SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20058
         (614 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BC130300-1|AAI30301.1|  338|Homo sapiens TWIST neighbor protein.       74   5e-13
BC130298-1|AAI30299.1|  338|Homo sapiens TWIST neighbor protein.       74   5e-13
BC014574-1|AAH14574.1|  226|Homo sapiens TWISTNB protein protein.      74   5e-13

>BC130300-1|AAI30301.1|  338|Homo sapiens TWIST neighbor protein.
          Length = 338

 Score = 73.7 bits (173), Expect = 5e-13
 Identities = 33/83 (39%), Positives = 50/83 (60%)
 Frame = +3

Query: 255 KELNGVLVSYKNPCILQNVGTIRNDNADIHFQVQADYFIFQPYIGAKLTGLVNKKCSTHL 434
           + L GV ++Y N  ++  +G I +D   IH  ++AD+ IF P  G KL G+VNK  S+H+
Sbjct: 84  ESLLGVPIAYDNIKVVGELGDIYDDQGHIHLNIEADFVIFCPEPGQKLMGIVNKVSSSHI 143

Query: 435 SVLVHRVFNVVIPQPTEEPGDKW 503
             LVH  FN  IP+P +   ++W
Sbjct: 144 GCLVHGCFNASIPKPEQLSAEQW 166


>BC130298-1|AAI30299.1|  338|Homo sapiens TWIST neighbor protein.
          Length = 338

 Score = 73.7 bits (173), Expect = 5e-13
 Identities = 33/83 (39%), Positives = 50/83 (60%)
 Frame = +3

Query: 255 KELNGVLVSYKNPCILQNVGTIRNDNADIHFQVQADYFIFQPYIGAKLTGLVNKKCSTHL 434
           + L GV ++Y N  ++  +G I +D   IH  ++AD+ IF P  G KL G+VNK  S+H+
Sbjct: 84  ESLLGVPIAYDNIKVVGELGDIYDDQGHIHLNIEADFVIFCPEPGQKLMGIVNKVSSSHI 143

Query: 435 SVLVHRVFNVVIPQPTEEPGDKW 503
             LVH  FN  IP+P +   ++W
Sbjct: 144 GCLVHGCFNASIPKPEQLSAEQW 166


>BC014574-1|AAH14574.1|  226|Homo sapiens TWISTNB protein protein.
          Length = 226

 Score = 73.7 bits (173), Expect = 5e-13
 Identities = 33/83 (39%), Positives = 50/83 (60%)
 Frame = +3

Query: 255 KELNGVLVSYKNPCILQNVGTIRNDNADIHFQVQADYFIFQPYIGAKLTGLVNKKCSTHL 434
           + L GV ++Y N  ++  +G I +D   IH  ++AD+ IF P  G KL G+VNK  S+H+
Sbjct: 84  ESLLGVPIAYDNIKVVGELGDIYDDQGHIHLNIEADFVIFCPEPGQKLMGIVNKVSSSHI 143

Query: 435 SVLVHRVFNVVIPQPTEEPGDKW 503
             LVH  FN  IP+P +   ++W
Sbjct: 144 GCLVHGCFNASIPKPEQLSAEQW 166


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 80,419,255
Number of Sequences: 237096
Number of extensions: 1538780
Number of successful extensions: 2334
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 2212
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2334
length of database: 76,859,062
effective HSP length: 87
effective length of database: 56,231,710
effective search space used: 6579110070
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -