTGRVYNVT HA G++VN
Sbjct: 19  FRKHGVVPLATYMRIYKKGDIVDIKGMGTVQKGMPHKCYHGKTGRVYNVTQHAAGIVVN 77



 Score = 98.7 bits (235), Expect = 1e-20
 Identities = 45/83 (54%), Positives = 63/83 (75%), Gaps = 1/83 (1%)
 Frame = +2

Query: 254 QRVRGRIIPKRINIRVEHVKHSKCRQDFLKRVKENERLLKEAKAAGKTVNLKRQPAPPKA 433
           ++V+G+I+ KRIN+R+EH+KHSK R +FLKRVK +++   EA+  G  V LKR PAPP+ 
Sbjct: 78  EQVKGKILAKRINVRIEHIKHSKSRDNFLKRVKXDDQEKXEAQEKGTWVQLKRXPAPPRE 137

Query: 434 AHIV-SGTEKPVLLAPIPYEFVA 499
           AH V +  ++P LL PIPYEF+A
Sbjct: 138 AHFVRTNGKEPELLEPIPYEFMA 160


>AB209100-1|BAD92337.1|  163|Homo sapiens ribosomal protein L21
           variant protein.
          Length = 163

 Score =  105 bits (252), Expect = 1e-22
 Identities = 44/59 (74%), Positives = 51/59 (86%)
 Frame = +3

Query: 78  FRTHGTIPLSTYMKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGVIVN 254
           FR HG +PL+TYM+VYK GDIVDI+G G VQKGMPH  YHGKTGRVYNVT HA+G++VN
Sbjct: 22  FRKHGVVPLATYMRVYKKGDIVDIKGMGTVQKGMPHTRYHGKTGRVYNVTQHAVGIVVN 80



 Score =  103 bits (247), Expect = 4e-22
 Identities = 47/83 (56%), Positives = 64/83 (77%), Gaps = 1/83 (1%)
 Frame = +2

Query: 254 QRVRGRIIPKRINIRVEHVKHSKCRQDFLKRVKENERLLKEAKAAGKTVNLKRQPAPPKA 433
           ++V+G+I+ KRIN+R+EH+KHSK +  FLKRVKEN++  KEAK     + LKRQPAPP+ 
Sbjct: 81  KQVKGKILAKRINVRIEHIKHSKSQDSFLKRVKENDQKKKEAKEKVTWIQLKRQPAPPRE 140

Query: 434 AHIV-SGTEKPVLLAPIPYEFVA 499
           AH V +  ++P LL PIPYEF+A
Sbjct: 141 AHFVRTNGKEPELLEPIPYEFMA 163


>BC057822-1|AAH57822.1|  136|Homo sapiens similar to 60S ribosomal
           protein L21 protein.
          Length = 136

 Score = 93.1 bits (221), Expect = 6e-19
 Identities = 44/80 (55%), Positives = 55/80 (68%), Gaps = 1/80 (1%)
 Frame = +2

Query: 263 RGRIIPKRINIRVEHVKHSKCRQDFLKRVKENERLLKEAKAAGKTVNLKRQPAPPKAAHI 442
           +G+I+ KRIN+ +EH+KH K R  FLK VKEN++  KEAK  G  V +K QPAPP+ AH 
Sbjct: 56  KGKILAKRINVHIEHIKHCKSRDSFLKCVKENDQKKKEAKEEGTWVQVKHQPAPPREAHF 115

Query: 443 VSGTEK-PVLLAPIPYEFVA 499
           V    K P LL PIP EF+A
Sbjct: 116 VKACGKEPELLEPIPCEFMA 135


>AB007176-1|BAA25835.1|   31|Homo sapiens ribosomal protein L21
           protein.
          Length = 31

 Score = 35.5 bits (78), Expect = 0.12
 Identities = 17/29 (58%), Positives = 21/29 (72%), Gaps = 1/29 (3%)
 Frame = +2

Query: 398 VNLKRQPAPPKAAHIV-SGTEKPVLLAPI 481
           V LKRQPAPP+ AH V +  ++P LL PI
Sbjct: 3   VQLKRQPAPPREAHFVRTNGKEPELLEPI 31


>AK125861-1|BAC86325.1|  367|Homo sapiens protein ( Homo sapiens
           cDNA FLJ43873 fis, clone TESTI4008429, highly  similar
           to Probable cation-transporting ATPase 2 (EC 3.6.3.-).
           ).
          Length = 367

 Score = 30.7 bits (66), Expect = 3.3
 Identities = 12/33 (36%), Positives = 13/33 (39%)
 Frame = +2

Query: 65  CSLAVPHTWNYSALHVHESVQSWRHCRHQRQWC 163
           C    PH    S  H H +  SWR C     WC
Sbjct: 271 CLPTQPHPMKPSVPHPHRARPSWRACPRTSPWC 303


>AK123780-1|BAC85690.1|  367|Homo sapiens protein ( Homo sapiens
           cDNA FLJ41786 fis, clone KIDNE2001361, highly  similar
           to Mus musculus catp mRNA for cation-transporting
           atpase. ).
          Length = 367

 Score = 30.7 bits (66), Expect = 3.3
 Identities = 12/33 (36%), Positives = 13/33 (39%)
 Frame = +2

Query: 65  CSLAVPHTWNYSALHVHESVQSWRHCRHQRQWC 163
           C    PH    S  H H +  SWR C     WC
Sbjct: 271 CLPTQPHPMKPSVPHPHRARPSWRACPRTSPWC 303


>AK074159-1|BAB84985.1|  318|Homo sapiens FLJ00232 protein protein.
          Length = 318

 Score = 30.7 bits (66), Expect = 3.3
 Identities = 12/33 (36%), Positives = 13/33 (39%)
 Frame = +2

Query: 65  CSLAVPHTWNYSALHVHESVQSWRHCRHQRQWC 163
           C    PH    S  H H +  SWR C     WC
Sbjct: 222 CLPTQPHPMKPSVPHPHRARPSWRACPRTSPWC 254


>BC130292-1|AAI30293.1|  418|Homo sapiens sprouty-related, EVH1
           domain containing 2 protein.
          Length = 418

 Score = 29.5 bits (63), Expect = 7.7
 Identities = 15/29 (51%), Positives = 17/29 (58%), Gaps = 1/29 (3%)
 Frame = +1

Query: 364 ATEGSQGCRQDR-QPEETASSP*SCPHRQ 447
           AT+ S    Q R QP  T SSP SC HR+
Sbjct: 148 ATDSSSNSSQKREQPTRTISSPTSCEHRR 176


>BC111495-1|AAI11496.1|  415|Homo sapiens SPRED2 protein protein.
          Length = 415

 Score = 29.5 bits (63), Expect = 7.7
 Identities = 15/29 (51%), Positives = 17/29 (58%), Gaps = 1/29 (3%)
 Frame = +1

Query: 364 ATEGSQGCRQDR-QPEETASSP*SCPHRQ 447
           AT+ S    Q R QP  T SSP SC HR+
Sbjct: 148 ATDSSSNSSQKREQPTRTISSPTSCEHRR 176


>AY299090-1|AAP59415.1|  418|Homo sapiens SPRED2 protein.
          Length = 418

 Score = 29.5 bits (63), Expect = 7.7
 Identities = 15/29 (51%), Positives = 17/29 (58%), Gaps = 1/29 (3%)
 Frame = +1

Query: 364 ATEGSQGCRQDR-QPEETASSP*SCPHRQ 447
           AT+ S    Q R QP  T SSP SC HR+
Sbjct: 148 ATDSSSNSSQKREQPTRTISSPTSCEHRR 176


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 76,969,810
Number of Sequences: 237096
Number of extensions: 1638320
Number of successful extensions: 8590
Number of sequences better than 10.0: 24
Number of HSP's better than 10.0 without gapping: 8299
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 8573
length of database: 76,859,062
effective HSP length: 85
effective length of database: 56,705,902
effective search space used: 5160237082
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -