SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20057
         (573 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AK124538-1|BAC85878.1|  256|Homo sapiens protein ( Homo sapiens ...    33   0.71 
AK074076-1|BAB84902.1|  772|Homo sapiens FLJ00147 protein protein.     32   1.6  
AK027561-1|BAB55198.1|  819|Homo sapiens protein ( Homo sapiens ...    32   1.6  
AK027362-1|BAB55063.1| 1287|Homo sapiens protein ( Homo sapiens ...    32   1.6  
AF059318-1|AAG43115.1|  212|Homo sapiens My002 protein protein.        32   1.6  
AB037837-1|BAA92654.1| 1967|Homo sapiens KIAA1416 protein protein.     32   1.6  
Z83689-1|CAB69660.1| 1211|Homo sapiens AF-4 protein.                   31   3.8  
L25050-1|AAA36642.1| 1206|Homo sapiens serine/proline-rich prote...    31   3.8  
L22179-1|AAC37520.1| 2311|Homo sapiens MLL-AF4 der(11) fusion pr...    31   3.8  
L13773-1|AAA58360.1| 1210|Homo sapiens AF-4 protein.                   31   3.8  
BC114930-1|AAI14931.1| 1211|Homo sapiens AF4/FMR2 family, member...    31   3.8  
BC110537-1|AAI10538.1|  819|Homo sapiens IWS1 homolog (S. cerevi...    31   3.8  
BC110536-1|AAI10537.1|  819|Homo sapiens IWS1 homolog (S. cerevi...    31   3.8  
BC065279-1|AAH65279.1|  375|Homo sapiens IWS1 protein protein.         31   3.8  
BC014009-1|AAH14009.2|  476|Homo sapiens GLTSCR2 protein protein.      31   3.8  
BC010095-1|AAH10095.1|  478|Homo sapiens glioma tumor suppressor...    31   3.8  
BC007248-1|AAH07248.1|  474|Homo sapiens glioma tumor suppressor...    31   3.8  
BC006311-1|AAH06311.1|  478|Homo sapiens glioma tumor suppressor...    31   3.8  
BC004229-1|AAH04229.2|  472|Homo sapiens GLTSCR2 protein protein.      31   3.8  
AY535000-1|AAS46028.1|  478|Homo sapiens preS1 binding protein p...    31   3.8  
AL359336-1|CAB94787.1|  467|Homo sapiens  GLTSCR2, glioma tumor ...    31   3.8  
AL359335-1|CAB94786.1|  459|Homo sapiens  GLTSCR2, glioma tumor ...    31   3.8  
AF182076-1|AAF62873.1|  478|Homo sapiens glioma tumor suppressor...    31   3.8  
BC017847-1|AAH17847.1|  447|Homo sapiens Unknown (protein for IM...    30   5.0  
AL645487-1|CAH72345.1| 3117|Homo sapiens centrosomal protein 350...    30   5.0  
AL590632-2|CAI15177.1| 3117|Homo sapiens centrosomal protein 350...    30   5.0  
AL390718-2|CAI14834.1| 1291|Homo sapiens centrosomal protein 350...    30   5.0  
AL390718-1|CAI14833.1| 3117|Homo sapiens centrosomal protein 350...    30   5.0  
BC073135-1|AAH73135.1|  321|Homo sapiens solute carrier family 2...    30   6.7  
BC040501-1|AAH40501.2| 1700|Homo sapiens leucine rich repeat con...    30   6.7  
BC004991-1|AAH04991.1|  321|Homo sapiens solute carrier family 2...    30   6.7  
AL954705-5|CAI17271.1|  321|Homo sapiens novel mitochondrial car...    30   6.7  
AL928921-1|CAI17318.1|  321|Homo sapiens novel mitochondrial car...    30   6.7  
AJ880283-1|CAI54244.1|  321|Homo sapiens PNC1 protein protein.         30   6.7  
AF495714-1|AAM18051.1|  321|Homo sapiens mitochondrial carrier p...    30   6.7  
AF287356-1|AAL55733.1| 3117|Homo sapiens centrosome-associated p...    30   6.7  
AB007949-1|BAA32325.2| 1288|Homo sapiens KIAA0480 protein protein.     30   6.7  

>AK124538-1|BAC85878.1|  256|Homo sapiens protein ( Homo sapiens
           cDNA FLJ42547 fis, clone BRACE3004880. ).
          Length = 256

 Score = 33.1 bits (72), Expect = 0.71
 Identities = 23/70 (32%), Positives = 44/70 (62%), Gaps = 4/70 (5%)
 Frame = -2

Query: 263 ITLNDGLISS-TITLTGMSMTSFLFARRLLSMSLMVLAWS---MSSCSLDKLSTTFKGLS 96
           +TL+   +SS T++  G+S T+ LFA RL S+++   + S   +S+C L +++ +  GLS
Sbjct: 111 VTLSACCLSSMTLSACGLSSTT-LFACRLSSVTVSTCSLSSVTLSACGLSRVTLSACGLS 169

Query: 95  SASGTLSGMA 66
           S + +  G++
Sbjct: 170 SMTPSACGLS 179


>AK074076-1|BAB84902.1|  772|Homo sapiens FLJ00147 protein protein.
          Length = 772

 Score = 31.9 bits (69), Expect = 1.6
 Identities = 21/60 (35%), Positives = 30/60 (50%)
 Frame = +3

Query: 258 SDLENVEVPDENEEIKRPLVDLRNPGPPQHQEHETQNPEHHEDAEKIVSSVKNDINTAEI 437
           SD EN+E P  NE      VD R       Q  +T +PE+ +  E+  S V ND +T+ +
Sbjct: 300 SDFENIESP-LNERDSSASVDNRE----LEQHIQTSDPENFQSEERSDSDVNNDRSTSSV 354


>AK027561-1|BAB55198.1|  819|Homo sapiens protein ( Homo sapiens
           cDNA FLJ14655 fis, clone NT2RP2002292. ).
          Length = 819

 Score = 31.9 bits (69), Expect = 1.6
 Identities = 18/46 (39%), Positives = 26/46 (56%), Gaps = 7/46 (15%)
 Frame = +3

Query: 258 SDLENVEVP------DENEEIKRPLV-DLRNPGPPQHQEHETQNPE 374
           SD E+ E P       ENEE+ RP + D  +  PP+HQ  +++N E
Sbjct: 222 SDSESEEPPRHQASDSENEELPRPRISDSESEDPPRHQASDSENEE 267



 Score = 30.7 bits (66), Expect = 3.8
 Identities = 18/46 (39%), Positives = 26/46 (56%), Gaps = 7/46 (15%)
 Frame = +3

Query: 258 SDLENVEVP------DENEEIKRPLV-DLRNPGPPQHQEHETQNPE 374
           SD EN E P       E+EE+ +P V D  +  PP+HQ  +++N E
Sbjct: 196 SDSENEEPPKPRMSDSESEELPKPQVSDSESEEPPRHQASDSENEE 241


>AK027362-1|BAB55063.1| 1287|Homo sapiens protein ( Homo sapiens
           cDNA FLJ14456 fis, clone HEMBB1001915, moderately
           similar to UBIQUITIN CARBOXYL-TERMINAL HYDROLASE 64E (EC
           3.1.2.15). ).
          Length = 1287

 Score = 31.9 bits (69), Expect = 1.6
 Identities = 21/60 (35%), Positives = 30/60 (50%)
 Frame = +3

Query: 258 SDLENVEVPDENEEIKRPLVDLRNPGPPQHQEHETQNPEHHEDAEKIVSSVKNDINTAEI 437
           SD EN+E P  NE      VD R       Q  +T +PE+ +  E+  S V ND +T+ +
Sbjct: 815 SDFENIESP-LNERDSSASVDNRE----LEQHIQTSDPENFQSEERSDSDVNNDRSTSSV 869


>AF059318-1|AAG43115.1|  212|Homo sapiens My002 protein protein.
          Length = 212

 Score = 31.9 bits (69), Expect = 1.6
 Identities = 21/60 (35%), Positives = 30/60 (50%)
 Frame = +3

Query: 258 SDLENVEVPDENEEIKRPLVDLRNPGPPQHQEHETQNPEHHEDAEKIVSSVKNDINTAEI 437
           SD EN+E P  NE      VD R       Q  +T +PE+ +  E+  S V ND +T+ +
Sbjct: 100 SDFENIESP-LNERDSSASVDNRE----LEQHIQTSDPENFQSEERSDSDVNNDRSTSSV 154


>AB037837-1|BAA92654.1| 1967|Homo sapiens KIAA1416 protein protein.
          Length = 1967

 Score = 31.9 bits (69), Expect = 1.6
 Identities = 15/59 (25%), Positives = 28/59 (47%)
 Frame = +3

Query: 294  EEIKRPLVDLRNPGPPQHQEHETQNPEHHEDAEKIVSSVKNDINTAEIALRQGFQEVSD 470
            EE + P    +  G  + +E +    E  ++ E   SSVKN++   E+    G + +S+
Sbjct: 1414 EEPENPAAKEKCEGKEEEEETDGSGKESKQECEAEASSVKNELKGVEVGADTGSKSISE 1472


>Z83689-1|CAB69660.1| 1211|Homo sapiens AF-4 protein.
          Length = 1211

 Score = 30.7 bits (66), Expect = 3.8
 Identities = 19/93 (20%), Positives = 36/93 (38%)
 Frame = +3

Query: 264  LENVEVPDENEEIKRPLVDLRNPGPPQHQEHETQNPEHHEDAEKIVSSVKNDINTAEIAL 443
            L  +  P      +R   D + P   +H   +  +    + A+K     + D +  +I L
Sbjct: 770  LSRIPQPPGKGSRQRKAEDKQPPAGKKHSSEKRSSDSSSKLAKKRKGEAERDCDNKKIRL 829

Query: 444  RQGFQEVSDGIGKWYARTEQIKSSRPACNISKK 542
             +  +  S      +  + + K SRP+   SKK
Sbjct: 830  EKEIKSQSSSSSSSHKESSKTKPSRPSSQSSKK 862


>L25050-1|AAA36642.1| 1206|Homo sapiens serine/proline-rich protein
            protein.
          Length = 1206

 Score = 30.7 bits (66), Expect = 3.8
 Identities = 19/93 (20%), Positives = 36/93 (38%)
 Frame = +3

Query: 264  LENVEVPDENEEIKRPLVDLRNPGPPQHQEHETQNPEHHEDAEKIVSSVKNDINTAEIAL 443
            L  +  P      +R   D + P   +H   +  +    + A+K     + D +  +I L
Sbjct: 770  LSRIPQPPGKGSRQRKAEDKQPPAGKKHSSEKRSSDSSSKLAKKRKGEAERDCDNKKIRL 829

Query: 444  RQGFQEVSDGIGKWYARTEQIKSSRPACNISKK 542
             +  +  S      +  + + K SRP+   SKK
Sbjct: 830  EKEIKSQSSSSSSSHKESSKTKPSRPSSQSSKK 862


>L22179-1|AAC37520.1| 2311|Homo sapiens MLL-AF4 der(11) fusion protein
            protein.
          Length = 2311

 Score = 30.7 bits (66), Expect = 3.8
 Identities = 19/93 (20%), Positives = 36/93 (38%)
 Frame = +3

Query: 264  LENVEVPDENEEIKRPLVDLRNPGPPQHQEHETQNPEHHEDAEKIVSSVKNDINTAEIAL 443
            L  +  P      +R   D + P   +H   +  +    + A+K     + D +  +I L
Sbjct: 1870 LSRIPQPPGKGSRQRKAEDKQPPAGKKHSSEKRSSDSSSKLAKKRKGEAERDCDNKKIRL 1929

Query: 444  RQGFQEVSDGIGKWYARTEQIKSSRPACNISKK 542
             +  +  S      +  + + K SRP+   SKK
Sbjct: 1930 EKEIKSQSSSSSSSHKESSKTKPSRPSSQSSKK 1962


>L13773-1|AAA58360.1| 1210|Homo sapiens AF-4 protein.
          Length = 1210

 Score = 30.7 bits (66), Expect = 3.8
 Identities = 19/93 (20%), Positives = 36/93 (38%)
 Frame = +3

Query: 264  LENVEVPDENEEIKRPLVDLRNPGPPQHQEHETQNPEHHEDAEKIVSSVKNDINTAEIAL 443
            L  +  P      +R   D + P   +H   +  +    + A+K     + D +  +I L
Sbjct: 770  LSRIPQPPGKGSRQRKAEDKQPPAGKKHSSEKRSSDSSSKLAKKRKGEAERDCDNKKIRL 829

Query: 444  RQGFQEVSDGIGKWYARTEQIKSSRPACNISKK 542
             +  +  S      +  + + K SRP+   SKK
Sbjct: 830  EKEIKSQSSSSSSSHKESSKTKPSRPSSQSSKK 862


>BC114930-1|AAI14931.1| 1211|Homo sapiens AF4/FMR2 family, member 1
            protein.
          Length = 1211

 Score = 30.7 bits (66), Expect = 3.8
 Identities = 19/93 (20%), Positives = 36/93 (38%)
 Frame = +3

Query: 264  LENVEVPDENEEIKRPLVDLRNPGPPQHQEHETQNPEHHEDAEKIVSSVKNDINTAEIAL 443
            L  +  P      +R   D + P   +H   +  +    + A+K     + D +  +I L
Sbjct: 770  LSRIPQPPGKGSRQRKAEDKQPPAGKKHSSEKRSSDSSSKLAKKRKGEAERDCDNKKIRL 829

Query: 444  RQGFQEVSDGIGKWYARTEQIKSSRPACNISKK 542
             +  +  S      +  + + K SRP+   SKK
Sbjct: 830  EKEIKSQSSSSSSSHKESSKTKPSRPSSQSSKK 862


>BC110537-1|AAI10538.1|  819|Homo sapiens IWS1 homolog (S.
           cerevisiae) protein.
          Length = 819

 Score = 30.7 bits (66), Expect = 3.8
 Identities = 18/46 (39%), Positives = 26/46 (56%), Gaps = 7/46 (15%)
 Frame = +3

Query: 258 SDLENVEVP------DENEEIKRPLV-DLRNPGPPQHQEHETQNPE 374
           SD EN E P       E+EE+ +P V D  +  PP+HQ  +++N E
Sbjct: 196 SDSENEEPPKPRMSDSESEELPKPQVSDSESEEPPRHQASDSENEE 241



 Score = 30.7 bits (66), Expect = 3.8
 Identities = 17/46 (36%), Positives = 26/46 (56%), Gaps = 7/46 (15%)
 Frame = +3

Query: 258 SDLENVEVP------DENEEIKRPLV-DLRNPGPPQHQEHETQNPE 374
           SD E+ E P       ENEE+ +P + D  +  PP+HQ  +++N E
Sbjct: 222 SDSESEEPPRHQASDSENEELPKPRISDSESEDPPRHQASDSENEE 267


>BC110536-1|AAI10537.1|  819|Homo sapiens IWS1 homolog (S.
           cerevisiae) protein.
          Length = 819

 Score = 30.7 bits (66), Expect = 3.8
 Identities = 18/46 (39%), Positives = 26/46 (56%), Gaps = 7/46 (15%)
 Frame = +3

Query: 258 SDLENVEVP------DENEEIKRPLV-DLRNPGPPQHQEHETQNPE 374
           SD EN E P       E+EE+ +P V D  +  PP+HQ  +++N E
Sbjct: 196 SDSENEEPPKPRMSDSESEELPKPQVSDSESEEPPRHQASDSENEE 241



 Score = 30.7 bits (66), Expect = 3.8
 Identities = 17/46 (36%), Positives = 26/46 (56%), Gaps = 7/46 (15%)
 Frame = +3

Query: 258 SDLENVEVP------DENEEIKRPLV-DLRNPGPPQHQEHETQNPE 374
           SD E+ E P       ENEE+ +P + D  +  PP+HQ  +++N E
Sbjct: 222 SDSESEEPPRHQASDSENEELPKPRISDSESEDPPRHQASDSENEE 267


>BC065279-1|AAH65279.1|  375|Homo sapiens IWS1 protein protein.
          Length = 375

 Score = 30.7 bits (66), Expect = 3.8
 Identities = 18/46 (39%), Positives = 26/46 (56%), Gaps = 7/46 (15%)
 Frame = +3

Query: 258 SDLENVEVP------DENEEIKRPLV-DLRNPGPPQHQEHETQNPE 374
           SD EN E P       E+EE+ +P V D  +  PP+HQ  +++N E
Sbjct: 196 SDSENEEPPKPRMSDSESEELPKPQVSDSESEEPPRHQASDSENEE 241



 Score = 30.7 bits (66), Expect = 3.8
 Identities = 17/46 (36%), Positives = 26/46 (56%), Gaps = 7/46 (15%)
 Frame = +3

Query: 258 SDLENVEVP------DENEEIKRPLV-DLRNPGPPQHQEHETQNPE 374
           SD E+ E P       ENEE+ +P + D  +  PP+HQ  +++N E
Sbjct: 222 SDSESEEPPRHQASDSENEELPKPRISDSESEDPPRHQASDSENEE 267


>BC014009-1|AAH14009.2|  476|Homo sapiens GLTSCR2 protein protein.
          Length = 476

 Score = 30.7 bits (66), Expect = 3.8
 Identities = 17/56 (30%), Positives = 26/56 (46%)
 Frame = +1

Query: 391 KKSFLPSKMTLTQRKSLFVKASRKCQTVLENGTLVPSKLRAPGQLATFPRKFRRSD 558
           K+  L  K T  Q+KSL +K   +   +LEN + VP+            +K RR +
Sbjct: 92  KEKGLTKKRTKVQKKSLLLKKPLRVDLILENTSKVPAPKDVLAHQVPNAKKLRRKE 147


>BC010095-1|AAH10095.1|  478|Homo sapiens glioma tumor suppressor
           candidate region gene 2 protein.
          Length = 478

 Score = 30.7 bits (66), Expect = 3.8
 Identities = 17/56 (30%), Positives = 26/56 (46%)
 Frame = +1

Query: 391 KKSFLPSKMTLTQRKSLFVKASRKCQTVLENGTLVPSKLRAPGQLATFPRKFRRSD 558
           K+  L  K T  Q+KSL +K   +   +LEN + VP+            +K RR +
Sbjct: 94  KEKGLTKKRTKVQKKSLLLKKPLRVDLILENTSKVPAPKDVLAHQVPNAKKLRRKE 149


>BC007248-1|AAH07248.1|  474|Homo sapiens glioma tumor suppressor
           candidate region gene 2 protein.
          Length = 474

 Score = 30.7 bits (66), Expect = 3.8
 Identities = 17/56 (30%), Positives = 26/56 (46%)
 Frame = +1

Query: 391 KKSFLPSKMTLTQRKSLFVKASRKCQTVLENGTLVPSKLRAPGQLATFPRKFRRSD 558
           K+  L  K T  Q+KSL +K   +   +LEN + VP+            +K RR +
Sbjct: 90  KEKGLTKKRTKVQKKSLLLKKPLRVDLILENTSKVPAPKDVLAHQVPNAKKLRRKE 145


>BC006311-1|AAH06311.1|  478|Homo sapiens glioma tumor suppressor
           candidate region gene 2 protein.
          Length = 478

 Score = 30.7 bits (66), Expect = 3.8
 Identities = 17/56 (30%), Positives = 26/56 (46%)
 Frame = +1

Query: 391 KKSFLPSKMTLTQRKSLFVKASRKCQTVLENGTLVPSKLRAPGQLATFPRKFRRSD 558
           K+  L  K T  Q+KSL +K   +   +LEN + VP+            +K RR +
Sbjct: 94  KEKGLTKKRTKVQKKSLLLKKPLRVDLILENTSKVPAPKDVLAHQVPNAKKLRRKE 149


>BC004229-1|AAH04229.2|  472|Homo sapiens GLTSCR2 protein protein.
          Length = 472

 Score = 30.7 bits (66), Expect = 3.8
 Identities = 17/56 (30%), Positives = 26/56 (46%)
 Frame = +1

Query: 391 KKSFLPSKMTLTQRKSLFVKASRKCQTVLENGTLVPSKLRAPGQLATFPRKFRRSD 558
           K+  L  K T  Q+KSL +K   +   +LEN + VP+            +K RR +
Sbjct: 88  KEKGLTKKRTKVQKKSLLLKKPLRVDLILENTSKVPAPKDVLAHQVPNAKKLRRKE 143


>AY535000-1|AAS46028.1|  478|Homo sapiens preS1 binding protein
           protein.
          Length = 478

 Score = 30.7 bits (66), Expect = 3.8
 Identities = 17/56 (30%), Positives = 26/56 (46%)
 Frame = +1

Query: 391 KKSFLPSKMTLTQRKSLFVKASRKCQTVLENGTLVPSKLRAPGQLATFPRKFRRSD 558
           K+  L  K T  Q+KSL +K   +   +LEN + VP+            +K RR +
Sbjct: 94  KEKGLTKKRTKVQKKSLLLKKPLRVDLILENTSKVPAPKDVLAHQVPNAKKLRRKE 149


>AL359336-1|CAB94787.1|  467|Homo sapiens  GLTSCR2, glioma tumor
           suppressor candidate region protein 2 (AF182076_1)
           protein.
          Length = 467

 Score = 30.7 bits (66), Expect = 3.8
 Identities = 17/56 (30%), Positives = 26/56 (46%)
 Frame = +1

Query: 391 KKSFLPSKMTLTQRKSLFVKASRKCQTVLENGTLVPSKLRAPGQLATFPRKFRRSD 558
           K+  L  K T  Q+KSL +K   +   +LEN + VP+            +K RR +
Sbjct: 83  KEKGLTKKRTKVQKKSLLLKKPLRVDLILENTSKVPAPKDVLAHQVPNAKKLRRKE 138


>AL359335-1|CAB94786.1|  459|Homo sapiens  GLTSCR2, glioma tumor
           suppressor candidate region protein 2 (AF182076_1)
           protein.
          Length = 459

 Score = 30.7 bits (66), Expect = 3.8
 Identities = 17/56 (30%), Positives = 26/56 (46%)
 Frame = +1

Query: 391 KKSFLPSKMTLTQRKSLFVKASRKCQTVLENGTLVPSKLRAPGQLATFPRKFRRSD 558
           K+  L  K T  Q+KSL +K   +   +LEN + VP+            +K RR +
Sbjct: 75  KEKGLTKKRTKVQKKSLLLKKPLRVDLILENTSKVPAPKDVLAHQVPNAKKLRRKE 130


>AF182076-1|AAF62873.1|  478|Homo sapiens glioma tumor suppressor
           candidate region protein 2 protein.
          Length = 478

 Score = 30.7 bits (66), Expect = 3.8
 Identities = 17/56 (30%), Positives = 26/56 (46%)
 Frame = +1

Query: 391 KKSFLPSKMTLTQRKSLFVKASRKCQTVLENGTLVPSKLRAPGQLATFPRKFRRSD 558
           K+  L  K T  Q+KSL +K   +   +LEN + VP+            +K RR +
Sbjct: 94  KEKGLTKKRTKVQKKSLLLKKPLRVDLILENTSKVPAPKDVLAHQVPNAKKLRRKE 149


>BC017847-1|AAH17847.1|  447|Homo sapiens Unknown (protein for
           IMAGE:4288585) protein.
          Length = 447

 Score = 30.3 bits (65), Expect = 5.0
 Identities = 20/98 (20%), Positives = 42/98 (42%), Gaps = 1/98 (1%)
 Frame = +3

Query: 255 KSDLENVEVPDENEEIKRPLVDLRNPGPPQHQEHETQNPEHHEDAEKIVSSVKNDINTAE 434
           K  ++ +    E  +IK PL  L      ++ +  T++       E I   V   ++ +E
Sbjct: 293 KPQIKTLSSASEKPKIK-PLTPLHRSETAKNWKSLTESERSRGSLESIAEHVDASLSGSE 351

Query: 435 IALRQ-GFQEVSDGIGKWYARTEQIKSSRPACNISKKI 545
            ++ +      +  + +W +RTE  ++  P    S+KI
Sbjct: 352 RSVSERSLSAYAKRVNEWDSRTEDFQTPSPVLRSSRKI 389


>AL645487-1|CAH72345.1| 3117|Homo sapiens centrosomal protein 350kDa
            protein.
          Length = 3117

 Score = 30.3 bits (65), Expect = 5.0
 Identities = 20/98 (20%), Positives = 42/98 (42%), Gaps = 1/98 (1%)
 Frame = +3

Query: 255  KSDLENVEVPDENEEIKRPLVDLRNPGPPQHQEHETQNPEHHEDAEKIVSSVKNDINTAE 434
            K  ++ +    E  +IK PL  L      ++ +  T++       E I   V   ++ +E
Sbjct: 2119 KPQIKTLSSASEKPKIK-PLTPLHRSETAKNWKSLTESERSRGSLESIAEHVDASLSGSE 2177

Query: 435  IALRQ-GFQEVSDGIGKWYARTEQIKSSRPACNISKKI 545
             ++ +      +  + +W +RTE  ++  P    S+KI
Sbjct: 2178 RSVSERSLSAYAKRVNEWDSRTEDFQTPSPVLRSSRKI 2215


>AL590632-2|CAI15177.1| 3117|Homo sapiens centrosomal protein 350kDa
            protein.
          Length = 3117

 Score = 30.3 bits (65), Expect = 5.0
 Identities = 20/98 (20%), Positives = 42/98 (42%), Gaps = 1/98 (1%)
 Frame = +3

Query: 255  KSDLENVEVPDENEEIKRPLVDLRNPGPPQHQEHETQNPEHHEDAEKIVSSVKNDINTAE 434
            K  ++ +    E  +IK PL  L      ++ +  T++       E I   V   ++ +E
Sbjct: 2119 KPQIKTLSSASEKPKIK-PLTPLHRSETAKNWKSLTESERSRGSLESIAEHVDASLSGSE 2177

Query: 435  IALRQ-GFQEVSDGIGKWYARTEQIKSSRPACNISKKI 545
             ++ +      +  + +W +RTE  ++  P    S+KI
Sbjct: 2178 RSVSERSLSAYAKRVNEWDSRTEDFQTPSPVLRSSRKI 2215


>AL390718-2|CAI14834.1| 1291|Homo sapiens centrosomal protein 350kDa
           protein.
          Length = 1291

 Score = 30.3 bits (65), Expect = 5.0
 Identities = 20/98 (20%), Positives = 42/98 (42%), Gaps = 1/98 (1%)
 Frame = +3

Query: 255 KSDLENVEVPDENEEIKRPLVDLRNPGPPQHQEHETQNPEHHEDAEKIVSSVKNDINTAE 434
           K  ++ +    E  +IK PL  L      ++ +  T++       E I   V   ++ +E
Sbjct: 293 KPQIKTLSSASEKPKIK-PLTPLHRSETAKNWKSLTESERSRGSLESIAEHVDASLSGSE 351

Query: 435 IALRQ-GFQEVSDGIGKWYARTEQIKSSRPACNISKKI 545
            ++ +      +  + +W +RTE  ++  P    S+KI
Sbjct: 352 RSVSERSLSAYAKRVNEWDSRTEDFQTPSPVLRSSRKI 389


>AL390718-1|CAI14833.1| 3117|Homo sapiens centrosomal protein 350kDa
            protein.
          Length = 3117

 Score = 30.3 bits (65), Expect = 5.0
 Identities = 20/98 (20%), Positives = 42/98 (42%), Gaps = 1/98 (1%)
 Frame = +3

Query: 255  KSDLENVEVPDENEEIKRPLVDLRNPGPPQHQEHETQNPEHHEDAEKIVSSVKNDINTAE 434
            K  ++ +    E  +IK PL  L      ++ +  T++       E I   V   ++ +E
Sbjct: 2119 KPQIKTLSSASEKPKIK-PLTPLHRSETAKNWKSLTESERSRGSLESIAEHVDASLSGSE 2177

Query: 435  IALRQ-GFQEVSDGIGKWYARTEQIKSSRPACNISKKI 545
             ++ +      +  + +W +RTE  ++  P    S+KI
Sbjct: 2178 RSVSERSLSAYAKRVNEWDSRTEDFQTPSPVLRSSRKI 2215


>BC073135-1|AAH73135.1|  321|Homo sapiens solute carrier family 25,
           member 33 protein.
          Length = 321

 Score = 29.9 bits (64), Expect = 6.7
 Identities = 21/65 (32%), Positives = 29/65 (44%), Gaps = 1/65 (1%)
 Frame = -2

Query: 233 TITLTGMSMTSFLFA-RRLLSMSLMVLAWSMSSCSLDKLSTTFKGLSSASGTLSGMAGCA 57
           T +  G+S T   FA    L   L     + S+   +K ST+F GL +A+    G A C 
Sbjct: 191 TASYAGISETIICFAIYESLKKYLKEAPLASSANGTEKNSTSFFGLMAAAALSKGCASCI 250

Query: 56  CGEHE 42
              HE
Sbjct: 251 AYPHE 255


>BC040501-1|AAH40501.2| 1700|Homo sapiens leucine rich repeat
           containing 37A protein.
          Length = 1700

 Score = 29.9 bits (64), Expect = 6.7
 Identities = 12/45 (26%), Positives = 21/45 (46%), Gaps = 1/45 (2%)
 Frame = +3

Query: 252 VKSDLENVEVPDENEEIKRPLVDLRNPG-PPQHQEHETQNPEHHE 383
           +    + V+  + + E++  L     PG PP+H E     P HH+
Sbjct: 357 ISEQQQPVQPSESSREVESSLTQQETPGQPPEHHEVTVSPPGHHQ 401


>BC004991-1|AAH04991.1|  321|Homo sapiens solute carrier family 25,
           member 33 protein.
          Length = 321

 Score = 29.9 bits (64), Expect = 6.7
 Identities = 21/65 (32%), Positives = 29/65 (44%), Gaps = 1/65 (1%)
 Frame = -2

Query: 233 TITLTGMSMTSFLFA-RRLLSMSLMVLAWSMSSCSLDKLSTTFKGLSSASGTLSGMAGCA 57
           T +  G+S T   FA    L   L     + S+   +K ST+F GL +A+    G A C 
Sbjct: 191 TASYAGISETIICFAIYESLKKYLKEAPLASSANGTEKNSTSFFGLMAAAALSKGCASCI 250

Query: 56  CGEHE 42
              HE
Sbjct: 251 AYPHE 255


>AL954705-5|CAI17271.1|  321|Homo sapiens novel mitochondrial
           carrier protein protein.
          Length = 321

 Score = 29.9 bits (64), Expect = 6.7
 Identities = 21/65 (32%), Positives = 29/65 (44%), Gaps = 1/65 (1%)
 Frame = -2

Query: 233 TITLTGMSMTSFLFA-RRLLSMSLMVLAWSMSSCSLDKLSTTFKGLSSASGTLSGMAGCA 57
           T +  G+S T   FA    L   L     + S+   +K ST+F GL +A+    G A C 
Sbjct: 191 TASYAGISETIICFAIYESLKKYLKEAPLASSANGTEKNSTSFFGLMAAAALSKGCASCI 250

Query: 56  CGEHE 42
              HE
Sbjct: 251 AYPHE 255


>AL928921-1|CAI17318.1|  321|Homo sapiens novel mitochondrial
           carrier protein protein.
          Length = 321

 Score = 29.9 bits (64), Expect = 6.7
 Identities = 21/65 (32%), Positives = 29/65 (44%), Gaps = 1/65 (1%)
 Frame = -2

Query: 233 TITLTGMSMTSFLFA-RRLLSMSLMVLAWSMSSCSLDKLSTTFKGLSSASGTLSGMAGCA 57
           T +  G+S T   FA    L   L     + S+   +K ST+F GL +A+    G A C 
Sbjct: 191 TASYAGISETIICFAIYESLKKYLKEAPLASSANGTEKNSTSFFGLMAAAALSKGCASCI 250

Query: 56  CGEHE 42
              HE
Sbjct: 251 AYPHE 255


>AJ880283-1|CAI54244.1|  321|Homo sapiens PNC1 protein protein.
          Length = 321

 Score = 29.9 bits (64), Expect = 6.7
 Identities = 21/65 (32%), Positives = 29/65 (44%), Gaps = 1/65 (1%)
 Frame = -2

Query: 233 TITLTGMSMTSFLFA-RRLLSMSLMVLAWSMSSCSLDKLSTTFKGLSSASGTLSGMAGCA 57
           T +  G+S T   FA    L   L     + S+   +K ST+F GL +A+    G A C 
Sbjct: 191 TASYAGISETIICFAIYESLKKYLKEAPLASSANGTEKNSTSFFGLMAAAALSKGCASCI 250

Query: 56  CGEHE 42
              HE
Sbjct: 251 AYPHE 255


>AF495714-1|AAM18051.1|  321|Homo sapiens mitochondrial carrier
           protein protein.
          Length = 321

 Score = 29.9 bits (64), Expect = 6.7
 Identities = 21/65 (32%), Positives = 29/65 (44%), Gaps = 1/65 (1%)
 Frame = -2

Query: 233 TITLTGMSMTSFLFA-RRLLSMSLMVLAWSMSSCSLDKLSTTFKGLSSASGTLSGMAGCA 57
           T +  G+S T   FA    L   L     + S+   +K ST+F GL +A+    G A C 
Sbjct: 191 TASYAGISETIICFAIYESLKKYLKEAPLASSANGTEKNSTSFFGLMAAAALSKGCASCI 250

Query: 56  CGEHE 42
              HE
Sbjct: 251 AYPHE 255


>AF287356-1|AAL55733.1| 3117|Homo sapiens centrosome-associated
            protein 350 protein.
          Length = 3117

 Score = 29.9 bits (64), Expect = 6.7
 Identities = 20/98 (20%), Positives = 42/98 (42%), Gaps = 1/98 (1%)
 Frame = +3

Query: 255  KSDLENVEVPDENEEIKRPLVDLRNPGPPQHQEHETQNPEHHEDAEKIVSSVKNDINTAE 434
            K  ++ +    E  +IK PL  L      ++ +  T++       E I   V   ++ +E
Sbjct: 2119 KPQIKTLSSASEKPKIK-PLTPLHRSETAKNWKSLTESERSRGSLEPIAEHVDASLSGSE 2177

Query: 435  IALRQ-GFQEVSDGIGKWYARTEQIKSSRPACNISKKI 545
             ++ +      +  + +W +RTE  ++  P    S+KI
Sbjct: 2178 RSVSERSLSAYAKRVNEWDSRTEDFQTPSPVLRSSRKI 2215


>AB007949-1|BAA32325.2| 1288|Homo sapiens KIAA0480 protein protein.
          Length = 1288

 Score = 29.9 bits (64), Expect = 6.7
 Identities = 20/98 (20%), Positives = 42/98 (42%), Gaps = 1/98 (1%)
 Frame = +3

Query: 255 KSDLENVEVPDENEEIKRPLVDLRNPGPPQHQEHETQNPEHHEDAEKIVSSVKNDINTAE 434
           K  ++ +    E  +IK PL  L      ++ +  T++       E I   V   ++ +E
Sbjct: 290 KPQIKTLSSASEKPKIK-PLTPLHRSETAKNWKSLTESERSRGSLEPIAEHVDASLSGSE 348

Query: 435 IALRQ-GFQEVSDGIGKWYARTEQIKSSRPACNISKKI 545
            ++ +      +  + +W +RTE  ++  P    S+KI
Sbjct: 349 RSVSERSLSAYAKRVNEWDSRTEDFQTPSPVLRSSRKI 386


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 70,665,732
Number of Sequences: 237096
Number of extensions: 1335620
Number of successful extensions: 4733
Number of sequences better than 10.0: 37
Number of HSP's better than 10.0 without gapping: 4431
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4726
length of database: 76,859,062
effective HSP length: 86
effective length of database: 56,468,806
effective search space used: 5872755824
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -