SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20056
         (750 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Y00371-1|CAA68445.1|  646|Homo sapiens 71 Kd heat shock cognate ...   132   2e-30
BC019816-1|AAH19816.1|  646|Homo sapiens heat shock 70kDa protei...   132   2e-30
BC016660-1|AAH16660.1|  646|Homo sapiens heat shock 70kDa protei...   132   2e-30
BC016179-1|AAH16179.1|  646|Homo sapiens heat shock 70kDa protei...   132   2e-30
AK222785-1|BAD96505.1|  646|Homo sapiens heat shock 70kDa protei...   132   2e-30
AK222628-1|BAD96348.1|  493|Homo sapiens heat shock 70kDa protei...   132   2e-30
AF352832-1|AAK17898.1|  646|Homo sapiens constitutive heat shock...   132   2e-30
AB034951-1|BAB18615.1|  493|Homo sapiens heat shock cognate prot...   132   2e-30
U56725-1|AAD11466.1|  639|Homo sapiens heat shock protein protein.    129   9e-30
L26336-1|AAA52698.1|  639|Homo sapiens heat shock protein protein.    129   9e-30
DQ489378-1|ABE96830.1|  639|Homo sapiens heat shock 70kDa protei...   129   9e-30
BT009815-1|AAP88817.1|  639|Homo sapiens heat shock 70kDa protei...   129   9e-30
BC001752-1|AAH01752.1|  639|Homo sapiens heat shock 70kDa protei...   129   9e-30
M11717-1|AAA52697.1|  640|Homo sapiens heat shock protein protein.    128   2e-29
M59830-1|AAA63227.1|  641|Homo sapiens heat shock-induced protei...   128   3e-29
M59828-1|AAA63226.1|  641|Homo sapiens heat shock-induced protei...   128   3e-29
DQ451402-1|ABD96830.1|  641|Homo sapiens heat shock 70kDa protei...   128   3e-29
DQ388429-1|ABD48956.1|  641|Homo sapiens heat shock 70kDa protei...   128   3e-29
BC063507-1|AAH63507.1|  641|Homo sapiens heat shock 70kDa protei...   128   3e-29
BC057397-1|AAH57397.1|  641|Homo sapiens heat shock 70kDa protei...   128   3e-29
BC018740-1|AAH18740.1|  641|Homo sapiens HSPA1A protein protein.      128   3e-29
BC009322-1|AAH09322.1|  641|Homo sapiens HSPA1A protein protein.      128   3e-29
BC002453-1|AAH02453.1|  641|Homo sapiens heat shock 70kDa protei...   128   3e-29
BA000025-9|BAB63300.1|  641|Homo sapiens heat shock protein prot...   128   3e-29
BA000025-8|BAB63299.1|  641|Homo sapiens heat shock protein prot...   128   3e-29
AL929592-7|CAI18466.1|  641|Homo sapiens heat shock 70kDa protei...   128   3e-29
AL929592-5|CAI18464.1|  641|Homo sapiens heat shock 70kDa protei...   128   3e-29
AL671762-7|CAI18217.1|  641|Homo sapiens heat shock 70kDa protei...   128   3e-29
AL671762-6|CAI18216.1|  641|Homo sapiens heat shock 70kDa protei...   128   3e-29
AL662834-18|CAI17738.1|  641|Homo sapiens heat shock 70kDa prote...   128   3e-29
AL662834-17|CAI17737.1|  641|Homo sapiens heat shock 70kDa prote...   128   3e-29
AF134726-7|AAD21816.1|  641|Homo sapiens HSP70-1 protein.             128   3e-29
AF134726-6|AAD21815.1|  641|Homo sapiens HSP70-2 protein.             128   3e-29
AB209818-1|BAD93055.1|  709|Homo sapiens heat shock 70kDa protei...   128   3e-29
BC036107-1|AAH36107.1|  639|Homo sapiens HSPA2 protein protein.       127   5e-29
M59829-1|AAA63228.1|  641|Homo sapiens heat shock-induced protei...   124   3e-28
D85730-1|BAA32521.1|  641|Homo sapiens Heat shock protein 70 tes...   124   3e-28
DQ383515-1|ABC88476.1|  641|Homo sapiens heat shock 70kDa protei...   124   3e-28
BC034483-1|AAH34483.1|  641|Homo sapiens heat shock 70kDa protei...   124   3e-28
BA000025-10|BAB63301.1|  641|Homo sapiens heat shock protein pro...   124   3e-28
AL929592-4|CAI18463.1|  641|Homo sapiens heat shock 70kDa protei...   124   3e-28
AL671762-4|CAI18215.1|  641|Homo sapiens heat shock 70kDa protei...   124   3e-28
AL662834-15|CAI17736.1|  641|Homo sapiens heat shock 70kDa prote...   124   3e-28
AK223386-1|BAD97106.1|  641|Homo sapiens heat shock 70kDa protei...   124   3e-28
AF134726-8|AAD21817.1|  641|Homo sapiens HSP70-HOM protein.           124   3e-28
U10149-1|AAC50076.1|  125|Homo sapiens heat shock protein protein.    122   1e-27
M11236-1|AAA52696.1|  247|Homo sapiens HSPA1L protein.                114   4e-25
X51757-1|CAA36061.1|  643|Homo sapiens protein ( Human heat-shoc...   113   5e-25
DQ521571-1|ABF47108.1|  643|Homo sapiens heat shock 70kDa protei...   113   5e-25
BC035665-1|AAH35665.1|  643|Homo sapiens heat shock 70kDa protei...   113   5e-25
AL590385-3|CAI16120.1|  643|Homo sapiens heat shock 70kDa protei...   113   5e-25
AK223362-1|BAD97082.1|  643|Homo sapiens heat shock 70kDa protei...   112   1e-24
AB018045-1|BAA77235.1|  151|Homo sapiens heat shock protein 72 p...   111   2e-24
BC007276-1|AAH07276.2|  587|Homo sapiens HSPA8 protein protein.       110   5e-24
X87949-1|CAA61201.1|  653|Homo sapiens BiP protein.                   105   2e-22
M19645-1|AAA52614.1|  653|Homo sapiens protein ( Human 78 kdalto...   105   2e-22
DQ385847-1|ABD04090.1|  654|Homo sapiens heat shock 70kDa protei...   105   2e-22
BC112963-1|AAI12964.1|  655|Homo sapiens HSPA5 protein protein.       105   2e-22
BC020235-1|AAH20235.1|  654|Homo sapiens heat shock 70kDa protei...   105   2e-22
AJ271729-1|CAB71335.1|  654|Homo sapiens glucose-regulated prote...   105   2e-22
AF216292-1|AAF42836.1|  654|Homo sapiens endoplasmic reticulum l...   105   2e-22
AF188611-1|AAF13605.1|  639|Homo sapiens BiP protein protein.         105   2e-22
L15189-1|AAA67526.1|  679|Homo sapiens MTHSP75 protein.                92   2e-18
DQ531046-1|ABF50973.1|  679|Homo sapiens heat shock 70kDa protei...    92   2e-18
BC030634-1|AAH30634.1|  681|Homo sapiens HSPA9 protein protein.        92   2e-18
BC024034-1|AAH24034.1|  679|Homo sapiens heat shock 70kDa protei...    92   2e-18
BC000478-1|AAH00478.1|  679|Homo sapiens heat shock 70kDa protei...    92   2e-18
DQ185038-1|ABD14419.1|  176|Homo sapiens heat shock 70 kDa prote...    90   9e-18
AK222758-1|BAD96478.1|  679|Homo sapiens heat shock 70kDa protei...    90   9e-18
M24743-1|AAA59844.1|   36|Homo sapiens HSPA2 protein.                  76   1e-13
U04735-1|AAA16954.1|  471|Homo sapiens microsomal stress 70 prot...    62   2e-09
BC036370-1|AAH36370.1|  471|Homo sapiens stress 70 protein chape...    62   2e-09
AL163206-1|CAB90390.1|  471|Homo sapiens human microsomal stress...    62   2e-09
AK223282-1|BAD97002.1|  471|Homo sapiens stress 70 protein chape...    62   2e-09
AF130249-1|AAD21091.1|  471|Homo sapiens STCH protein.                 62   2e-09
BC119690-1|AAI19691.1|  509|Homo sapiens heat shock 70kDa protei...    60   1e-08
BC108738-1|AAI08739.1|   88|Homo sapiens HSPA14 protein protein.       60   1e-08
BC065281-1|AAH65281.1|   88|Homo sapiens HSPA14 protein protein.       60   1e-08
AF112210-1|AAF17198.1|  509|Homo sapiens heat shock protein hsp7...    60   1e-08
AF143723-1|AAF66640.1|  509|Homo sapiens heat shock protein HSP6...    57   6e-08
AL929592-6|CAI18465.1|  476|Homo sapiens heat shock 70kDa protei...    55   2e-07
AL671762-5|CAM25532.1|  476|Homo sapiens heat shock 70kDa protei...    55   2e-07
AL662834-16|CAM24989.1|  476|Homo sapiens heat shock 70kDa prote...    55   2e-07
U65785-1|AAC50947.1|  999|Homo sapiens 150 kDa oxygen-regulated ...    55   3e-07
DQ372932-1|ABD14370.1|  999|Homo sapiens 150 kDa oxygen-regulate...    55   3e-07
DQ350134-1|ABC75106.1|  999|Homo sapiens 150 kDa oxygen-regulate...    55   3e-07
BC072436-1|AAH72436.1|  678|Homo sapiens HYOU1 protein protein.        55   3e-07
BC017726-1|AAH17726.1|  657|Homo sapiens Unknown (protein for IM...    55   3e-07
AK222756-1|BAD96476.1|  999|Homo sapiens oxygen regulated protei...    55   3e-07
L12723-1|AAA02807.1|  701|Homo sapiens heat shock protein 70 pro...    51   5e-06
EF197155-1|ABM69040.1|  839|Homo sapiens heat shock 70 kDa prote...    51   5e-06
D86956-1|BAA13192.2|  949|Homo sapiens KIAA0201 protein.               51   5e-06
BC040560-1|AAH40560.1|  839|Homo sapiens heat shock 70kDa protei...    51   5e-06
BC037553-1|AAH37553.1|  858|Homo sapiens heat shock 105kDa/110kD...    51   5e-06
AY290862-1|AAP44471.1|  839|Homo sapiens heat shock protein apg-...    51   5e-06
AL137142-5|CAI12430.1|  858|Homo sapiens heat shock 105kDa/110kD...    51   5e-06
AL137142-4|CAI12428.1|  814|Homo sapiens heat shock 105kDa/110kD...    51   5e-06
AF039695-1|AAC18044.1|  872|Homo sapiens antigen NY-CO-25 protein.     51   5e-06
AC093591-2|AAY40975.1|  839|Homo sapiens unknown protein.              51   5e-06
AB023421-1|BAA75063.1|  839|Homo sapiens apg-1 protein.                51   5e-06
AB003334-1|BAA34780.1|  858|Homo sapiens HSP105 alpha protein.         51   5e-06
AB003333-1|BAA34779.1|  814|Homo sapiens HSP105 beta protein.          51   5e-06
X67643-1|CAA47886.1|  474|Homo sapiens HS24/P52 protein.               50   7e-06
X67640-1|CAA47885.1|  266|Homo sapiens HS24/P52 protein.               50   7e-06
BC126124-1|AAI26125.1|  840|Homo sapiens heat shock 70kDa protei...    50   7e-06
BC126122-1|AAI26123.1|  840|Homo sapiens heat shock 70kDa protei...    50   7e-06
BC110861-1|AAI10862.1|  840|Homo sapiens heat shock 70kDa protei...    50   7e-06
AB209151-1|BAD92388.1|  782|Homo sapiens heat shock 70kDa protei...    50   7e-06
AB023420-1|BAA75062.1|  840|Homo sapiens apg-2 protein.                50   7e-06
AL137142-3|CAI12429.1|  817|Homo sapiens heat shock 105kDa/110kD...    48   3e-05
BT007375-1|AAP36039.1|  148|Homo sapiens heat shock protein, 110...    48   4e-05
BC002526-1|AAH02526.1|  148|Homo sapiens heat shock 70kDa protei...    48   4e-05
X04676-1|CAA28381.1|   22|Homo sapiens protein ( Human hsp 70 ge...    47   8e-05
BC004560-1|AAH04560.1|  147|Homo sapiens HYOU1 protein protein.        37   0.067
BC103893-1|AAI03894.1|  346|Homo sapiens MAGEC3 protein protein.       33   1.4  
AB037748-1|BAA92565.2| 1804|Homo sapiens KIAA1327 protein protein.     31   4.4  
U73737-1|AAB47425.1| 1360|Homo sapiens hMSH6 protein.                  30   7.7  
U54777-1|AAB39212.2| 1360|Homo sapiens hMSH6 protein protein.          30   7.7  
U28946-1|AAC50461.1| 1360|Homo sapiens G/T mismatch binding prot...    30   7.7  
D89646-1|BAA23675.1| 1068|Homo sapiens GTBP-ALT protein.               30   7.7  
D89645-2|BAA23673.1| 1068|Homo sapiens GTBP-ALT protein.               30   7.7  
D89645-1|BAA23674.1| 1360|Homo sapiens GTBP-N protein.                 30   7.7  
BC004246-1|AAH04246.1| 1360|Homo sapiens mutS homolog 6 (E. coli...    30   7.7  
AY082894-1|AAL87401.1| 1358|Homo sapiens mutS homolog 6 (E. coli...    30   7.7  

>Y00371-1|CAA68445.1|  646|Homo sapiens 71 Kd heat shock cognate
           protein protein.
          Length = 646

 Score =  132 bits (318), Expect = 2e-30
 Identities = 61/64 (95%), Positives = 62/64 (96%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           M+K PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 252 MTPT 263
           M PT
Sbjct: 61  MNPT 64



 Score =  110 bits (265), Expect = 5e-24
 Identities = 59/81 (72%), Positives = 61/81 (75%), Gaps = 1/81 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAGTI+GLNVLRIINEPTAAAIAYGLDKK   ERNVLIFDLGGGT   
Sbjct: 148 AYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDV 207

Query: 690 PSLP-SRRYLRGEIHRGDTHL 749
             L         +   GDTHL
Sbjct: 208 SILTIEDGIFEVKSTAGDTHL 228



 Score = 95.1 bits (226), Expect = 2e-19
 Identities = 43/56 (76%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F VV+D G+PK++V YKGE K+F+PEEVSSMVLTKMKE AEAYLGKTV NAV+TVP
Sbjct: 92  FMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVP 147



 Score = 64.1 bits (149), Expect = 5e-10
 Identities = 28/57 (49%), Positives = 39/57 (68%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFELSVMEANLRSR*HIRVKTKPFSPRK 424
           +P NT+FDAKRLIGR+F+DA VQ+DMKHWPF +       + +   + +TK F P +
Sbjct: 62  NPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEE 118


>BC019816-1|AAH19816.1|  646|Homo sapiens heat shock 70kDa protein 8
           protein.
          Length = 646

 Score =  132 bits (318), Expect = 2e-30
 Identities = 61/64 (95%), Positives = 62/64 (96%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           M+K PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 252 MTPT 263
           M PT
Sbjct: 61  MNPT 64



 Score =  110 bits (265), Expect = 5e-24
 Identities = 59/81 (72%), Positives = 61/81 (75%), Gaps = 1/81 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAGTI+GLNVLRIINEPTAAAIAYGLDKK   ERNVLIFDLGGGT   
Sbjct: 148 AYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDV 207

Query: 690 PSLP-SRRYLRGEIHRGDTHL 749
             L         +   GDTHL
Sbjct: 208 SILTIEDGIFEVKSTAGDTHL 228



 Score = 95.1 bits (226), Expect = 2e-19
 Identities = 43/56 (76%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F VV+D G+PK++V YKGE K+F+PEEVSSMVLTKMKE AEAYLGKTV NAV+TVP
Sbjct: 92  FMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVP 147



 Score = 64.1 bits (149), Expect = 5e-10
 Identities = 28/57 (49%), Positives = 39/57 (68%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFELSVMEANLRSR*HIRVKTKPFSPRK 424
           +P NT+FDAKRLIGR+F+DA VQ+DMKHWPF +       + +   + +TK F P +
Sbjct: 62  NPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEE 118


>BC016660-1|AAH16660.1|  646|Homo sapiens heat shock 70kDa protein 8
           protein.
          Length = 646

 Score =  132 bits (318), Expect = 2e-30
 Identities = 61/64 (95%), Positives = 62/64 (96%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           M+K PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 252 MTPT 263
           M PT
Sbjct: 61  MNPT 64



 Score =  110 bits (265), Expect = 5e-24
 Identities = 59/81 (72%), Positives = 61/81 (75%), Gaps = 1/81 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAGTI+GLNVLRIINEPTAAAIAYGLDKK   ERNVLIFDLGGGT   
Sbjct: 148 AYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDV 207

Query: 690 PSLP-SRRYLRGEIHRGDTHL 749
             L         +   GDTHL
Sbjct: 208 SILTIEDGIFEVKSTAGDTHL 228



 Score = 95.1 bits (226), Expect = 2e-19
 Identities = 43/56 (76%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F VV+D G+PK++V YKGE K+F+PEEVSSMVLTKMKE AEAYLGKTV NAV+TVP
Sbjct: 92  FMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVP 147



 Score = 64.1 bits (149), Expect = 5e-10
 Identities = 28/57 (49%), Positives = 39/57 (68%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFELSVMEANLRSR*HIRVKTKPFSPRK 424
           +P NT+FDAKRLIGR+F+DA VQ+DMKHWPF +       + +   + +TK F P +
Sbjct: 62  NPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEE 118


>BC016179-1|AAH16179.1|  646|Homo sapiens heat shock 70kDa protein 8
           protein.
          Length = 646

 Score =  132 bits (318), Expect = 2e-30
 Identities = 61/64 (95%), Positives = 62/64 (96%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           M+K PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 252 MTPT 263
           M PT
Sbjct: 61  MNPT 64



 Score =  110 bits (265), Expect = 5e-24
 Identities = 59/81 (72%), Positives = 61/81 (75%), Gaps = 1/81 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAGTI+GLNVLRIINEPTAAAIAYGLDKK   ERNVLIFDLGGGT   
Sbjct: 148 AYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDV 207

Query: 690 PSLP-SRRYLRGEIHRGDTHL 749
             L         +   GDTHL
Sbjct: 208 SILTIEDGIFEVKSTAGDTHL 228



 Score = 95.1 bits (226), Expect = 2e-19
 Identities = 43/56 (76%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F VV+D G+PK++V YKGE K+F+PEEVSSMVLTKMKE AEAYLGKTV NAV+TVP
Sbjct: 92  FMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVP 147



 Score = 64.1 bits (149), Expect = 5e-10
 Identities = 28/57 (49%), Positives = 39/57 (68%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFELSVMEANLRSR*HIRVKTKPFSPRK 424
           +P NT+FDAKRLIGR+F+DA VQ+DMKHWPF +       + +   + +TK F P +
Sbjct: 62  NPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEE 118


>AK222785-1|BAD96505.1|  646|Homo sapiens heat shock 70kDa protein 8
           isoform 1 variant protein.
          Length = 646

 Score =  132 bits (318), Expect = 2e-30
 Identities = 61/64 (95%), Positives = 62/64 (96%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           M+K PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 252 MTPT 263
           M PT
Sbjct: 61  MNPT 64



 Score =  109 bits (261), Expect = 1e-23
 Identities = 58/81 (71%), Positives = 61/81 (75%), Gaps = 1/81 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAGTI+GLNVLRIINEPTAAAIAYGLD+K   ERNVLIFDLGGGT   
Sbjct: 148 AYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDEKVGAERNVLIFDLGGGTFDV 207

Query: 690 PSLP-SRRYLRGEIHRGDTHL 749
             L         +   GDTHL
Sbjct: 208 SILTIEDGIFEVKSTAGDTHL 228



 Score = 95.1 bits (226), Expect = 2e-19
 Identities = 43/56 (76%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F VV+D G+PK++V YKGE K+F+PEEVSSMVLTKMKE AEAYLGKTV NAV+TVP
Sbjct: 92  FMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVP 147



 Score = 64.1 bits (149), Expect = 5e-10
 Identities = 28/57 (49%), Positives = 39/57 (68%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFELSVMEANLRSR*HIRVKTKPFSPRK 424
           +P NT+FDAKRLIGR+F+DA VQ+DMKHWPF +       + +   + +TK F P +
Sbjct: 62  NPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEE 118


>AK222628-1|BAD96348.1|  493|Homo sapiens heat shock 70kDa protein 8
           isoform 2 variant protein.
          Length = 493

 Score =  132 bits (318), Expect = 2e-30
 Identities = 61/64 (95%), Positives = 62/64 (96%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           M+K PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 252 MTPT 263
           M PT
Sbjct: 61  MNPT 64



 Score =  110 bits (265), Expect = 5e-24
 Identities = 59/81 (72%), Positives = 61/81 (75%), Gaps = 1/81 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAGTI+GLNVLRIINEPTAAAIAYGLDKK   ERNVLIFDLGGGT   
Sbjct: 148 AYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDV 207

Query: 690 PSLP-SRRYLRGEIHRGDTHL 749
             L         +   GDTHL
Sbjct: 208 SILTIEDGIFEVKSTAGDTHL 228



 Score = 95.1 bits (226), Expect = 2e-19
 Identities = 43/56 (76%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F VV+D G+PK++V YKGE K+F+PEEVSSMVLTKMKE AEAYLGKTV NAV+TVP
Sbjct: 92  FMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVP 147



 Score = 64.1 bits (149), Expect = 5e-10
 Identities = 28/57 (49%), Positives = 39/57 (68%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFELSVMEANLRSR*HIRVKTKPFSPRK 424
           +P NT+FDAKRLIGR+F+DA VQ+DMKHWPF +       + +   + +TK F P +
Sbjct: 62  NPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEE 118


>AF352832-1|AAK17898.1|  646|Homo sapiens constitutive heat shock
           protein 70 protein.
          Length = 646

 Score =  132 bits (318), Expect = 2e-30
 Identities = 61/64 (95%), Positives = 62/64 (96%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           M+K PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 252 MTPT 263
           M PT
Sbjct: 61  MNPT 64



 Score =  110 bits (265), Expect = 5e-24
 Identities = 59/81 (72%), Positives = 61/81 (75%), Gaps = 1/81 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAGTI+GLNVLRIINEPTAAAIAYGLDKK   ERNVLIFDLGGGT   
Sbjct: 148 AYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDV 207

Query: 690 PSLP-SRRYLRGEIHRGDTHL 749
             L         +   GDTHL
Sbjct: 208 SILTIEDGIFEVKSTAGDTHL 228



 Score = 95.1 bits (226), Expect = 2e-19
 Identities = 43/56 (76%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F VV+D G+PK++V YKGE K+F+PEEVSSMVLTKMKE AEAYLGKTV NAV+TVP
Sbjct: 92  FMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVP 147



 Score = 64.1 bits (149), Expect = 5e-10
 Identities = 28/57 (49%), Positives = 39/57 (68%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFELSVMEANLRSR*HIRVKTKPFSPRK 424
           +P NT+FDAKRLIGR+F+DA VQ+DMKHWPF +       + +   + +TK F P +
Sbjct: 62  NPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEE 118


>AB034951-1|BAB18615.1|  493|Homo sapiens heat shock cognate protein
           54 protein.
          Length = 493

 Score =  132 bits (318), Expect = 2e-30
 Identities = 61/64 (95%), Positives = 62/64 (96%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           M+K PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 252 MTPT 263
           M PT
Sbjct: 61  MNPT 64



 Score =  110 bits (265), Expect = 5e-24
 Identities = 59/81 (72%), Positives = 61/81 (75%), Gaps = 1/81 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAGTI+GLNVLRIINEPTAAAIAYGLDKK   ERNVLIFDLGGGT   
Sbjct: 148 AYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDV 207

Query: 690 PSLP-SRRYLRGEIHRGDTHL 749
             L         +   GDTHL
Sbjct: 208 SILTIEDGIFEVKSTAGDTHL 228



 Score = 95.1 bits (226), Expect = 2e-19
 Identities = 43/56 (76%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F VV+D G+PK++V YKGE K+F+PEEVSSMVLTKMKE AEAYLGKTV NAV+TVP
Sbjct: 92  FMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVP 147



 Score = 64.1 bits (149), Expect = 5e-10
 Identities = 28/57 (49%), Positives = 39/57 (68%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFELSVMEANLRSR*HIRVKTKPFSPRK 424
           +P NT+FDAKRLIGR+F+DA VQ+DMKHWPF +       + +   + +TK F P +
Sbjct: 62  NPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEE 118


>U56725-1|AAD11466.1|  639|Homo sapiens heat shock protein protein.
          Length = 639

 Score =  129 bits (312), Expect = 9e-30
 Identities = 59/63 (93%), Positives = 61/63 (96%)
 Frame = +3

Query: 75  AKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM 254
           A+ PA+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM
Sbjct: 3   ARGPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM 62

Query: 255 TPT 263
            PT
Sbjct: 63  NPT 65



 Score =  110 bits (265), Expect = 5e-24
 Identities = 60/83 (72%), Positives = 63/83 (75%), Gaps = 3/83 (3%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGT--GERNVLIFDLGGGTS 683
           AYFNDSQRQATKDAGTI+GLNVLRIINEPTAAAIAYGLDKKG   GE+NVLIFDLGGGT 
Sbjct: 149 AYFNDSQRQATKDAGTITGLNVLRIINEPTAAAIAYGLDKKGCAGGEKNVLIFDLGGGTF 208

Query: 684 TCPSLP-SRRYLRGEIHRGDTHL 749
               L         +   GDTHL
Sbjct: 209 DVSILTIEDGIFEVKSTAGDTHL 231



 Score = 96.7 bits (230), Expect = 8e-20
 Identities = 45/56 (80%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           FRVVS+GGKPK++V YKGE KTFFPEE+SSMVLTKMKE AEAYLG  V +AVITVP
Sbjct: 93  FRVVSEGGKPKVQVEYKGETKTFFPEEISSMVLTKMKEIAEAYLGGKVHSAVITVP 148



 Score = 70.1 bits (164), Expect = 8e-12
 Identities = 32/57 (56%), Positives = 40/57 (70%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFELSVMEANLRSR*HIRVKTKPFSPRK 424
           +P NTIFDAKRLIGRKFEDATVQ+DMKHWPF +       + +   + +TK F P +
Sbjct: 63  NPTNTIFDAKRLIGRKFEDATVQSDMKHWPFRVVSEGGKPKVQVEYKGETKTFFPEE 119


>L26336-1|AAA52698.1|  639|Homo sapiens heat shock protein protein.
          Length = 639

 Score =  129 bits (312), Expect = 9e-30
 Identities = 59/63 (93%), Positives = 61/63 (96%)
 Frame = +3

Query: 75  AKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM 254
           A+ PA+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM
Sbjct: 3   ARGPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM 62

Query: 255 TPT 263
            PT
Sbjct: 63  NPT 65



 Score =  110 bits (265), Expect = 5e-24
 Identities = 60/83 (72%), Positives = 63/83 (75%), Gaps = 3/83 (3%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGT--GERNVLIFDLGGGTS 683
           AYFNDSQRQATKDAGTI+GLNVLRIINEPTAAAIAYGLDKKG   GE+NVLIFDLGGGT 
Sbjct: 149 AYFNDSQRQATKDAGTITGLNVLRIINEPTAAAIAYGLDKKGCAGGEKNVLIFDLGGGTF 208

Query: 684 TCPSLP-SRRYLRGEIHRGDTHL 749
               L         +   GDTHL
Sbjct: 209 DVSILTIEDGIFEVKSTAGDTHL 231



 Score = 96.7 bits (230), Expect = 8e-20
 Identities = 45/56 (80%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           FRVVS+GGKPK++V YKGE KTFFPEE+SSMVLTKMKE AEAYLG  V +AVITVP
Sbjct: 93  FRVVSEGGKPKVQVEYKGETKTFFPEEISSMVLTKMKEIAEAYLGGKVHSAVITVP 148



 Score = 70.1 bits (164), Expect = 8e-12
 Identities = 32/57 (56%), Positives = 40/57 (70%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFELSVMEANLRSR*HIRVKTKPFSPRK 424
           +P NTIFDAKRLIGRKFEDATVQ+DMKHWPF +       + +   + +TK F P +
Sbjct: 63  NPTNTIFDAKRLIGRKFEDATVQSDMKHWPFRVVSEGGKPKVQVEYKGETKTFFPEE 119


>DQ489378-1|ABE96830.1|  639|Homo sapiens heat shock 70kDa protein 2
           protein.
          Length = 639

 Score =  129 bits (312), Expect = 9e-30
 Identities = 59/63 (93%), Positives = 61/63 (96%)
 Frame = +3

Query: 75  AKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM 254
           A+ PA+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM
Sbjct: 3   ARGPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM 62

Query: 255 TPT 263
            PT
Sbjct: 63  NPT 65



 Score =  110 bits (265), Expect = 5e-24
 Identities = 60/83 (72%), Positives = 63/83 (75%), Gaps = 3/83 (3%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGT--GERNVLIFDLGGGTS 683
           AYFNDSQRQATKDAGTI+GLNVLRIINEPTAAAIAYGLDKKG   GE+NVLIFDLGGGT 
Sbjct: 149 AYFNDSQRQATKDAGTITGLNVLRIINEPTAAAIAYGLDKKGCAGGEKNVLIFDLGGGTF 208

Query: 684 TCPSLP-SRRYLRGEIHRGDTHL 749
               L         +   GDTHL
Sbjct: 209 DVSILTIEDGIFEVKSTAGDTHL 231



 Score = 96.7 bits (230), Expect = 8e-20
 Identities = 45/56 (80%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           FRVVS+GGKPK++V YKGE KTFFPEE+SSMVLTKMKE AEAYLG  V +AVITVP
Sbjct: 93  FRVVSEGGKPKVQVEYKGETKTFFPEEISSMVLTKMKEIAEAYLGGKVHSAVITVP 148



 Score = 70.1 bits (164), Expect = 8e-12
 Identities = 32/57 (56%), Positives = 40/57 (70%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFELSVMEANLRSR*HIRVKTKPFSPRK 424
           +P NTIFDAKRLIGRKFEDATVQ+DMKHWPF +       + +   + +TK F P +
Sbjct: 63  NPTNTIFDAKRLIGRKFEDATVQSDMKHWPFRVVSEGGKPKVQVEYKGETKTFFPEE 119


>BT009815-1|AAP88817.1|  639|Homo sapiens heat shock 70kDa protein 2
           protein.
          Length = 639

 Score =  129 bits (312), Expect = 9e-30
 Identities = 59/63 (93%), Positives = 61/63 (96%)
 Frame = +3

Query: 75  AKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM 254
           A+ PA+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM
Sbjct: 3   ARGPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM 62

Query: 255 TPT 263
            PT
Sbjct: 63  NPT 65



 Score =  110 bits (265), Expect = 5e-24
 Identities = 60/83 (72%), Positives = 63/83 (75%), Gaps = 3/83 (3%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGT--GERNVLIFDLGGGTS 683
           AYFNDSQRQATKDAGTI+GLNVLRIINEPTAAAIAYGLDKKG   GE+NVLIFDLGGGT 
Sbjct: 149 AYFNDSQRQATKDAGTITGLNVLRIINEPTAAAIAYGLDKKGCAGGEKNVLIFDLGGGTF 208

Query: 684 TCPSLP-SRRYLRGEIHRGDTHL 749
               L         +   GDTHL
Sbjct: 209 DVSILTIEDGIFEVKSTAGDTHL 231



 Score = 96.7 bits (230), Expect = 8e-20
 Identities = 45/56 (80%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           FRVVS+GGKPK++V YKGE KTFFPEE+SSMVLTKMKE AEAYLG  V +AVITVP
Sbjct: 93  FRVVSEGGKPKVQVEYKGETKTFFPEEISSMVLTKMKEIAEAYLGGKVHSAVITVP 148



 Score = 70.1 bits (164), Expect = 8e-12
 Identities = 32/57 (56%), Positives = 40/57 (70%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFELSVMEANLRSR*HIRVKTKPFSPRK 424
           +P NTIFDAKRLIGRKFEDATVQ+DMKHWPF +       + +   + +TK F P +
Sbjct: 63  NPTNTIFDAKRLIGRKFEDATVQSDMKHWPFRVVSEGGKPKVQVEYKGETKTFFPEE 119


>BC001752-1|AAH01752.1|  639|Homo sapiens heat shock 70kDa protein 2
           protein.
          Length = 639

 Score =  129 bits (312), Expect = 9e-30
 Identities = 59/63 (93%), Positives = 61/63 (96%)
 Frame = +3

Query: 75  AKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM 254
           A+ PA+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM
Sbjct: 3   ARGPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM 62

Query: 255 TPT 263
            PT
Sbjct: 63  NPT 65



 Score =  110 bits (265), Expect = 5e-24
 Identities = 60/83 (72%), Positives = 63/83 (75%), Gaps = 3/83 (3%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGT--GERNVLIFDLGGGTS 683
           AYFNDSQRQATKDAGTI+GLNVLRIINEPTAAAIAYGLDKKG   GE+NVLIFDLGGGT 
Sbjct: 149 AYFNDSQRQATKDAGTITGLNVLRIINEPTAAAIAYGLDKKGCAGGEKNVLIFDLGGGTF 208

Query: 684 TCPSLP-SRRYLRGEIHRGDTHL 749
               L         +   GDTHL
Sbjct: 209 DVSILTIEDGIFEVKSTAGDTHL 231



 Score = 96.7 bits (230), Expect = 8e-20
 Identities = 45/56 (80%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           FRVVS+GGKPK++V YKGE KTFFPEE+SSMVLTKMKE AEAYLG  V +AVITVP
Sbjct: 93  FRVVSEGGKPKVQVEYKGETKTFFPEEISSMVLTKMKEIAEAYLGGKVHSAVITVP 148



 Score = 70.1 bits (164), Expect = 8e-12
 Identities = 32/57 (56%), Positives = 40/57 (70%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFELSVMEANLRSR*HIRVKTKPFSPRK 424
           +P NTIFDAKRLIGRKFEDATVQ+DMKHWPF +       + +   + +TK F P +
Sbjct: 63  NPTNTIFDAKRLIGRKFEDATVQSDMKHWPFRVVSEGGKPKVQVEYKGETKTFFPEE 119


>M11717-1|AAA52697.1|  640|Homo sapiens heat shock protein protein.
          Length = 640

 Score =  128 bits (309), Expect = 2e-29
 Identities = 60/63 (95%), Positives = 61/63 (96%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           MAKA AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MAKAAAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 252 MTP 260
           + P
Sbjct: 61  LNP 63



 Score =  111 bits (268), Expect = 2e-24
 Identities = 58/81 (71%), Positives = 61/81 (75%), Gaps = 1/81 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLD+ G GERNVLIFDLGGGT   
Sbjct: 148 AYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDRTGKGERNVLIFDLGGGTFDV 207

Query: 690 PSLP-SRRYLRGEIHRGDTHL 749
             L         +   GDTHL
Sbjct: 208 SILTIDDGIFEVKATAGDTHL 228



 Score = 91.5 bits (217), Expect = 3e-18
 Identities = 41/56 (73%), Positives = 49/56 (87%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+V++DG KPK++V+YKGE K F+PEE+SSMVLTKMKE AEAYLG  V NAVITVP
Sbjct: 92  FQVINDGDKPKVQVSYKGETKAFYPEEISSMVLTKMKEIAEAYLGYPVTNAVITVP 147



 Score = 61.7 bits (143), Expect = 3e-09
 Identities = 28/57 (49%), Positives = 38/57 (66%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFELSVMEANLRSR*HIRVKTKPFSPRK 424
           +P NT+FDAKRLIGRKF D  VQ+DMKHWPF++       + +   + +TK F P +
Sbjct: 62  NPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEE 118


>M59830-1|AAA63227.1|  641|Homo sapiens heat shock-induced protein
           protein.
          Length = 641

 Score =  128 bits (308), Expect = 3e-29
 Identities = 59/63 (93%), Positives = 61/63 (96%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           MAKA A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 252 MTP 260
           + P
Sbjct: 61  LNP 63



 Score =  111 bits (268), Expect = 2e-24
 Identities = 58/81 (71%), Positives = 61/81 (75%), Gaps = 1/81 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLD+ G GERNVLIFDLGGGT   
Sbjct: 148 AYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDRTGKGERNVLIFDLGGGTFDV 207

Query: 690 PSLP-SRRYLRGEIHRGDTHL 749
             L         +   GDTHL
Sbjct: 208 SILTIDDGIFEVKATAGDTHL 228



 Score = 91.5 bits (217), Expect = 3e-18
 Identities = 41/56 (73%), Positives = 49/56 (87%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+V++DG KPK++V+YKGE K F+PEE+SSMVLTKMKE AEAYLG  V NAVITVP
Sbjct: 92  FQVINDGDKPKVQVSYKGETKAFYPEEISSMVLTKMKEIAEAYLGYPVTNAVITVP 147



 Score = 61.7 bits (143), Expect = 3e-09
 Identities = 28/57 (49%), Positives = 38/57 (66%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFELSVMEANLRSR*HIRVKTKPFSPRK 424
           +P NT+FDAKRLIGRKF D  VQ+DMKHWPF++       + +   + +TK F P +
Sbjct: 62  NPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEE 118


>M59828-1|AAA63226.1|  641|Homo sapiens heat shock-induced protein
           protein.
          Length = 641

 Score =  128 bits (308), Expect = 3e-29
 Identities = 59/63 (93%), Positives = 61/63 (96%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           MAKA A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 252 MTP 260
           + P
Sbjct: 61  LNP 63



 Score =  111 bits (268), Expect = 2e-24
 Identities = 58/81 (71%), Positives = 61/81 (75%), Gaps = 1/81 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLD+ G GERNVLIFDLGGGT   
Sbjct: 148 AYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDRTGKGERNVLIFDLGGGTFDV 207

Query: 690 PSLP-SRRYLRGEIHRGDTHL 749
             L         +   GDTHL
Sbjct: 208 SILTIDDGIFEVKATAGDTHL 228



 Score = 91.5 bits (217), Expect = 3e-18
 Identities = 41/56 (73%), Positives = 49/56 (87%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+V++DG KPK++V+YKGE K F+PEE+SSMVLTKMKE AEAYLG  V NAVITVP
Sbjct: 92  FQVINDGDKPKVQVSYKGETKAFYPEEISSMVLTKMKEIAEAYLGYPVTNAVITVP 147



 Score = 61.7 bits (143), Expect = 3e-09
 Identities = 28/57 (49%), Positives = 38/57 (66%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFELSVMEANLRSR*HIRVKTKPFSPRK 424
           +P NT+FDAKRLIGRKF D  VQ+DMKHWPF++       + +   + +TK F P +
Sbjct: 62  NPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEE 118


>DQ451402-1|ABD96830.1|  641|Homo sapiens heat shock 70kDa protein
           1A protein.
          Length = 641

 Score =  128 bits (308), Expect = 3e-29
 Identities = 59/63 (93%), Positives = 61/63 (96%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           MAKA A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 252 MTP 260
           + P
Sbjct: 61  LNP 63



 Score =  111 bits (268), Expect = 2e-24
 Identities = 58/81 (71%), Positives = 61/81 (75%), Gaps = 1/81 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLD+ G GERNVLIFDLGGGT   
Sbjct: 148 AYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDRTGKGERNVLIFDLGGGTFDV 207

Query: 690 PSLP-SRRYLRGEIHRGDTHL 749
             L         +   GDTHL
Sbjct: 208 SILTIDDGIFEVKATAGDTHL 228



 Score = 91.5 bits (217), Expect = 3e-18
 Identities = 41/56 (73%), Positives = 49/56 (87%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+V++DG KPK++V+YKGE K F+PEE+SSMVLTKMKE AEAYLG  V NAVITVP
Sbjct: 92  FQVINDGDKPKVQVSYKGETKAFYPEEISSMVLTKMKEIAEAYLGYPVTNAVITVP 147



 Score = 61.7 bits (143), Expect = 3e-09
 Identities = 28/57 (49%), Positives = 38/57 (66%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFELSVMEANLRSR*HIRVKTKPFSPRK 424
           +P NT+FDAKRLIGRKF D  VQ+DMKHWPF++       + +   + +TK F P +
Sbjct: 62  NPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEE 118


>DQ388429-1|ABD48956.1|  641|Homo sapiens heat shock 70kDa protein
           1B protein.
          Length = 641

 Score =  128 bits (308), Expect = 3e-29
 Identities = 59/63 (93%), Positives = 61/63 (96%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           MAKA A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 252 MTP 260
           + P
Sbjct: 61  LNP 63



 Score =  111 bits (268), Expect = 2e-24
 Identities = 58/81 (71%), Positives = 61/81 (75%), Gaps = 1/81 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLD+ G GERNVLIFDLGGGT   
Sbjct: 148 AYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDRTGKGERNVLIFDLGGGTFDV 207

Query: 690 PSLP-SRRYLRGEIHRGDTHL 749
             L         +   GDTHL
Sbjct: 208 SILTIDDGIFEVKATAGDTHL 228



 Score = 91.5 bits (217), Expect = 3e-18
 Identities = 41/56 (73%), Positives = 49/56 (87%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+V++DG KPK++V+YKGE K F+PEE+SSMVLTKMKE AEAYLG  V NAVITVP
Sbjct: 92  FQVINDGDKPKVQVSYKGETKAFYPEEISSMVLTKMKEIAEAYLGYPVTNAVITVP 147



 Score = 61.7 bits (143), Expect = 3e-09
 Identities = 28/57 (49%), Positives = 38/57 (66%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFELSVMEANLRSR*HIRVKTKPFSPRK 424
           +P NT+FDAKRLIGRKF D  VQ+DMKHWPF++       + +   + +TK F P +
Sbjct: 62  NPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEE 118


>BC063507-1|AAH63507.1|  641|Homo sapiens heat shock 70kDa protein
           1B protein.
          Length = 641

 Score =  128 bits (308), Expect = 3e-29
 Identities = 59/63 (93%), Positives = 61/63 (96%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           MAKA A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 252 MTP 260
           + P
Sbjct: 61  LNP 63



 Score =  111 bits (268), Expect = 2e-24
 Identities = 58/81 (71%), Positives = 61/81 (75%), Gaps = 1/81 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLD+ G GERNVLIFDLGGGT   
Sbjct: 148 AYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDRTGKGERNVLIFDLGGGTFDV 207

Query: 690 PSLP-SRRYLRGEIHRGDTHL 749
             L         +   GDTHL
Sbjct: 208 SILTIDDGIFEVKATAGDTHL 228



 Score = 91.5 bits (217), Expect = 3e-18
 Identities = 41/56 (73%), Positives = 49/56 (87%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+V++DG KPK++V+YKGE K F+PEE+SSMVLTKMKE AEAYLG  V NAVITVP
Sbjct: 92  FQVINDGDKPKVQVSYKGETKAFYPEEISSMVLTKMKEIAEAYLGYPVTNAVITVP 147



 Score = 61.7 bits (143), Expect = 3e-09
 Identities = 28/57 (49%), Positives = 38/57 (66%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFELSVMEANLRSR*HIRVKTKPFSPRK 424
           +P NT+FDAKRLIGRKF D  VQ+DMKHWPF++       + +   + +TK F P +
Sbjct: 62  NPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEE 118


>BC057397-1|AAH57397.1|  641|Homo sapiens heat shock 70kDa protein
           1B protein.
          Length = 641

 Score =  128 bits (308), Expect = 3e-29
 Identities = 59/63 (93%), Positives = 61/63 (96%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           MAKA A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 252 MTP 260
           + P
Sbjct: 61  LNP 63



 Score =  111 bits (268), Expect = 2e-24
 Identities = 58/81 (71%), Positives = 61/81 (75%), Gaps = 1/81 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLD+ G GERNVLIFDLGGGT   
Sbjct: 148 AYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDRTGKGERNVLIFDLGGGTFDV 207

Query: 690 PSLP-SRRYLRGEIHRGDTHL 749
             L         +   GDTHL
Sbjct: 208 SILTIDDGIFEVKATAGDTHL 228



 Score = 91.5 bits (217), Expect = 3e-18
 Identities = 41/56 (73%), Positives = 49/56 (87%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+V++DG KPK++V+YKGE K F+PEE+SSMVLTKMKE AEAYLG  V NAVITVP
Sbjct: 92  FQVINDGDKPKVQVSYKGETKAFYPEEISSMVLTKMKEIAEAYLGYPVTNAVITVP 147



 Score = 61.7 bits (143), Expect = 3e-09
 Identities = 28/57 (49%), Positives = 38/57 (66%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFELSVMEANLRSR*HIRVKTKPFSPRK 424
           +P NT+FDAKRLIGRKF D  VQ+DMKHWPF++       + +   + +TK F P +
Sbjct: 62  NPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEE 118


>BC018740-1|AAH18740.1|  641|Homo sapiens HSPA1A protein protein.
          Length = 641

 Score =  128 bits (308), Expect = 3e-29
 Identities = 59/63 (93%), Positives = 61/63 (96%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           MAKA A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 252 MTP 260
           + P
Sbjct: 61  LNP 63



 Score =  111 bits (268), Expect = 2e-24
 Identities = 58/81 (71%), Positives = 61/81 (75%), Gaps = 1/81 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLD+ G GERNVLIFDLGGGT   
Sbjct: 148 AYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDRTGKGERNVLIFDLGGGTFDV 207

Query: 690 PSLP-SRRYLRGEIHRGDTHL 749
             L         +   GDTHL
Sbjct: 208 SILTIDDGIFEVKATAGDTHL 228



 Score = 91.5 bits (217), Expect = 3e-18
 Identities = 41/56 (73%), Positives = 49/56 (87%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+V++DG KPK++V+YKGE K F+PEE+SSMVLTKMKE AEAYLG  V NAVITVP
Sbjct: 92  FQVINDGDKPKVQVSYKGETKAFYPEEISSMVLTKMKEIAEAYLGYPVTNAVITVP 147



 Score = 61.7 bits (143), Expect = 3e-09
 Identities = 28/57 (49%), Positives = 38/57 (66%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFELSVMEANLRSR*HIRVKTKPFSPRK 424
           +P NT+FDAKRLIGRKF D  VQ+DMKHWPF++       + +   + +TK F P +
Sbjct: 62  NPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEE 118


>BC009322-1|AAH09322.1|  641|Homo sapiens HSPA1A protein protein.
          Length = 641

 Score =  128 bits (308), Expect = 3e-29
 Identities = 59/63 (93%), Positives = 61/63 (96%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           MAKA A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 252 MTP 260
           + P
Sbjct: 61  LNP 63



 Score =  111 bits (268), Expect = 2e-24
 Identities = 58/81 (71%), Positives = 61/81 (75%), Gaps = 1/81 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLD+ G GERNVLIFDLGGGT   
Sbjct: 148 AYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDRTGKGERNVLIFDLGGGTFDV 207

Query: 690 PSLP-SRRYLRGEIHRGDTHL 749
             L         +   GDTHL
Sbjct: 208 SILTIDDGIFEVKATAGDTHL 228



 Score = 91.5 bits (217), Expect = 3e-18
 Identities = 41/56 (73%), Positives = 49/56 (87%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+V++DG KPK++V+YKGE K F+PEE+SSMVLTKMKE AEAYLG  V NAVITVP
Sbjct: 92  FQVINDGDKPKVQVSYKGETKAFYPEEISSMVLTKMKEIAEAYLGYPVTNAVITVP 147



 Score = 61.7 bits (143), Expect = 3e-09
 Identities = 28/57 (49%), Positives = 38/57 (66%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFELSVMEANLRSR*HIRVKTKPFSPRK 424
           +P NT+FDAKRLIGRKF D  VQ+DMKHWPF++       + +   + +TK F P +
Sbjct: 62  NPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEE 118


>BC002453-1|AAH02453.1|  641|Homo sapiens heat shock 70kDa protein
           1A protein.
          Length = 641

 Score =  128 bits (308), Expect = 3e-29
 Identities = 59/63 (93%), Positives = 61/63 (96%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           MAKA A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 252 MTP 260
           + P
Sbjct: 61  LNP 63



 Score =  111 bits (268), Expect = 2e-24
 Identities = 58/81 (71%), Positives = 61/81 (75%), Gaps = 1/81 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLD+ G GERNVLIFDLGGGT   
Sbjct: 148 AYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDRTGKGERNVLIFDLGGGTFDV 207

Query: 690 PSLP-SRRYLRGEIHRGDTHL 749
             L         +   GDTHL
Sbjct: 208 SILTIDDGIFEVKATAGDTHL 228



 Score = 91.5 bits (217), Expect = 3e-18
 Identities = 41/56 (73%), Positives = 49/56 (87%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+V++DG KPK++V+YKGE K F+PEE+SSMVLTKMKE AEAYLG  V NAVITVP
Sbjct: 92  FQVINDGDKPKVQVSYKGETKAFYPEEISSMVLTKMKEIAEAYLGYPVTNAVITVP 147



 Score = 61.7 bits (143), Expect = 3e-09
 Identities = 28/57 (49%), Positives = 38/57 (66%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFELSVMEANLRSR*HIRVKTKPFSPRK 424
           +P NT+FDAKRLIGRKF D  VQ+DMKHWPF++       + +   + +TK F P +
Sbjct: 62  NPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEE 118


>BA000025-9|BAB63300.1|  641|Homo sapiens heat shock protein
           protein.
          Length = 641

 Score =  128 bits (308), Expect = 3e-29
 Identities = 59/63 (93%), Positives = 61/63 (96%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           MAKA A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 252 MTP 260
           + P
Sbjct: 61  LNP 63



 Score =  111 bits (268), Expect = 2e-24
 Identities = 58/81 (71%), Positives = 61/81 (75%), Gaps = 1/81 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLD+ G GERNVLIFDLGGGT   
Sbjct: 148 AYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDRTGKGERNVLIFDLGGGTFDV 207

Query: 690 PSLP-SRRYLRGEIHRGDTHL 749
             L         +   GDTHL
Sbjct: 208 SILTIDDGIFEVKATAGDTHL 228



 Score = 91.5 bits (217), Expect = 3e-18
 Identities = 41/56 (73%), Positives = 49/56 (87%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+V++DG KPK++V+YKGE K F+PEE+SSMVLTKMKE AEAYLG  V NAVITVP
Sbjct: 92  FQVINDGDKPKVQVSYKGETKAFYPEEISSMVLTKMKEIAEAYLGYPVTNAVITVP 147



 Score = 61.7 bits (143), Expect = 3e-09
 Identities = 28/57 (49%), Positives = 38/57 (66%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFELSVMEANLRSR*HIRVKTKPFSPRK 424
           +P NT+FDAKRLIGRKF D  VQ+DMKHWPF++       + +   + +TK F P +
Sbjct: 62  NPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEE 118


>BA000025-8|BAB63299.1|  641|Homo sapiens heat shock protein
           protein.
          Length = 641

 Score =  128 bits (308), Expect = 3e-29
 Identities = 59/63 (93%), Positives = 61/63 (96%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           MAKA A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 252 MTP 260
           + P
Sbjct: 61  LNP 63



 Score =  111 bits (268), Expect = 2e-24
 Identities = 58/81 (71%), Positives = 61/81 (75%), Gaps = 1/81 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLD+ G GERNVLIFDLGGGT   
Sbjct: 148 AYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDRTGKGERNVLIFDLGGGTFDV 207

Query: 690 PSLP-SRRYLRGEIHRGDTHL 749
             L         +   GDTHL
Sbjct: 208 SILTIDDGIFEVKATAGDTHL 228



 Score = 91.5 bits (217), Expect = 3e-18
 Identities = 41/56 (73%), Positives = 49/56 (87%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+V++DG KPK++V+YKGE K F+PEE+SSMVLTKMKE AEAYLG  V NAVITVP
Sbjct: 92  FQVINDGDKPKVQVSYKGETKAFYPEEISSMVLTKMKEIAEAYLGYPVTNAVITVP 147



 Score = 61.7 bits (143), Expect = 3e-09
 Identities = 28/57 (49%), Positives = 38/57 (66%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFELSVMEANLRSR*HIRVKTKPFSPRK 424
           +P NT+FDAKRLIGRKF D  VQ+DMKHWPF++       + +   + +TK F P +
Sbjct: 62  NPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEE 118


>AL929592-7|CAI18466.1|  641|Homo sapiens heat shock 70kDa protein
           1B protein.
          Length = 641

 Score =  128 bits (308), Expect = 3e-29
 Identities = 59/63 (93%), Positives = 61/63 (96%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           MAKA A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 252 MTP 260
           + P
Sbjct: 61  LNP 63



 Score =  111 bits (268), Expect = 2e-24
 Identities = 58/81 (71%), Positives = 61/81 (75%), Gaps = 1/81 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLD+ G GERNVLIFDLGGGT   
Sbjct: 148 AYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDRTGKGERNVLIFDLGGGTFDV 207

Query: 690 PSLP-SRRYLRGEIHRGDTHL 749
             L         +   GDTHL
Sbjct: 208 SILTIDDGIFEVKATAGDTHL 228



 Score = 91.5 bits (217), Expect = 3e-18
 Identities = 41/56 (73%), Positives = 49/56 (87%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+V++DG KPK++V+YKGE K F+PEE+SSMVLTKMKE AEAYLG  V NAVITVP
Sbjct: 92  FQVINDGDKPKVQVSYKGETKAFYPEEISSMVLTKMKEIAEAYLGYPVTNAVITVP 147



 Score = 61.7 bits (143), Expect = 3e-09
 Identities = 28/57 (49%), Positives = 38/57 (66%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFELSVMEANLRSR*HIRVKTKPFSPRK 424
           +P NT+FDAKRLIGRKF D  VQ+DMKHWPF++       + +   + +TK F P +
Sbjct: 62  NPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEE 118


>AL929592-5|CAI18464.1|  641|Homo sapiens heat shock 70kDa protein
           1A protein.
          Length = 641

 Score =  128 bits (308), Expect = 3e-29
 Identities = 59/63 (93%), Positives = 61/63 (96%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           MAKA A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 252 MTP 260
           + P
Sbjct: 61  LNP 63



 Score =  111 bits (268), Expect = 2e-24
 Identities = 58/81 (71%), Positives = 61/81 (75%), Gaps = 1/81 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLD+ G GERNVLIFDLGGGT   
Sbjct: 148 AYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDRTGKGERNVLIFDLGGGTFDV 207

Query: 690 PSLP-SRRYLRGEIHRGDTHL 749
             L         +   GDTHL
Sbjct: 208 SILTIDDGIFEVKATAGDTHL 228



 Score = 90.2 bits (214), Expect = 7e-18
 Identities = 40/56 (71%), Positives = 49/56 (87%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+V++DG KPK++V+YKG+ K F+PEE+SSMVLTKMKE AEAYLG  V NAVITVP
Sbjct: 92  FQVINDGDKPKVQVSYKGDTKAFYPEEISSMVLTKMKEIAEAYLGYPVTNAVITVP 147



 Score = 61.3 bits (142), Expect = 4e-09
 Identities = 24/33 (72%), Positives = 29/33 (87%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGRKF D  VQ+DMKHWPF++
Sbjct: 62  NPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQV 94


>AL671762-7|CAI18217.1|  641|Homo sapiens heat shock 70kDa protein
           1B protein.
          Length = 641

 Score =  128 bits (308), Expect = 3e-29
 Identities = 59/63 (93%), Positives = 61/63 (96%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           MAKA A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 252 MTP 260
           + P
Sbjct: 61  LNP 63



 Score =  111 bits (268), Expect = 2e-24
 Identities = 58/81 (71%), Positives = 61/81 (75%), Gaps = 1/81 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLD+ G GERNVLIFDLGGGT   
Sbjct: 148 AYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDRTGKGERNVLIFDLGGGTFDV 207

Query: 690 PSLP-SRRYLRGEIHRGDTHL 749
             L         +   GDTHL
Sbjct: 208 SILTIDDGIFEVKATAGDTHL 228



 Score = 91.5 bits (217), Expect = 3e-18
 Identities = 41/56 (73%), Positives = 49/56 (87%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+V++DG KPK++V+YKGE K F+PEE+SSMVLTKMKE AEAYLG  V NAVITVP
Sbjct: 92  FQVINDGDKPKVQVSYKGETKAFYPEEISSMVLTKMKEIAEAYLGYPVTNAVITVP 147



 Score = 61.7 bits (143), Expect = 3e-09
 Identities = 28/57 (49%), Positives = 38/57 (66%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFELSVMEANLRSR*HIRVKTKPFSPRK 424
           +P NT+FDAKRLIGRKF D  VQ+DMKHWPF++       + +   + +TK F P +
Sbjct: 62  NPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEE 118


>AL671762-6|CAI18216.1|  641|Homo sapiens heat shock 70kDa protein
           1A protein.
          Length = 641

 Score =  128 bits (308), Expect = 3e-29
 Identities = 59/63 (93%), Positives = 61/63 (96%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           MAKA A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 252 MTP 260
           + P
Sbjct: 61  LNP 63



 Score =  111 bits (268), Expect = 2e-24
 Identities = 58/81 (71%), Positives = 61/81 (75%), Gaps = 1/81 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLD+ G GERNVLIFDLGGGT   
Sbjct: 148 AYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDRTGKGERNVLIFDLGGGTFDV 207

Query: 690 PSLP-SRRYLRGEIHRGDTHL 749
             L         +   GDTHL
Sbjct: 208 SILTIDDGIFEVKATAGDTHL 228



 Score = 91.5 bits (217), Expect = 3e-18
 Identities = 41/56 (73%), Positives = 49/56 (87%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+V++DG KPK++V+YKGE K F+PEE+SSMVLTKMKE AEAYLG  V NAVITVP
Sbjct: 92  FQVINDGDKPKVQVSYKGETKAFYPEEISSMVLTKMKEIAEAYLGYPVTNAVITVP 147



 Score = 61.7 bits (143), Expect = 3e-09
 Identities = 28/57 (49%), Positives = 38/57 (66%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFELSVMEANLRSR*HIRVKTKPFSPRK 424
           +P NT+FDAKRLIGRKF D  VQ+DMKHWPF++       + +   + +TK F P +
Sbjct: 62  NPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEE 118


>AL662834-18|CAI17738.1|  641|Homo sapiens heat shock 70kDa protein
           1B protein.
          Length = 641

 Score =  128 bits (308), Expect = 3e-29
 Identities = 59/63 (93%), Positives = 61/63 (96%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           MAKA A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 252 MTP 260
           + P
Sbjct: 61  LNP 63



 Score =  111 bits (268), Expect = 2e-24
 Identities = 58/81 (71%), Positives = 61/81 (75%), Gaps = 1/81 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLD+ G GERNVLIFDLGGGT   
Sbjct: 148 AYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDRTGKGERNVLIFDLGGGTFDV 207

Query: 690 PSLP-SRRYLRGEIHRGDTHL 749
             L         +   GDTHL
Sbjct: 208 SILTIDDGIFEVKATAGDTHL 228



 Score = 91.5 bits (217), Expect = 3e-18
 Identities = 41/56 (73%), Positives = 49/56 (87%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+V++DG KPK++V+YKGE K F+PEE+SSMVLTKMKE AEAYLG  V NAVITVP
Sbjct: 92  FQVINDGDKPKVQVSYKGETKAFYPEEISSMVLTKMKEIAEAYLGYPVTNAVITVP 147



 Score = 61.7 bits (143), Expect = 3e-09
 Identities = 28/57 (49%), Positives = 38/57 (66%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFELSVMEANLRSR*HIRVKTKPFSPRK 424
           +P NT+FDAKRLIGRKF D  VQ+DMKHWPF++       + +   + +TK F P +
Sbjct: 62  NPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEE 118


>AL662834-17|CAI17737.1|  641|Homo sapiens heat shock 70kDa protein
           1A protein.
          Length = 641

 Score =  128 bits (308), Expect = 3e-29
 Identities = 59/63 (93%), Positives = 61/63 (96%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           MAKA A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 252 MTP 260
           + P
Sbjct: 61  LNP 63



 Score =  111 bits (268), Expect = 2e-24
 Identities = 58/81 (71%), Positives = 61/81 (75%), Gaps = 1/81 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLD+ G GERNVLIFDLGGGT   
Sbjct: 148 AYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDRTGKGERNVLIFDLGGGTFDV 207

Query: 690 PSLP-SRRYLRGEIHRGDTHL 749
             L         +   GDTHL
Sbjct: 208 SILTIDDGIFEVKATAGDTHL 228



 Score = 91.5 bits (217), Expect = 3e-18
 Identities = 41/56 (73%), Positives = 49/56 (87%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+V++DG KPK++V+YKGE K F+PEE+SSMVLTKMKE AEAYLG  V NAVITVP
Sbjct: 92  FQVINDGDKPKVQVSYKGETKAFYPEEISSMVLTKMKEIAEAYLGYPVTNAVITVP 147



 Score = 61.7 bits (143), Expect = 3e-09
 Identities = 28/57 (49%), Positives = 38/57 (66%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFELSVMEANLRSR*HIRVKTKPFSPRK 424
           +P NT+FDAKRLIGRKF D  VQ+DMKHWPF++       + +   + +TK F P +
Sbjct: 62  NPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEE 118


>AF134726-7|AAD21816.1|  641|Homo sapiens HSP70-1 protein.
          Length = 641

 Score =  128 bits (308), Expect = 3e-29
 Identities = 59/63 (93%), Positives = 61/63 (96%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           MAKA A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 252 MTP 260
           + P
Sbjct: 61  LNP 63



 Score =  111 bits (268), Expect = 2e-24
 Identities = 58/81 (71%), Positives = 61/81 (75%), Gaps = 1/81 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLD+ G GERNVLIFDLGGGT   
Sbjct: 148 AYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDRTGKGERNVLIFDLGGGTFDV 207

Query: 690 PSLP-SRRYLRGEIHRGDTHL 749
             L         +   GDTHL
Sbjct: 208 SILTIDDGIFEVKATAGDTHL 228



 Score = 90.2 bits (214), Expect = 7e-18
 Identities = 40/56 (71%), Positives = 49/56 (87%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+V++DG KPK++V+YKG+ K F+PEE+SSMVLTKMKE AEAYLG  V NAVITVP
Sbjct: 92  FQVINDGDKPKVQVSYKGDTKAFYPEEISSMVLTKMKEIAEAYLGYPVTNAVITVP 147



 Score = 61.3 bits (142), Expect = 4e-09
 Identities = 24/33 (72%), Positives = 29/33 (87%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGRKF D  VQ+DMKHWPF++
Sbjct: 62  NPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQV 94


>AF134726-6|AAD21815.1|  641|Homo sapiens HSP70-2 protein.
          Length = 641

 Score =  128 bits (308), Expect = 3e-29
 Identities = 59/63 (93%), Positives = 61/63 (96%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           MAKA A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 252 MTP 260
           + P
Sbjct: 61  LNP 63



 Score =  111 bits (268), Expect = 2e-24
 Identities = 58/81 (71%), Positives = 61/81 (75%), Gaps = 1/81 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLD+ G GERNVLIFDLGGGT   
Sbjct: 148 AYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDRTGKGERNVLIFDLGGGTFDV 207

Query: 690 PSLP-SRRYLRGEIHRGDTHL 749
             L         +   GDTHL
Sbjct: 208 SILTIDDGIFEVKATAGDTHL 228



 Score = 91.5 bits (217), Expect = 3e-18
 Identities = 41/56 (73%), Positives = 49/56 (87%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+V++DG KPK++V+YKGE K F+PEE+SSMVLTKMKE AEAYLG  V NAVITVP
Sbjct: 92  FQVINDGDKPKVQVSYKGETKAFYPEEISSMVLTKMKEIAEAYLGYPVTNAVITVP 147



 Score = 61.7 bits (143), Expect = 3e-09
 Identities = 28/57 (49%), Positives = 38/57 (66%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFELSVMEANLRSR*HIRVKTKPFSPRK 424
           +P NT+FDAKRLIGRKF D  VQ+DMKHWPF++       + +   + +TK F P +
Sbjct: 62  NPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEE 118


>AB209818-1|BAD93055.1|  709|Homo sapiens heat shock 70kDa protein
           1A variant protein.
          Length = 709

 Score =  128 bits (308), Expect = 3e-29
 Identities = 59/63 (93%), Positives = 61/63 (96%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           MAKA A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 69  MAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 128

Query: 252 MTP 260
           + P
Sbjct: 129 LNP 131



 Score =  111 bits (268), Expect = 2e-24
 Identities = 58/81 (71%), Positives = 61/81 (75%), Gaps = 1/81 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLD+ G GERNVLIFDLGGGT   
Sbjct: 216 AYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDRTGKGERNVLIFDLGGGTFDV 275

Query: 690 PSLP-SRRYLRGEIHRGDTHL 749
             L         +   GDTHL
Sbjct: 276 SILTIDDGIFEVKATAGDTHL 296



 Score = 90.2 bits (214), Expect = 7e-18
 Identities = 40/56 (71%), Positives = 49/56 (87%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+V++DG KPK++V+YKG+ K F+PEE+SSMVLTKMKE AEAYLG  V NAVITVP
Sbjct: 160 FQVINDGDKPKVQVSYKGDTKAFYPEEISSMVLTKMKEIAEAYLGYPVTNAVITVP 215



 Score = 61.3 bits (142), Expect = 4e-09
 Identities = 24/33 (72%), Positives = 29/33 (87%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGRKF D  VQ+DMKHWPF++
Sbjct: 130 NPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQV 162


>BC036107-1|AAH36107.1|  639|Homo sapiens HSPA2 protein protein.
          Length = 639

 Score =  127 bits (306), Expect = 5e-29
 Identities = 58/63 (92%), Positives = 60/63 (95%)
 Frame = +3

Query: 75  AKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM 254
           A+ PA+GIDLG TYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM
Sbjct: 3   ARGPAIGIDLGPTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM 62

Query: 255 TPT 263
            PT
Sbjct: 63  NPT 65



 Score =  110 bits (265), Expect = 5e-24
 Identities = 60/83 (72%), Positives = 63/83 (75%), Gaps = 3/83 (3%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGT--GERNVLIFDLGGGTS 683
           AYFNDSQRQATKDAGTI+GLNVLRIINEPTAAAIAYGLDKKG   GE+NVLIFDLGGGT 
Sbjct: 149 AYFNDSQRQATKDAGTITGLNVLRIINEPTAAAIAYGLDKKGCAGGEKNVLIFDLGGGTF 208

Query: 684 TCPSLP-SRRYLRGEIHRGDTHL 749
               L         +   GDTHL
Sbjct: 209 DVSILTIEDGIFEVKSTAGDTHL 231



 Score = 96.7 bits (230), Expect = 8e-20
 Identities = 45/56 (80%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           FRVVS+GGKPK++V YKGE KTFFPEE+SSMVLTKMKE AEAYLG  V +AVITVP
Sbjct: 93  FRVVSEGGKPKVQVEYKGETKTFFPEEISSMVLTKMKEIAEAYLGGKVHSAVITVP 148



 Score = 67.3 bits (157), Expect = 6e-11
 Identities = 31/57 (54%), Positives = 39/57 (68%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFELSVMEANLRSR*HIRVKTKPFSPRK 424
           +P NTIFDAKRLIGRKF DATVQ+DMKHWPF +       + +   + +TK F P +
Sbjct: 63  NPTNTIFDAKRLIGRKFGDATVQSDMKHWPFRVVSEGGKPKVQVEYKGETKTFFPEE 119


>M59829-1|AAA63228.1|  641|Homo sapiens heat shock-induced protein
           protein.
          Length = 641

 Score =  124 bits (300), Expect = 3e-28
 Identities = 58/62 (93%), Positives = 59/62 (95%)
 Frame = +3

Query: 75  AKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM 254
           AK  A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM
Sbjct: 4   AKGIAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM 63

Query: 255 TP 260
            P
Sbjct: 64  NP 65



 Score =  110 bits (265), Expect = 5e-24
 Identities = 58/81 (71%), Positives = 61/81 (75%), Gaps = 1/81 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDK G GER+VLIFDLGGGT   
Sbjct: 150 AYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKGGQGERHVLIFDLGGGTFDV 209

Query: 690 PSLP-SRRYLRGEIHRGDTHL 749
             L         +   GDTHL
Sbjct: 210 SILTIDDGIFEVKATAGDTHL 230



 Score = 92.3 bits (219), Expect = 2e-18
 Identities = 40/56 (71%), Positives = 51/56 (91%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+V+++GGKPK+ V+YKGE+K F+PEE+SSMVLTK+KETAEA+LG  V NAVITVP
Sbjct: 94  FQVINEGGKPKVLVSYKGENKAFYPEEISSMVLTKLKETAEAFLGHPVTNAVITVP 149



 Score = 58.8 bits (136), Expect = 2e-08
 Identities = 24/33 (72%), Positives = 28/33 (84%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGRKF D  VQADMK WPF++
Sbjct: 64  NPQNTVFDAKRLIGRKFNDPVVQADMKLWPFQV 96


>D85730-1|BAA32521.1|  641|Homo sapiens Heat shock protein 70 testis
           variant protein.
          Length = 641

 Score =  124 bits (300), Expect = 3e-28
 Identities = 58/62 (93%), Positives = 59/62 (95%)
 Frame = +3

Query: 75  AKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM 254
           AK  A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM
Sbjct: 4   AKGIAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM 63

Query: 255 TP 260
            P
Sbjct: 64  NP 65



 Score =  110 bits (265), Expect = 5e-24
 Identities = 58/81 (71%), Positives = 61/81 (75%), Gaps = 1/81 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDK G GER+VLIFDLGGGT   
Sbjct: 150 AYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKGGQGERHVLIFDLGGGTFDV 209

Query: 690 PSLP-SRRYLRGEIHRGDTHL 749
             L         +   GDTHL
Sbjct: 210 SILTIDDGIFEVKATAGDTHL 230



 Score = 92.3 bits (219), Expect = 2e-18
 Identities = 40/56 (71%), Positives = 51/56 (91%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+V+++GGKPK+ V+YKGE+K F+PEE+SSMVLTK+KETAEA+LG  V NAVITVP
Sbjct: 94  FQVINEGGKPKVLVSYKGENKAFYPEEISSMVLTKLKETAEAFLGHPVTNAVITVP 149



 Score = 58.8 bits (136), Expect = 2e-08
 Identities = 24/33 (72%), Positives = 28/33 (84%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGRKF D  VQADMK WPF++
Sbjct: 64  NPQNTVFDAKRLIGRKFNDPVVQADMKLWPFQV 96


>DQ383515-1|ABC88476.1|  641|Homo sapiens heat shock 70kDa protein
           1-like protein.
          Length = 641

 Score =  124 bits (300), Expect = 3e-28
 Identities = 58/62 (93%), Positives = 59/62 (95%)
 Frame = +3

Query: 75  AKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM 254
           AK  A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM
Sbjct: 4   AKGIAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM 63

Query: 255 TP 260
            P
Sbjct: 64  NP 65



 Score =  110 bits (265), Expect = 5e-24
 Identities = 58/81 (71%), Positives = 61/81 (75%), Gaps = 1/81 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDK G GER+VLIFDLGGGT   
Sbjct: 150 AYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKGGQGERHVLIFDLGGGTFDV 209

Query: 690 PSLP-SRRYLRGEIHRGDTHL 749
             L         +   GDTHL
Sbjct: 210 SILTIDDGIFEVKATAGDTHL 230



 Score = 92.3 bits (219), Expect = 2e-18
 Identities = 40/56 (71%), Positives = 51/56 (91%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+V+++GGKPK+ V+YKGE+K F+PEE+SSMVLTK+KETAEA+LG  V NAVITVP
Sbjct: 94  FQVINEGGKPKVLVSYKGENKAFYPEEISSMVLTKLKETAEAFLGHPVTNAVITVP 149



 Score = 58.8 bits (136), Expect = 2e-08
 Identities = 24/33 (72%), Positives = 28/33 (84%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGRKF D  VQADMK WPF++
Sbjct: 64  NPQNTVFDAKRLIGRKFNDPVVQADMKLWPFQV 96


>BC034483-1|AAH34483.1|  641|Homo sapiens heat shock 70kDa protein
           1-like protein.
          Length = 641

 Score =  124 bits (300), Expect = 3e-28
 Identities = 58/62 (93%), Positives = 59/62 (95%)
 Frame = +3

Query: 75  AKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM 254
           AK  A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM
Sbjct: 4   AKGIAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM 63

Query: 255 TP 260
            P
Sbjct: 64  NP 65



 Score =  110 bits (265), Expect = 5e-24
 Identities = 58/81 (71%), Positives = 61/81 (75%), Gaps = 1/81 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDK G GER+VLIFDLGGGT   
Sbjct: 150 AYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKGGQGERHVLIFDLGGGTFDV 209

Query: 690 PSLP-SRRYLRGEIHRGDTHL 749
             L         +   GDTHL
Sbjct: 210 SILTIDDGIFEVKATAGDTHL 230



 Score = 92.3 bits (219), Expect = 2e-18
 Identities = 40/56 (71%), Positives = 51/56 (91%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+V+++GGKPK+ V+YKGE+K F+PEE+SSMVLTK+KETAEA+LG  V NAVITVP
Sbjct: 94  FQVINEGGKPKVLVSYKGENKAFYPEEISSMVLTKLKETAEAFLGHPVTNAVITVP 149



 Score = 58.8 bits (136), Expect = 2e-08
 Identities = 24/33 (72%), Positives = 28/33 (84%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGRKF D  VQADMK WPF++
Sbjct: 64  NPQNTVFDAKRLIGRKFNDPVVQADMKLWPFQV 96


>BA000025-10|BAB63301.1|  641|Homo sapiens heat shock protein
           protein.
          Length = 641

 Score =  124 bits (300), Expect = 3e-28
 Identities = 58/62 (93%), Positives = 59/62 (95%)
 Frame = +3

Query: 75  AKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM 254
           AK  A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM
Sbjct: 4   AKGIAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM 63

Query: 255 TP 260
            P
Sbjct: 64  NP 65



 Score =  110 bits (265), Expect = 5e-24
 Identities = 58/81 (71%), Positives = 61/81 (75%), Gaps = 1/81 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDK G GER+VLIFDLGGGT   
Sbjct: 150 AYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKGGQGERHVLIFDLGGGTFDV 209

Query: 690 PSLP-SRRYLRGEIHRGDTHL 749
             L         +   GDTHL
Sbjct: 210 SILTIDDGIFEVKATAGDTHL 230



 Score = 92.3 bits (219), Expect = 2e-18
 Identities = 40/56 (71%), Positives = 51/56 (91%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+V+++GGKPK+ V+YKGE+K F+PEE+SSMVLTK+KETAEA+LG  V NAVITVP
Sbjct: 94  FQVINEGGKPKVLVSYKGENKAFYPEEISSMVLTKLKETAEAFLGHPVTNAVITVP 149



 Score = 58.8 bits (136), Expect = 2e-08
 Identities = 24/33 (72%), Positives = 28/33 (84%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGRKF D  VQADMK WPF++
Sbjct: 64  NPQNTVFDAKRLIGRKFNDPVVQADMKLWPFQV 96


>AL929592-4|CAI18463.1|  641|Homo sapiens heat shock 70kDa protein
           1-like protein.
          Length = 641

 Score =  124 bits (300), Expect = 3e-28
 Identities = 58/62 (93%), Positives = 59/62 (95%)
 Frame = +3

Query: 75  AKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM 254
           AK  A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM
Sbjct: 4   AKGIAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM 63

Query: 255 TP 260
            P
Sbjct: 64  NP 65



 Score =  110 bits (265), Expect = 5e-24
 Identities = 58/81 (71%), Positives = 61/81 (75%), Gaps = 1/81 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDK G GER+VLIFDLGGGT   
Sbjct: 150 AYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKGGQGERHVLIFDLGGGTFDV 209

Query: 690 PSLP-SRRYLRGEIHRGDTHL 749
             L         +   GDTHL
Sbjct: 210 SILTIDDGIFEVKATAGDTHL 230



 Score = 92.3 bits (219), Expect = 2e-18
 Identities = 40/56 (71%), Positives = 51/56 (91%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+V+++GGKPK+ V+YKGE+K F+PEE+SSMVLTK+KETAEA+LG  V NAVITVP
Sbjct: 94  FQVINEGGKPKVLVSYKGENKAFYPEEISSMVLTKLKETAEAFLGHPVTNAVITVP 149



 Score = 58.8 bits (136), Expect = 2e-08
 Identities = 24/33 (72%), Positives = 28/33 (84%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGRKF D  VQADMK WPF++
Sbjct: 64  NPQNTVFDAKRLIGRKFNDPVVQADMKLWPFQV 96


>AL671762-4|CAI18215.1|  641|Homo sapiens heat shock 70kDa protein
           1-like protein.
          Length = 641

 Score =  124 bits (300), Expect = 3e-28
 Identities = 58/62 (93%), Positives = 59/62 (95%)
 Frame = +3

Query: 75  AKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM 254
           AK  A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM
Sbjct: 4   AKGIAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM 63

Query: 255 TP 260
            P
Sbjct: 64  NP 65



 Score =  110 bits (265), Expect = 5e-24
 Identities = 58/81 (71%), Positives = 61/81 (75%), Gaps = 1/81 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDK G GER+VLIFDLGGGT   
Sbjct: 150 AYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKGGQGERHVLIFDLGGGTFDV 209

Query: 690 PSLP-SRRYLRGEIHRGDTHL 749
             L         +   GDTHL
Sbjct: 210 SILTIDDGIFEVKATAGDTHL 230



 Score = 92.3 bits (219), Expect = 2e-18
 Identities = 40/56 (71%), Positives = 51/56 (91%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+V+++GGKPK+ V+YKGE+K F+PEE+SSMVLTK+KETAEA+LG  V NAVITVP
Sbjct: 94  FQVINEGGKPKVLVSYKGENKAFYPEEISSMVLTKLKETAEAFLGHPVTNAVITVP 149



 Score = 58.8 bits (136), Expect = 2e-08
 Identities = 24/33 (72%), Positives = 28/33 (84%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGRKF D  VQADMK WPF++
Sbjct: 64  NPQNTVFDAKRLIGRKFNDPVVQADMKLWPFQV 96


>AL662834-15|CAI17736.1|  641|Homo sapiens heat shock 70kDa protein
           1-like protein.
          Length = 641

 Score =  124 bits (300), Expect = 3e-28
 Identities = 58/62 (93%), Positives = 59/62 (95%)
 Frame = +3

Query: 75  AKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM 254
           AK  A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM
Sbjct: 4   AKGIAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM 63

Query: 255 TP 260
            P
Sbjct: 64  NP 65



 Score =  110 bits (265), Expect = 5e-24
 Identities = 58/81 (71%), Positives = 61/81 (75%), Gaps = 1/81 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDK G GER+VLIFDLGGGT   
Sbjct: 150 AYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKGGQGERHVLIFDLGGGTFDV 209

Query: 690 PSLP-SRRYLRGEIHRGDTHL 749
             L         +   GDTHL
Sbjct: 210 SILTIDDGIFEVKATAGDTHL 230



 Score = 92.3 bits (219), Expect = 2e-18
 Identities = 40/56 (71%), Positives = 51/56 (91%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+V+++GGKPK+ V+YKGE+K F+PEE+SSMVLTK+KETAEA+LG  V NAVITVP
Sbjct: 94  FQVINEGGKPKVLVSYKGENKAFYPEEISSMVLTKLKETAEAFLGHPVTNAVITVP 149



 Score = 58.8 bits (136), Expect = 2e-08
 Identities = 24/33 (72%), Positives = 28/33 (84%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGRKF D  VQADMK WPF++
Sbjct: 64  NPQNTVFDAKRLIGRKFNDPVVQADMKLWPFQV 96


>AK223386-1|BAD97106.1|  641|Homo sapiens heat shock 70kDa protein
           1-like variant protein.
          Length = 641

 Score =  124 bits (300), Expect = 3e-28
 Identities = 58/62 (93%), Positives = 59/62 (95%)
 Frame = +3

Query: 75  AKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM 254
           AK  A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM
Sbjct: 4   AKGIAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM 63

Query: 255 TP 260
            P
Sbjct: 64  NP 65



 Score =  110 bits (265), Expect = 5e-24
 Identities = 58/81 (71%), Positives = 61/81 (75%), Gaps = 1/81 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDK G GER+VLIFDLGGGT   
Sbjct: 150 AYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKGGQGERHVLIFDLGGGTFDV 209

Query: 690 PSLP-SRRYLRGEIHRGDTHL 749
             L         +   GDTHL
Sbjct: 210 SILTIDDGIFEVKATAGDTHL 230



 Score = 92.3 bits (219), Expect = 2e-18
 Identities = 40/56 (71%), Positives = 51/56 (91%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+V+++GGKPK+ V+YKGE+K F+PEE+SSMVLTK+KETAEA+LG  V NAVITVP
Sbjct: 94  FQVINEGGKPKVLVSYKGENKAFYPEEISSMVLTKLKETAEAFLGHPVTNAVITVP 149



 Score = 58.8 bits (136), Expect = 2e-08
 Identities = 24/33 (72%), Positives = 28/33 (84%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGRKF D  VQADMK WPF++
Sbjct: 64  NPQNTVFDAKRLIGRKFNDPVVQADMKLWPFQV 96


>AF134726-8|AAD21817.1|  641|Homo sapiens HSP70-HOM protein.
          Length = 641

 Score =  124 bits (300), Expect = 3e-28
 Identities = 58/62 (93%), Positives = 59/62 (95%)
 Frame = +3

Query: 75  AKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM 254
           AK  A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM
Sbjct: 4   AKGIAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM 63

Query: 255 TP 260
            P
Sbjct: 64  NP 65



 Score =  110 bits (265), Expect = 5e-24
 Identities = 58/81 (71%), Positives = 61/81 (75%), Gaps = 1/81 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDK G GER+VLIFDLGGGT   
Sbjct: 150 AYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKGGQGERHVLIFDLGGGTFDV 209

Query: 690 PSLP-SRRYLRGEIHRGDTHL 749
             L         +   GDTHL
Sbjct: 210 SILTIDDGIFEVKATAGDTHL 230



 Score = 92.3 bits (219), Expect = 2e-18
 Identities = 40/56 (71%), Positives = 51/56 (91%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+V+++GGKPK+ V+YKGE+K F+PEE+SSMVLTK+KETAEA+LG  V NAVITVP
Sbjct: 94  FQVINEGGKPKVLVSYKGENKAFYPEEISSMVLTKLKETAEAFLGHPVTNAVITVP 149



 Score = 58.8 bits (136), Expect = 2e-08
 Identities = 24/33 (72%), Positives = 28/33 (84%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGRKF D  VQADMK WPF++
Sbjct: 64  NPQNTVFDAKRLIGRKFNDPVVQADMKLWPFQV 96


>U10149-1|AAC50076.1|  125|Homo sapiens heat shock protein protein.
          Length = 125

 Score =  122 bits (295), Expect = 1e-27
 Identities = 58/63 (92%), Positives = 60/63 (95%)
 Frame = +3

Query: 75  AKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM 254
           A+ PA+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIG AAKNQVAM
Sbjct: 3   ARGPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIG-AAKNQVAM 61

Query: 255 TPT 263
            PT
Sbjct: 62  NPT 64



 Score = 70.1 bits (164), Expect = 8e-12
 Identities = 32/57 (56%), Positives = 40/57 (70%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFELSVMEANLRSR*HIRVKTKPFSPRK 424
           +P NTIFDAKRLIGRKFEDATVQ+DMKHWPF +       + +   + +TK F P +
Sbjct: 62  NPTNTIFDAKRLIGRKFEDATVQSDMKHWPFRVVSEGGKPKVQVEYKGETKTFFPEE 118



 Score = 64.9 bits (151), Expect = 3e-10
 Identities = 28/34 (82%), Positives = 32/34 (94%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLT 444
           FRVVS+GGKPK++V YKGE KTFFPEE+SSMVLT
Sbjct: 92  FRVVSEGGKPKVQVEYKGETKTFFPEEISSMVLT 125


>M11236-1|AAA52696.1|  247|Homo sapiens HSPA1L protein.
          Length = 247

 Score =  114 bits (274), Expect = 4e-25
 Identities = 51/58 (87%), Positives = 55/58 (94%)
 Frame = +3

Query: 87  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           AVGIDLGTTYSCVGVFQ G+VEI+ANDQGNRTTPSYVAFTDTERL+GDAAKNQ A+ P
Sbjct: 8   AVGIDLGTTYSCVGVFQQGRVEILANDQGNRTTPSYVAFTDTERLVGDAAKNQAALNP 65



 Score = 99.5 bits (237), Expect = 1e-20
 Identities = 44/56 (78%), Positives = 53/56 (94%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VVS GGKPK++V Y+GEDKTF+PEE+SSMVLTKMKETAEAYLG+ V++AVITVP
Sbjct: 94  FKVVSGGGKPKVRVCYRGEDKTFYPEEISSMVLTKMKETAEAYLGQPVKHAVITVP 149



 Score = 95.1 bits (226), Expect = 2e-19
 Identities = 50/80 (62%), Positives = 57/80 (71%), Gaps = 1/80 (1%)
 Frame = +3

Query: 513 YFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTCP 692
           YF++SQRQATKDAG I+GL VL IINE TAAAIAYGLD++  G+RNVLIFDLGGGT    
Sbjct: 151 YFSNSQRQATKDAGAIAGLKVLPIINEATAAAIAYGLDRRRAGKRNVLIFDLGGGTFDVS 210

Query: 693 SLP-SRRYLRGEIHRGDTHL 749
            L         +   GDTHL
Sbjct: 211 VLTIDAGVFEVKATAGDTHL 230



 Score = 65.3 bits (152), Expect = 2e-10
 Identities = 30/57 (52%), Positives = 39/57 (68%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFELSVMEANLRSR*HIRVKTKPFSPRK 424
           +P+NT+FDAKRLIGRKF D TVQ+DMKHWPF++       + R   R + K F P +
Sbjct: 64  NPHNTVFDAKRLIGRKFADTTVQSDMKHWPFKVVSGGGKPKVRVCYRGEDKTFYPEE 120


>X51757-1|CAA36061.1|  643|Homo sapiens protein ( Human heat-shock
           protein HSP70B' gene. ).
          Length = 643

 Score =  113 bits (273), Expect = 5e-25
 Identities = 58/81 (71%), Positives = 62/81 (76%), Gaps = 1/81 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLD++G GERNVLIFDLGGGT   
Sbjct: 150 AYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDRRGAGERNVLIFDLGGGTFDV 209

Query: 690 PSLP-SRRYLRGEIHRGDTHL 749
             L         +   GDTHL
Sbjct: 210 SVLSIDAGVFEVKATAGDTHL 230



 Score =  112 bits (269), Expect = 1e-24
 Identities = 50/58 (86%), Positives = 55/58 (94%)
 Frame = +3

Query: 87  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           AVGIDLGTTYSCVGVFQ G+VEI+ANDQGNRTTPSYVAFTDTERL+GDAAK+Q A+ P
Sbjct: 8   AVGIDLGTTYSCVGVFQQGRVEILANDQGNRTTPSYVAFTDTERLVGDAAKSQAALNP 65



 Score = 99.5 bits (237), Expect = 1e-20
 Identities = 44/56 (78%), Positives = 54/56 (96%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           FRVVS+GGKPK+ V+Y+GEDKTF+PEE+SSMVL+KMKETAEAYLG+ V++AVITVP
Sbjct: 94  FRVVSEGGKPKVPVSYRGEDKTFYPEEISSMVLSKMKETAEAYLGQPVKHAVITVP 149



 Score = 63.7 bits (148), Expect = 7e-10
 Identities = 25/33 (75%), Positives = 30/33 (90%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P+NT+FDAKRLIGRKF D TVQ+DMKHWPF +
Sbjct: 64  NPHNTVFDAKRLIGRKFADTTVQSDMKHWPFRV 96


>DQ521571-1|ABF47108.1|  643|Homo sapiens heat shock 70kDa protein 6
           (HSP70B') protein.
          Length = 643

 Score =  113 bits (273), Expect = 5e-25
 Identities = 58/81 (71%), Positives = 62/81 (76%), Gaps = 1/81 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLD++G GERNVLIFDLGGGT   
Sbjct: 150 AYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDRRGAGERNVLIFDLGGGTFDV 209

Query: 690 PSLP-SRRYLRGEIHRGDTHL 749
             L         +   GDTHL
Sbjct: 210 SVLSIDAGVFEVKATAGDTHL 230



 Score =  112 bits (269), Expect = 1e-24
 Identities = 50/58 (86%), Positives = 55/58 (94%)
 Frame = +3

Query: 87  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           AVGIDLGTTYSCVGVFQ G+VEI+ANDQGNRTTPSYVAFTDTERL+GDAAK+Q A+ P
Sbjct: 8   AVGIDLGTTYSCVGVFQQGRVEILANDQGNRTTPSYVAFTDTERLVGDAAKSQAALNP 65



 Score =  100 bits (239), Expect = 6e-21
 Identities = 44/56 (78%), Positives = 54/56 (96%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           FRVVS+GGKPK++V Y+GEDKTF+PEE+SSMVL+KMKETAEAYLG+ V++AVITVP
Sbjct: 94  FRVVSEGGKPKVRVCYRGEDKTFYPEEISSMVLSKMKETAEAYLGQPVKHAVITVP 149



 Score = 65.3 bits (152), Expect = 2e-10
 Identities = 30/57 (52%), Positives = 38/57 (66%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFELSVMEANLRSR*HIRVKTKPFSPRK 424
           +P+NT+FDAKRLIGRKF D TVQ+DMKHWPF +       + R   R + K F P +
Sbjct: 64  NPHNTVFDAKRLIGRKFADTTVQSDMKHWPFRVVSEGGKPKVRVCYRGEDKTFYPEE 120


>BC035665-1|AAH35665.1|  643|Homo sapiens heat shock 70kDa protein 6
           (HSP70B') protein.
          Length = 643

 Score =  113 bits (273), Expect = 5e-25
 Identities = 58/81 (71%), Positives = 62/81 (76%), Gaps = 1/81 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLD++G GERNVLIFDLGGGT   
Sbjct: 150 AYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDRRGAGERNVLIFDLGGGTFDV 209

Query: 690 PSLP-SRRYLRGEIHRGDTHL 749
             L         +   GDTHL
Sbjct: 210 SVLSIDAGVFEVKATAGDTHL 230



 Score =  112 bits (269), Expect = 1e-24
 Identities = 50/58 (86%), Positives = 55/58 (94%)
 Frame = +3

Query: 87  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           AVGIDLGTTYSCVGVFQ G+VEI+ANDQGNRTTPSYVAFTDTERL+GDAAK+Q A+ P
Sbjct: 8   AVGIDLGTTYSCVGVFQQGRVEILANDQGNRTTPSYVAFTDTERLVGDAAKSQAALNP 65



 Score =  100 bits (239), Expect = 6e-21
 Identities = 44/56 (78%), Positives = 54/56 (96%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           FRVVS+GGKPK++V Y+GEDKTF+PEE+SSMVL+KMKETAEAYLG+ V++AVITVP
Sbjct: 94  FRVVSEGGKPKVRVCYRGEDKTFYPEEISSMVLSKMKETAEAYLGQPVKHAVITVP 149



 Score = 65.3 bits (152), Expect = 2e-10
 Identities = 30/57 (52%), Positives = 38/57 (66%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFELSVMEANLRSR*HIRVKTKPFSPRK 424
           +P+NT+FDAKRLIGRKF D TVQ+DMKHWPF +       + R   R + K F P +
Sbjct: 64  NPHNTVFDAKRLIGRKFADTTVQSDMKHWPFRVVSEGGKPKVRVCYRGEDKTFYPEE 120


>AL590385-3|CAI16120.1|  643|Homo sapiens heat shock 70kDa protein 6
           (HSP70B') protein.
          Length = 643

 Score =  113 bits (273), Expect = 5e-25
 Identities = 58/81 (71%), Positives = 62/81 (76%), Gaps = 1/81 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLD++G GERNVLIFDLGGGT   
Sbjct: 150 AYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDRRGAGERNVLIFDLGGGTFDV 209

Query: 690 PSLP-SRRYLRGEIHRGDTHL 749
             L         +   GDTHL
Sbjct: 210 SVLSIDAGVFEVKATAGDTHL 230



 Score =  112 bits (269), Expect = 1e-24
 Identities = 50/58 (86%), Positives = 55/58 (94%)
 Frame = +3

Query: 87  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           AVGIDLGTTYSCVGVFQ G+VEI+ANDQGNRTTPSYVAFTDTERL+GDAAK+Q A+ P
Sbjct: 8   AVGIDLGTTYSCVGVFQQGRVEILANDQGNRTTPSYVAFTDTERLVGDAAKSQAALNP 65



 Score =  100 bits (239), Expect = 6e-21
 Identities = 44/56 (78%), Positives = 54/56 (96%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           FRVVS+GGKPK++V Y+GEDKTF+PEE+SSMVL+KMKETAEAYLG+ V++AVITVP
Sbjct: 94  FRVVSEGGKPKVRVCYRGEDKTFYPEEISSMVLSKMKETAEAYLGQPVKHAVITVP 149



 Score = 65.3 bits (152), Expect = 2e-10
 Identities = 30/57 (52%), Positives = 38/57 (66%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFELSVMEANLRSR*HIRVKTKPFSPRK 424
           +P+NT+FDAKRLIGRKF D TVQ+DMKHWPF +       + R   R + K F P +
Sbjct: 64  NPHNTVFDAKRLIGRKFADTTVQSDMKHWPFRVVSEGGKPKVRVCYRGEDKTFYPEE 120


>AK223362-1|BAD97082.1|  643|Homo sapiens heat shock 70kDa protein 6
           (HSP70B') variant protein.
          Length = 643

 Score =  112 bits (269), Expect = 1e-24
 Identities = 50/58 (86%), Positives = 55/58 (94%)
 Frame = +3

Query: 87  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           AVGIDLGTTYSCVGVFQ G+VEI+ANDQGNRTTPSYVAFTDTERL+GDAAK+Q A+ P
Sbjct: 8   AVGIDLGTTYSCVGVFQQGRVEILANDQGNRTTPSYVAFTDTERLVGDAAKSQAALNP 65



 Score =  112 bits (269), Expect = 1e-24
 Identities = 57/81 (70%), Positives = 61/81 (75%), Gaps = 1/81 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLD++G GERNV IFDLGGGT   
Sbjct: 150 AYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDRRGAGERNVFIFDLGGGTFDV 209

Query: 690 PSLP-SRRYLRGEIHRGDTHL 749
             L         +   GDTHL
Sbjct: 210 SVLSIDAGVFEVKATAGDTHL 230



 Score =  100 bits (239), Expect = 6e-21
 Identities = 44/56 (78%), Positives = 54/56 (96%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           FRVVS+GGKPK++V Y+GEDKTF+PEE+SSMVL+KMKETAEAYLG+ V++AVITVP
Sbjct: 94  FRVVSEGGKPKVRVCYRGEDKTFYPEEISSMVLSKMKETAEAYLGQPVKHAVITVP 149



 Score = 65.3 bits (152), Expect = 2e-10
 Identities = 30/57 (52%), Positives = 38/57 (66%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFELSVMEANLRSR*HIRVKTKPFSPRK 424
           +P+NT+FDAKRLIGRKF D TVQ+DMKHWPF +       + R   R + K F P +
Sbjct: 64  NPHNTVFDAKRLIGRKFADTTVQSDMKHWPFRVVSEGGKPKVRVCYRGEDKTFYPEE 120


>AB018045-1|BAA77235.1|  151|Homo sapiens heat shock protein 72
           protein.
          Length = 151

 Score =  111 bits (268), Expect = 2e-24
 Identities = 58/81 (71%), Positives = 61/81 (75%), Gaps = 1/81 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLD+ G GERNVLIFDLGGGT   
Sbjct: 62  AYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDRTGKGERNVLIFDLGGGTFDV 121

Query: 690 PSLP-SRRYLRGEIHRGDTHL 749
             L         +   GDTHL
Sbjct: 122 SILTIDDGIFEVKATAGDTHL 142



 Score = 91.5 bits (217), Expect = 3e-18
 Identities = 41/56 (73%), Positives = 49/56 (87%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+V++DG KPK++V+YKGE K F+PEE+SSMVLTKMKE AEAYLG  V NAVITVP
Sbjct: 6   FQVINDGDKPKVQVSYKGETKAFYPEEISSMVLTKMKEIAEAYLGYPVTNAVITVP 61


>BC007276-1|AAH07276.2|  587|Homo sapiens HSPA8 protein protein.
          Length = 587

 Score =  110 bits (265), Expect = 5e-24
 Identities = 59/81 (72%), Positives = 61/81 (75%), Gaps = 1/81 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAGTI+GLNVLRIINEPTAAAIAYGLDKK   ERNVLIFDLGGGT   
Sbjct: 89  AYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDV 148

Query: 690 PSLP-SRRYLRGEIHRGDTHL 749
             L         +   GDTHL
Sbjct: 149 SILTIEDGIFEVKSTAGDTHL 169



 Score = 95.1 bits (226), Expect = 2e-19
 Identities = 43/56 (76%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F VV+D G+PK++V YKGE K+F+PEEVSSMVLTKMKE AEAYLGKTV NAV+TVP
Sbjct: 33  FMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVP 88



 Score = 64.1 bits (149), Expect = 5e-10
 Identities = 28/57 (49%), Positives = 39/57 (68%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFELSVMEANLRSR*HIRVKTKPFSPRK 424
           +P NT+FDAKRLIGR+F+DA VQ+DMKHWPF +       + +   + +TK F P +
Sbjct: 3   NPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEE 59


>X87949-1|CAA61201.1|  653|Homo sapiens BiP protein.
          Length = 653

 Score =  105 bits (252), Expect = 2e-22
 Identities = 54/81 (66%), Positives = 61/81 (75%), Gaps = 1/81 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFND+QRQATKDAGTI+GLNV+RIINEPTAAAIAYGLDK+  GE+N+L+FDLGGGT   
Sbjct: 174 AYFNDAQRQATKDAGTIAGLNVMRIINEPTAAAIAYGLDKR-EGEKNILVFDLGGGTFDV 232

Query: 690 PSLP-SRRYLRGEIHRGDTHL 749
             L             GDTHL
Sbjct: 233 SLLTIDNGVFEVVATNGDTHL 253



 Score = 99.1 bits (236), Expect = 1e-20
 Identities = 47/58 (81%), Positives = 52/58 (89%), Gaps = 1/58 (1%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMTP 260
           VGIDLGTTYSCVGVF++G+VEIIANDQGNR TPSYVAFT + ERLIGDAAKNQ+   P
Sbjct: 31  VGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTPEGERLIGDAAKNQLTSNP 88



 Score = 72.9 bits (171), Expect = 1e-12
 Identities = 38/59 (64%), Positives = 45/59 (76%), Gaps = 1/59 (1%)
 Frame = +1

Query: 337 LAFRVVSDGGKPKIKVAYKG-EDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           L F+VV    KP I+V   G + KTF PEE+S+MVLTKMKETAEAYLGK V +AV+TVP
Sbjct: 115 LPFKVVEKKTKPYIQVDIGGGQTKTFAPEEISAMVLTKMKETAEAYLGKKVTHAVVTVP 173



 Score = 47.6 bits (108), Expect = 5e-05
 Identities = 25/60 (41%), Positives = 38/60 (63%), Gaps = 3/60 (5%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFELSVMEANLRSR*HIRV---KTKPFSPRK 424
           +P NT+FDAKRLIGR + D +VQ D+K  PF+  V+E   +    + +   +TK F+P +
Sbjct: 87  NPENTVFDAKRLIGRTWNDPSVQQDIKFLPFK--VVEKKTKPYIQVDIGGGQTKTFAPEE 144


>M19645-1|AAA52614.1|  653|Homo sapiens protein ( Human 78 kdalton
           glucose-regulated protein (GRP78) gene, complete cds. ).
          Length = 653

 Score =  105 bits (252), Expect = 2e-22
 Identities = 54/81 (66%), Positives = 61/81 (75%), Gaps = 1/81 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFND+QRQATKDAGTI+GLNV+RIINEPTAAAIAYGLDK+  GE+N+L+FDLGGGT   
Sbjct: 174 AYFNDAQRQATKDAGTIAGLNVMRIINEPTAAAIAYGLDKR-EGEKNILVFDLGGGTFDV 232

Query: 690 PSLP-SRRYLRGEIHRGDTHL 749
             L             GDTHL
Sbjct: 233 SLLTIDNGVFEVVATNGDTHL 253



 Score = 99.1 bits (236), Expect = 1e-20
 Identities = 47/58 (81%), Positives = 52/58 (89%), Gaps = 1/58 (1%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMTP 260
           VGIDLGTTYSCVGVF++G+VEIIANDQGNR TPSYVAFT + ERLIGDAAKNQ+   P
Sbjct: 31  VGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTPEGERLIGDAAKNQLTSNP 88



 Score = 72.9 bits (171), Expect = 1e-12
 Identities = 38/59 (64%), Positives = 45/59 (76%), Gaps = 1/59 (1%)
 Frame = +1

Query: 337 LAFRVVSDGGKPKIKVAYKG-EDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           L F+VV    KP I+V   G + KTF PEE+S+MVLTKMKETAEAYLGK V +AV+TVP
Sbjct: 115 LPFKVVEKKTKPYIQVDIGGGQTKTFAPEEISAMVLTKMKETAEAYLGKKVTHAVVTVP 173



 Score = 47.6 bits (108), Expect = 5e-05
 Identities = 25/60 (41%), Positives = 38/60 (63%), Gaps = 3/60 (5%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFELSVMEANLRSR*HIRV---KTKPFSPRK 424
           +P NT+FDAKRLIGR + D +VQ D+K  PF+  V+E   +    + +   +TK F+P +
Sbjct: 87  NPENTVFDAKRLIGRTWNDPSVQQDIKFLPFK--VVEKKTKPYIQVDIGGGQTKTFAPEE 144


>DQ385847-1|ABD04090.1|  654|Homo sapiens heat shock 70kDa protein 5
           (glucose-regulated protein, 78kDa) protein.
          Length = 654

 Score =  105 bits (252), Expect = 2e-22
 Identities = 54/81 (66%), Positives = 61/81 (75%), Gaps = 1/81 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFND+QRQATKDAGTI+GLNV+RIINEPTAAAIAYGLDK+  GE+N+L+FDLGGGT   
Sbjct: 174 AYFNDAQRQATKDAGTIAGLNVMRIINEPTAAAIAYGLDKR-EGEKNILVFDLGGGTFDV 232

Query: 690 PSLP-SRRYLRGEIHRGDTHL 749
             L             GDTHL
Sbjct: 233 SLLTIDNGVFEVVATNGDTHL 253



 Score = 99.1 bits (236), Expect = 1e-20
 Identities = 47/58 (81%), Positives = 52/58 (89%), Gaps = 1/58 (1%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMTP 260
           VGIDLGTTYSCVGVF++G+VEIIANDQGNR TPSYVAFT + ERLIGDAAKNQ+   P
Sbjct: 31  VGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTPEGERLIGDAAKNQLTSNP 88



 Score = 72.9 bits (171), Expect = 1e-12
 Identities = 38/59 (64%), Positives = 45/59 (76%), Gaps = 1/59 (1%)
 Frame = +1

Query: 337 LAFRVVSDGGKPKIKVAYKG-EDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           L F+VV    KP I+V   G + KTF PEE+S+MVLTKMKETAEAYLGK V +AV+TVP
Sbjct: 115 LPFKVVEKKTKPYIQVDIGGGQTKTFAPEEISAMVLTKMKETAEAYLGKKVTHAVVTVP 173



 Score = 47.6 bits (108), Expect = 5e-05
 Identities = 25/60 (41%), Positives = 38/60 (63%), Gaps = 3/60 (5%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFELSVMEANLRSR*HIRV---KTKPFSPRK 424
           +P NT+FDAKRLIGR + D +VQ D+K  PF+  V+E   +    + +   +TK F+P +
Sbjct: 87  NPENTVFDAKRLIGRTWNDPSVQQDIKFLPFK--VVEKKTKPYIQVDIGGGQTKTFAPEE 144


>BC112963-1|AAI12964.1|  655|Homo sapiens HSPA5 protein protein.
          Length = 655

 Score =  105 bits (252), Expect = 2e-22
 Identities = 54/81 (66%), Positives = 61/81 (75%), Gaps = 1/81 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFND+QRQATKDAGTI+GLNV+RIINEPTAAAIAYGLDK+  GE+N+L+FDLGGGT   
Sbjct: 175 AYFNDAQRQATKDAGTIAGLNVMRIINEPTAAAIAYGLDKR-EGEKNILVFDLGGGTFDV 233

Query: 690 PSLP-SRRYLRGEIHRGDTHL 749
             L             GDTHL
Sbjct: 234 SLLTIDNGVFEVVATNGDTHL 254



 Score = 99.1 bits (236), Expect = 1e-20
 Identities = 47/58 (81%), Positives = 52/58 (89%), Gaps = 1/58 (1%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMTP 260
           VGIDLGTTYSCVGVF++G+VEIIANDQGNR TPSYVAFT + ERLIGDAAKNQ+   P
Sbjct: 32  VGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTPEGERLIGDAAKNQLTSNP 89



 Score = 72.9 bits (171), Expect = 1e-12
 Identities = 38/59 (64%), Positives = 45/59 (76%), Gaps = 1/59 (1%)
 Frame = +1

Query: 337 LAFRVVSDGGKPKIKVAYKG-EDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           L F+VV    KP I+V   G + KTF PEE+S+MVLTKMKETAEAYLGK V +AV+TVP
Sbjct: 116 LPFKVVEKKTKPYIQVDIGGGQTKTFAPEEISAMVLTKMKETAEAYLGKKVTHAVVTVP 174



 Score = 47.6 bits (108), Expect = 5e-05
 Identities = 25/60 (41%), Positives = 38/60 (63%), Gaps = 3/60 (5%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFELSVMEANLRSR*HIRV---KTKPFSPRK 424
           +P NT+FDAKRLIGR + D +VQ D+K  PF+  V+E   +    + +   +TK F+P +
Sbjct: 88  NPENTVFDAKRLIGRTWNDPSVQQDIKFLPFK--VVEKKTKPYIQVDIGGGQTKTFAPEE 145


>BC020235-1|AAH20235.1|  654|Homo sapiens heat shock 70kDa protein 5
           (glucose-regulated protein, 78kDa) protein.
          Length = 654

 Score =  105 bits (252), Expect = 2e-22
 Identities = 54/81 (66%), Positives = 61/81 (75%), Gaps = 1/81 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFND+QRQATKDAGTI+GLNV+RIINEPTAAAIAYGLDK+  GE+N+L+FDLGGGT   
Sbjct: 174 AYFNDAQRQATKDAGTIAGLNVMRIINEPTAAAIAYGLDKR-EGEKNILVFDLGGGTFDV 232

Query: 690 PSLP-SRRYLRGEIHRGDTHL 749
             L             GDTHL
Sbjct: 233 SLLTIDNGVFEVVATNGDTHL 253



 Score = 99.1 bits (236), Expect = 1e-20
 Identities = 47/58 (81%), Positives = 52/58 (89%), Gaps = 1/58 (1%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMTP 260
           VGIDLGTTYSCVGVF++G+VEIIANDQGNR TPSYVAFT + ERLIGDAAKNQ+   P
Sbjct: 31  VGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTPEGERLIGDAAKNQLTSNP 88



 Score = 72.9 bits (171), Expect = 1e-12
 Identities = 38/59 (64%), Positives = 45/59 (76%), Gaps = 1/59 (1%)
 Frame = +1

Query: 337 LAFRVVSDGGKPKIKVAYKG-EDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           L F+VV    KP I+V   G + KTF PEE+S+MVLTKMKETAEAYLGK V +AV+TVP
Sbjct: 115 LPFKVVEKKTKPYIQVDIGGGQTKTFAPEEISAMVLTKMKETAEAYLGKKVTHAVVTVP 173



 Score = 47.6 bits (108), Expect = 5e-05
 Identities = 25/60 (41%), Positives = 38/60 (63%), Gaps = 3/60 (5%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFELSVMEANLRSR*HIRV---KTKPFSPRK 424
           +P NT+FDAKRLIGR + D +VQ D+K  PF+  V+E   +    + +   +TK F+P +
Sbjct: 87  NPENTVFDAKRLIGRTWNDPSVQQDIKFLPFK--VVEKKTKPYIQVDIGGGQTKTFAPEE 144


>AJ271729-1|CAB71335.1|  654|Homo sapiens glucose-regulated protein
           protein.
          Length = 654

 Score =  105 bits (252), Expect = 2e-22
 Identities = 54/81 (66%), Positives = 61/81 (75%), Gaps = 1/81 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFND+QRQATKDAGTI+GLNV+RIINEPTAAAIAYGLDK+  GE+N+L+FDLGGGT   
Sbjct: 174 AYFNDAQRQATKDAGTIAGLNVMRIINEPTAAAIAYGLDKR-EGEKNILVFDLGGGTFDV 232

Query: 690 PSLP-SRRYLRGEIHRGDTHL 749
             L             GDTHL
Sbjct: 233 SLLTIDNGVFEVVATNGDTHL 253



 Score = 99.1 bits (236), Expect = 1e-20
 Identities = 47/58 (81%), Positives = 52/58 (89%), Gaps = 1/58 (1%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMTP 260
           VGIDLGTTYSCVGVF++G+VEIIANDQGNR TPSYVAFT + ERLIGDAAKNQ+   P
Sbjct: 31  VGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTPEGERLIGDAAKNQLTSNP 88



 Score = 72.9 bits (171), Expect = 1e-12
 Identities = 38/59 (64%), Positives = 45/59 (76%), Gaps = 1/59 (1%)
 Frame = +1

Query: 337 LAFRVVSDGGKPKIKVAYKG-EDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           L F+VV    KP I+V   G + KTF PEE+S+MVLTKMKETAEAYLGK V +AV+TVP
Sbjct: 115 LPFKVVEKKTKPYIQVDIGGGQTKTFAPEEISAMVLTKMKETAEAYLGKKVTHAVVTVP 173



 Score = 47.6 bits (108), Expect = 5e-05
 Identities = 25/60 (41%), Positives = 38/60 (63%), Gaps = 3/60 (5%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFELSVMEANLRSR*HIRV---KTKPFSPRK 424
           +P NT+FDAKRLIGR + D +VQ D+K  PF+  V+E   +    + +   +TK F+P +
Sbjct: 87  NPENTVFDAKRLIGRTWNDPSVQQDIKFLPFK--VVEKKTKPYIQVDIGGGQTKTFAPEE 144


>AF216292-1|AAF42836.1|  654|Homo sapiens endoplasmic reticulum
           lumenal Ca2+ binding protein grp78 protein.
          Length = 654

 Score =  105 bits (252), Expect = 2e-22
 Identities = 54/81 (66%), Positives = 61/81 (75%), Gaps = 1/81 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFND+QRQATKDAGTI+GLNV+RIINEPTAAAIAYGLDK+  GE+N+L+FDLGGGT   
Sbjct: 174 AYFNDAQRQATKDAGTIAGLNVMRIINEPTAAAIAYGLDKR-EGEKNILVFDLGGGTFDV 232

Query: 690 PSLP-SRRYLRGEIHRGDTHL 749
             L             GDTHL
Sbjct: 233 SLLTIDNGVFEVVATNGDTHL 253



 Score = 99.1 bits (236), Expect = 1e-20
 Identities = 47/58 (81%), Positives = 52/58 (89%), Gaps = 1/58 (1%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMTP 260
           VGIDLGTTYSCVGVF++G+VEIIANDQGNR TPSYVAFT + ERLIGDAAKNQ+   P
Sbjct: 31  VGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTPEGERLIGDAAKNQLTSNP 88



 Score = 72.9 bits (171), Expect = 1e-12
 Identities = 38/59 (64%), Positives = 45/59 (76%), Gaps = 1/59 (1%)
 Frame = +1

Query: 337 LAFRVVSDGGKPKIKVAYKG-EDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           L F+VV    KP I+V   G + KTF PEE+S+MVLTKMKETAEAYLGK V +AV+TVP
Sbjct: 115 LPFKVVEKKTKPYIQVDIGGGQTKTFAPEEISAMVLTKMKETAEAYLGKKVTHAVVTVP 173



 Score = 47.6 bits (108), Expect = 5e-05
 Identities = 25/60 (41%), Positives = 38/60 (63%), Gaps = 3/60 (5%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFELSVMEANLRSR*HIRV---KTKPFSPRK 424
           +P NT+FDAKRLIGR + D +VQ D+K  PF+  V+E   +    + +   +TK F+P +
Sbjct: 87  NPENTVFDAKRLIGRTWNDPSVQQDIKFLPFK--VVEKKTKPYIQVDIGGGQTKTFAPEE 144


>AF188611-1|AAF13605.1|  639|Homo sapiens BiP protein protein.
          Length = 639

 Score =  105 bits (252), Expect = 2e-22
 Identities = 54/81 (66%), Positives = 61/81 (75%), Gaps = 1/81 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFND+QRQATKDAGTI+GLNV+RIINEPTAAAIAYGLDK+  GE+N+L+FDLGGGT   
Sbjct: 156 AYFNDAQRQATKDAGTIAGLNVMRIINEPTAAAIAYGLDKR-EGEKNILVFDLGGGTFDV 214

Query: 690 PSLP-SRRYLRGEIHRGDTHL 749
             L             GDTHL
Sbjct: 215 SLLTIDNGVFEVVATNGDTHL 235



 Score = 99.1 bits (236), Expect = 1e-20
 Identities = 47/58 (81%), Positives = 52/58 (89%), Gaps = 1/58 (1%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMTP 260
           VGIDLGTTYSCVGVF++G+VEIIANDQGNR TPSYVAFT + ERLIGDAAKNQ+   P
Sbjct: 13  VGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTPEGERLIGDAAKNQLTSNP 70



 Score = 72.9 bits (171), Expect = 1e-12
 Identities = 38/59 (64%), Positives = 45/59 (76%), Gaps = 1/59 (1%)
 Frame = +1

Query: 337 LAFRVVSDGGKPKIKVAYKG-EDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           L F+VV    KP I+V   G + KTF PEE+S+MVLTKMKETAEAYLGK V +AV+TVP
Sbjct: 97  LPFKVVEKKTKPYIQVDIGGGQTKTFAPEEISAMVLTKMKETAEAYLGKKVTHAVVTVP 155



 Score = 47.6 bits (108), Expect = 5e-05
 Identities = 25/60 (41%), Positives = 38/60 (63%), Gaps = 3/60 (5%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFELSVMEANLRSR*HIRV---KTKPFSPRK 424
           +P NT+FDAKRLIGR + D +VQ D+K  PF+  V+E   +    + +   +TK F+P +
Sbjct: 69  NPENTVFDAKRLIGRTWNDPSVQQDIKFLPFK--VVEKKTKPYIQVDIGGGQTKTFAPEE 126


>L15189-1|AAA67526.1|  679|Homo sapiens MTHSP75 protein.
          Length = 679

 Score = 91.9 bits (218), Expect = 2e-18
 Identities = 43/57 (75%), Positives = 51/57 (89%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 680
           AYFNDSQRQATKDAG ISGLNVLR+INEPTAAA+AYGLDK  + ++ + ++DLGGGT
Sbjct: 195 AYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDK--SEDKVIAVYDLGGGT 249



 Score = 67.3 bits (157), Expect = 6e-11
 Identities = 35/79 (44%), Positives = 46/79 (58%), Gaps = 1/79 (1%)
 Frame = +3

Query: 39  RTSNKTD*KYKMAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTE 215
           R  ++ D   +  K   VGIDLGTT SCV V +  + +++ N +G RTTPS VAFT D E
Sbjct: 39  RLVSRRDYASEAIKGAVVGIDLGTTNSCVAVMEGKQAKVLENAEGARTTPSVVAFTADGE 98

Query: 216 RLIGDAAKNQVAMTPTTQY 272
           RL+G  AK Q    P   +
Sbjct: 99  RLVGMPAKRQAVTNPNNTF 117



 Score = 49.6 bits (113), Expect = 1e-05
 Identities = 22/36 (61%), Positives = 27/36 (75%)
 Frame = +1

Query: 403 KTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           K + P ++ + VL KMKETAE YLG T +NAVITVP
Sbjct: 159 KLYSPSQIGAFVLMKMKETAENYLGHTAKNAVITVP 194



 Score = 44.4 bits (100), Expect = 4e-04
 Identities = 17/33 (51%), Positives = 26/33 (78%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +PNNT +  KRLIGR+++D  VQ D+K+ PF++
Sbjct: 112 NPNNTFYATKRLIGRRYDDPEVQKDIKNVPFKI 144


>DQ531046-1|ABF50973.1|  679|Homo sapiens heat shock 70kDa protein
           9B (mortalin-2) protein.
          Length = 679

 Score = 91.9 bits (218), Expect = 2e-18
 Identities = 43/57 (75%), Positives = 51/57 (89%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 680
           AYFNDSQRQATKDAG ISGLNVLR+INEPTAAA+AYGLDK  + ++ + ++DLGGGT
Sbjct: 195 AYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDK--SEDKVIAVYDLGGGT 249



 Score = 67.3 bits (157), Expect = 6e-11
 Identities = 35/79 (44%), Positives = 46/79 (58%), Gaps = 1/79 (1%)
 Frame = +3

Query: 39  RTSNKTD*KYKMAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTE 215
           R  ++ D   +  K   VGIDLGTT SCV V +  + +++ N +G RTTPS VAFT D E
Sbjct: 39  RLVSRRDYASEAIKGAVVGIDLGTTNSCVAVMEGKQAKVLENAEGARTTPSVVAFTADGE 98

Query: 216 RLIGDAAKNQVAMTPTTQY 272
           RL+G  AK Q    P   +
Sbjct: 99  RLVGMPAKRQAVTNPNNTF 117



 Score = 49.6 bits (113), Expect = 1e-05
 Identities = 22/36 (61%), Positives = 27/36 (75%)
 Frame = +1

Query: 403 KTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           K + P ++ + VL KMKETAE YLG T +NAVITVP
Sbjct: 159 KLYSPSQIGAFVLMKMKETAENYLGHTAKNAVITVP 194



 Score = 44.4 bits (100), Expect = 4e-04
 Identities = 17/33 (51%), Positives = 26/33 (78%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +PNNT +  KRLIGR+++D  VQ D+K+ PF++
Sbjct: 112 NPNNTFYATKRLIGRRYDDPEVQKDIKNVPFKI 144


>BC030634-1|AAH30634.1|  681|Homo sapiens HSPA9 protein protein.
          Length = 681

 Score = 91.9 bits (218), Expect = 2e-18
 Identities = 43/57 (75%), Positives = 51/57 (89%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 680
           AYFNDSQRQATKDAG ISGLNVLR+INEPTAAA+AYGLDK  + ++ + ++DLGGGT
Sbjct: 197 AYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDK--SEDKVIAVYDLGGGT 251



 Score = 67.7 bits (158), Expect = 4e-11
 Identities = 35/79 (44%), Positives = 46/79 (58%), Gaps = 1/79 (1%)
 Frame = +3

Query: 39  RTSNKTD*KYKMAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTE 215
           R  ++ D   +  K   VGIDLGTT SCV V +  + +++ N +G RTTPS VAFT D E
Sbjct: 41  RLVSRRDYASEAIKGAVVGIDLGTTNSCVAVMEGKRAKVLENAEGARTTPSVVAFTADGE 100

Query: 216 RLIGDAAKNQVAMTPTTQY 272
           RL+G  AK Q    P   +
Sbjct: 101 RLVGMPAKRQAVTNPNNTF 119



 Score = 50.8 bits (116), Expect = 5e-06
 Identities = 22/36 (61%), Positives = 28/36 (77%)
 Frame = +1

Query: 403 KTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           K + P ++ + VL KMKETAE YLG+T +NAVITVP
Sbjct: 161 KLYSPSQIGAFVLMKMKETAENYLGRTAKNAVITVP 196



 Score = 44.4 bits (100), Expect = 4e-04
 Identities = 17/33 (51%), Positives = 26/33 (78%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +PNNT +  KRLIGR+++D  VQ D+K+ PF++
Sbjct: 114 NPNNTFYATKRLIGRRYDDPEVQKDIKNVPFKI 146


>BC024034-1|AAH24034.1|  679|Homo sapiens heat shock 70kDa protein 9
           (mortalin) protein.
          Length = 679

 Score = 91.9 bits (218), Expect = 2e-18
 Identities = 43/57 (75%), Positives = 51/57 (89%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 680
           AYFNDSQRQATKDAG ISGLNVLR+INEPTAAA+AYGLDK  + ++ + ++DLGGGT
Sbjct: 195 AYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDK--SEDKVIAVYDLGGGT 249



 Score = 67.7 bits (158), Expect = 4e-11
 Identities = 35/79 (44%), Positives = 46/79 (58%), Gaps = 1/79 (1%)
 Frame = +3

Query: 39  RTSNKTD*KYKMAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTE 215
           R  ++ D   +  K   VGIDLGTT SCV V +  + +++ N +G RTTPS VAFT D E
Sbjct: 39  RLVSRRDYASEAIKGAVVGIDLGTTNSCVAVMEGKRAKVLENAEGARTTPSVVAFTADGE 98

Query: 216 RLIGDAAKNQVAMTPTTQY 272
           RL+G  AK Q    P   +
Sbjct: 99  RLVGMPAKRQAVTNPNNTF 117



 Score = 50.8 bits (116), Expect = 5e-06
 Identities = 22/36 (61%), Positives = 28/36 (77%)
 Frame = +1

Query: 403 KTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           K + P ++ + VL KMKETAE YLG+T +NAVITVP
Sbjct: 159 KLYSPSQIGAFVLMKMKETAENYLGRTAKNAVITVP 194



 Score = 44.4 bits (100), Expect = 4e-04
 Identities = 17/33 (51%), Positives = 26/33 (78%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +PNNT +  KRLIGR+++D  VQ D+K+ PF++
Sbjct: 112 NPNNTFYATKRLIGRRYDDPEVQKDIKNVPFKI 144


>BC000478-1|AAH00478.1|  679|Homo sapiens heat shock 70kDa protein 9
           (mortalin) protein.
          Length = 679

 Score = 91.9 bits (218), Expect = 2e-18
 Identities = 43/57 (75%), Positives = 51/57 (89%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 680
           AYFNDSQRQATKDAG ISGLNVLR+INEPTAAA+AYGLDK  + ++ + ++DLGGGT
Sbjct: 195 AYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDK--SEDKVIAVYDLGGGT 249



 Score = 67.7 bits (158), Expect = 4e-11
 Identities = 35/79 (44%), Positives = 46/79 (58%), Gaps = 1/79 (1%)
 Frame = +3

Query: 39  RTSNKTD*KYKMAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTE 215
           R  ++ D   +  K   VGIDLGTT SCV V +  + +++ N +G RTTPS VAFT D E
Sbjct: 39  RLVSRRDYASEAIKGAVVGIDLGTTNSCVAVMEGKRAKVLENAEGARTTPSVVAFTADGE 98

Query: 216 RLIGDAAKNQVAMTPTTQY 272
           RL+G  AK Q    P   +
Sbjct: 99  RLVGMPAKRQAVTNPNNTF 117



 Score = 50.8 bits (116), Expect = 5e-06
 Identities = 22/36 (61%), Positives = 28/36 (77%)
 Frame = +1

Query: 403 KTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           K + P ++ + VL KMKETAE YLG+T +NAVITVP
Sbjct: 159 KLYSPSQIGAFVLMKMKETAENYLGRTAKNAVITVP 194



 Score = 44.4 bits (100), Expect = 4e-04
 Identities = 17/33 (51%), Positives = 26/33 (78%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +PNNT +  KRLIGR+++D  VQ D+K+ PF++
Sbjct: 112 NPNNTFYATKRLIGRRYDDPEVQKDIKNVPFKI 144


>DQ185038-1|ABD14419.1|  176|Homo sapiens heat shock 70 kDa protein
           9B protein.
          Length = 176

 Score = 89.8 bits (213), Expect = 9e-18
 Identities = 42/57 (73%), Positives = 51/57 (89%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 680
           AYFNDSQRQATKDAG ISGL+VLR+INEPTAAA+AYGLDK  + ++ + ++DLGGGT
Sbjct: 63  AYFNDSQRQATKDAGQISGLSVLRVINEPTAAALAYGLDK--SEDKVIAVYDLGGGT 117



 Score = 49.6 bits (113), Expect = 1e-05
 Identities = 22/36 (61%), Positives = 27/36 (75%)
 Frame = +1

Query: 403 KTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           K + P ++ + VL KMKETAE YLG T +NAVITVP
Sbjct: 27  KLYSPSQIGAFVLMKMKETAENYLGHTAKNAVITVP 62


>AK222758-1|BAD96478.1|  679|Homo sapiens heat shock 70kDa protein
           9B precursor variant protein.
          Length = 679

 Score = 89.8 bits (213), Expect = 9e-18
 Identities = 42/56 (75%), Positives = 50/56 (89%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGG 677
           AYFNDSQRQATKDAG ISGLNVLR+INEPTAAA+AYGLDK  + ++ + ++DLGGG
Sbjct: 195 AYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDK--SEDKVIAVYDLGGG 248



 Score = 67.3 bits (157), Expect = 6e-11
 Identities = 35/79 (44%), Positives = 46/79 (58%), Gaps = 1/79 (1%)
 Frame = +3

Query: 39  RTSNKTD*KYKMAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTE 215
           R  ++ D   +  K   VGIDLGTT SCV V +  + +++ N +G RTTPS VAFT D E
Sbjct: 39  RLVSRRDYASEAIKGAVVGIDLGTTNSCVAVMEGKQAKVLENAEGARTTPSVVAFTADGE 98

Query: 216 RLIGDAAKNQVAMTPTTQY 272
           RL+G  AK Q    P   +
Sbjct: 99  RLVGMPAKRQAVTNPNNTF 117



 Score = 49.6 bits (113), Expect = 1e-05
 Identities = 22/36 (61%), Positives = 27/36 (75%)
 Frame = +1

Query: 403 KTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           K + P ++ + VL KMKETAE YLG T +NAVITVP
Sbjct: 159 KLYSPSQIGAFVLMKMKETAENYLGHTAKNAVITVP 194



 Score = 44.4 bits (100), Expect = 4e-04
 Identities = 17/33 (51%), Positives = 26/33 (78%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +PNNT +  KRLIGR+++D  VQ D+K+ PF++
Sbjct: 112 NPNNTFYATKRLIGRRYDDPEVQKDIKNVPFKI 144


>M24743-1|AAA59844.1|   36|Homo sapiens HSPA2 protein.
          Length = 36

 Score = 76.2 bits (179), Expect = 1e-13
 Identities = 34/36 (94%), Positives = 35/36 (97%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNR 179
           MAKA A+GIDLGTTYSCVGVFQHGKVEIIANDQGNR
Sbjct: 1   MAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNR 36


>U04735-1|AAA16954.1|  471|Homo sapiens microsomal stress 70 protein
           ATPase core protein.
          Length = 471

 Score = 62.1 bits (144), Expect = 2e-09
 Identities = 31/57 (54%), Positives = 41/57 (71%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 680
           A F+  QR +T +A  ++GL +LR+INEPTAAA+AYGL K      +VL+ DLGGGT
Sbjct: 176 AEFDLKQRNSTIEAANLAGLKILRVINEPTAAAMAYGLHKADV--FHVLVIDLGGGT 230



 Score = 51.6 bits (118), Expect = 3e-06
 Identities = 31/75 (41%), Positives = 42/75 (56%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVPRTSM 522
           F+V++  G  +  V    E  T  PE V S +L K+KE AEAYLG  V NAVI+VP    
Sbjct: 121 FKVLNKNGMVEFSVT-SNETITVSPEYVGSRLLLKLKEMAEAYLGMPVANAVISVP-AEF 178

Query: 523 TLKDKPQKMQVPSLA 567
            LK +   ++  +LA
Sbjct: 179 DLKQRNSTIEAANLA 193



 Score = 50.4 bits (115), Expect = 7e-06
 Identities = 24/48 (50%), Positives = 34/48 (70%), Gaps = 2/48 (4%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVF--QHGKVEIIANDQGNRTTPSYVAFTDTERLIG 227
           +GIDLGTTY  VGVF    GKV++I ++ G+ + PS V+FTD +  +G
Sbjct: 34  IGIDLGTTYCSVGVFFPGTGKVKVIPDENGHISIPSMVSFTDNDVYVG 81



 Score = 37.1 bits (82), Expect = 0.067
 Identities = 15/38 (39%), Positives = 25/38 (65%)
 Frame = +2

Query: 239 EPGGDDPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           E    +P NTI+DAKR IG+ F    ++A++  +PF++
Sbjct: 86  ELADSNPQNTIYDAKRFIGKIFTAEELEAEIGRYPFKV 123


>BC036370-1|AAH36370.1|  471|Homo sapiens stress 70 protein
           chaperone, microsome-associated, 60kDa protein.
          Length = 471

 Score = 62.1 bits (144), Expect = 2e-09
 Identities = 31/57 (54%), Positives = 41/57 (71%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 680
           A F+  QR +T +A  ++GL +LR+INEPTAAA+AYGL K      +VL+ DLGGGT
Sbjct: 176 AEFDLKQRNSTIEAANLAGLKILRVINEPTAAAMAYGLHKADV--FHVLVIDLGGGT 230



 Score = 51.6 bits (118), Expect = 3e-06
 Identities = 31/75 (41%), Positives = 42/75 (56%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVPRTSM 522
           F+V++  G  +  V    E  T  PE V S +L K+KE AEAYLG  V NAVI+VP    
Sbjct: 121 FKVLNKNGMVEFSVT-SNETITVSPEYVGSRLLLKLKEMAEAYLGMPVANAVISVP-AEF 178

Query: 523 TLKDKPQKMQVPSLA 567
            LK +   ++  +LA
Sbjct: 179 DLKQRNSTIEAANLA 193



 Score = 50.4 bits (115), Expect = 7e-06
 Identities = 24/48 (50%), Positives = 34/48 (70%), Gaps = 2/48 (4%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVF--QHGKVEIIANDQGNRTTPSYVAFTDTERLIG 227
           +GIDLGTTY  VGVF    GKV++I ++ G+ + PS V+FTD +  +G
Sbjct: 34  IGIDLGTTYCSVGVFFPGTGKVKVIPDENGHISIPSMVSFTDNDVYVG 81



 Score = 37.1 bits (82), Expect = 0.067
 Identities = 15/38 (39%), Positives = 25/38 (65%)
 Frame = +2

Query: 239 EPGGDDPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           E    +P NTI+DAKR IG+ F    ++A++  +PF++
Sbjct: 86  ELADSNPQNTIYDAKRFIGKIFTAEELEAEIGRYPFKV 123


>AL163206-1|CAB90390.1|  471|Homo sapiens human microsomal stress70
           protein ATPase core precursor protein.
          Length = 471

 Score = 62.1 bits (144), Expect = 2e-09
 Identities = 31/57 (54%), Positives = 41/57 (71%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 680
           A F+  QR +T +A  ++GL +LR+INEPTAAA+AYGL K      +VL+ DLGGGT
Sbjct: 176 AEFDLKQRNSTIEAANLAGLKILRVINEPTAAAMAYGLHKADV--FHVLVIDLGGGT 230



 Score = 51.6 bits (118), Expect = 3e-06
 Identities = 31/75 (41%), Positives = 42/75 (56%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVPRTSM 522
           F+V++  G  +  V    E  T  PE V S +L K+KE AEAYLG  V NAVI+VP    
Sbjct: 121 FKVLNKNGMVEFSVT-SNETITVSPEYVGSRLLLKLKEMAEAYLGMPVANAVISVP-AEF 178

Query: 523 TLKDKPQKMQVPSLA 567
            LK +   ++  +LA
Sbjct: 179 DLKQRNSTIEAANLA 193



 Score = 50.4 bits (115), Expect = 7e-06
 Identities = 24/48 (50%), Positives = 34/48 (70%), Gaps = 2/48 (4%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVF--QHGKVEIIANDQGNRTTPSYVAFTDTERLIG 227
           +GIDLGTTY  VGVF    GKV++I ++ G+ + PS V+FTD +  +G
Sbjct: 34  IGIDLGTTYCSVGVFFPGTGKVKVIPDENGHISIPSMVSFTDNDVYVG 81



 Score = 37.1 bits (82), Expect = 0.067
 Identities = 15/38 (39%), Positives = 25/38 (65%)
 Frame = +2

Query: 239 EPGGDDPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           E    +P NTI+DAKR IG+ F    ++A++  +PF++
Sbjct: 86  ELADSNPQNTIYDAKRFIGKIFTAEELEAEIGRYPFKV 123


>AK223282-1|BAD97002.1|  471|Homo sapiens stress 70 protein
           chaperone, microsome-associated, 60kDa precursor variant
           protein.
          Length = 471

 Score = 62.1 bits (144), Expect = 2e-09
 Identities = 31/57 (54%), Positives = 41/57 (71%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 680
           A F+  QR +T +A  ++GL +LR+INEPTAAA+AYGL K      +VL+ DLGGGT
Sbjct: 176 AEFDLKQRNSTIEAANLAGLKILRVINEPTAAAMAYGLHKADV--FHVLVIDLGGGT 230



 Score = 51.6 bits (118), Expect = 3e-06
 Identities = 31/75 (41%), Positives = 42/75 (56%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVPRTSM 522
           F+V++  G  +  V    E  T  PE V S +L K+KE AEAYLG  V NAVI+VP    
Sbjct: 121 FKVLNKNGMVEFSVT-SNETITVSPEYVGSRLLLKLKEMAEAYLGMPVANAVISVP-AEF 178

Query: 523 TLKDKPQKMQVPSLA 567
            LK +   ++  +LA
Sbjct: 179 DLKQRNSTIEAANLA 193



 Score = 50.4 bits (115), Expect = 7e-06
 Identities = 24/48 (50%), Positives = 34/48 (70%), Gaps = 2/48 (4%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVF--QHGKVEIIANDQGNRTTPSYVAFTDTERLIG 227
           +GIDLGTTY  VGVF    GKV++I ++ G+ + PS V+FTD +  +G
Sbjct: 34  IGIDLGTTYCSVGVFFPGTGKVKVIPDENGHISIPSMVSFTDNDVYVG 81



 Score = 35.1 bits (77), Expect = 0.27
 Identities = 15/38 (39%), Positives = 24/38 (63%)
 Frame = +2

Query: 239 EPGGDDPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           E    +P NTI DAKR IG+ F    ++A++  +PF++
Sbjct: 86  ELADSNPQNTICDAKRFIGKIFTAEELEAEIGRYPFKV 123


>AF130249-1|AAD21091.1|  471|Homo sapiens STCH protein.
          Length = 471

 Score = 62.1 bits (144), Expect = 2e-09
 Identities = 31/57 (54%), Positives = 41/57 (71%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 680
           A F+  QR +T +A  ++GL +LR+INEPTAAA+AYGL K      +VL+ DLGGGT
Sbjct: 176 AEFDLKQRNSTIEAANLAGLKILRVINEPTAAAMAYGLHKADV--FHVLVIDLGGGT 230



 Score = 51.6 bits (118), Expect = 3e-06
 Identities = 31/75 (41%), Positives = 42/75 (56%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVPRTSM 522
           F+V++  G  +  V    E  T  PE V S +L K+KE AEAYLG  V NAVI+VP    
Sbjct: 121 FKVLNKNGMVEFSVT-SNETITVSPEYVGSRLLLKLKEMAEAYLGMPVANAVISVP-AEF 178

Query: 523 TLKDKPQKMQVPSLA 567
            LK +   ++  +LA
Sbjct: 179 DLKQRNSTIEAANLA 193



 Score = 50.4 bits (115), Expect = 7e-06
 Identities = 24/48 (50%), Positives = 34/48 (70%), Gaps = 2/48 (4%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVF--QHGKVEIIANDQGNRTTPSYVAFTDTERLIG 227
           +GIDLGTTY  VGVF    GKV++I ++ G+ + PS V+FTD +  +G
Sbjct: 34  IGIDLGTTYCSVGVFFPGTGKVKVIPDENGHISIPSMVSFTDNDVYVG 81



 Score = 37.1 bits (82), Expect = 0.067
 Identities = 15/38 (39%), Positives = 25/38 (65%)
 Frame = +2

Query: 239 EPGGDDPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           E    +P NTI+DAKR IG+ F    ++A++  +PF++
Sbjct: 86  ELADSNPQNTIYDAKRFIGKIFTAEELEAEIGRYPFKV 123


>BC119690-1|AAI19691.1|  509|Homo sapiens heat shock 70kDa protein
           14 protein.
          Length = 509

 Score = 59.7 bits (138), Expect = 1e-08
 Identities = 23/51 (45%), Positives = 38/51 (74%)
 Frame = +3

Query: 87  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAK 239
           A+G+ LG T +CV V++ G+  ++AND G+R TP+ VA+++ E ++G AAK
Sbjct: 3   AIGVHLGCTSACVAVYKDGRAGVVANDAGDRVTPAVVAYSENEEIVGLAAK 53



 Score = 56.4 bits (130), Expect = 1e-07
 Identities = 25/54 (46%), Positives = 38/54 (70%), Gaps = 1/54 (1%)
 Frame = +3

Query: 516 FNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKG-TGERNVLIFDLGG 674
           F + Q+ A  +A   +G NVLR+I+EP+AA +AYG+ +   TG+ N+L+F LGG
Sbjct: 147 FGEKQKNALGEAARAAGFNVLRLIHEPSAALLAYGIGQDSPTGKSNILVFKLGG 200



 Score = 44.8 bits (101), Expect = 3e-04
 Identities = 21/54 (38%), Positives = 32/54 (59%)
 Frame = +1

Query: 349 VVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           V+   GK + ++    E K   PE+V+ ++ +KMKETA + LG    + VITVP
Sbjct: 91  VIEKNGKLRYEIDTGEETKFVNPEDVARLIFSKMKETAHSVLGSDANDVVITVP 144


>BC108738-1|AAI08739.1|   88|Homo sapiens HSPA14 protein protein.
          Length = 88

 Score = 59.7 bits (138), Expect = 1e-08
 Identities = 23/51 (45%), Positives = 38/51 (74%)
 Frame = +3

Query: 87  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAK 239
           A+G+ LG T +CV V++ G+  ++AND G+R TP+ VA+++ E ++G AAK
Sbjct: 3   AIGVHLGCTSACVAVYKDGRAGVVANDAGDRVTPAVVAYSENEEIVGLAAK 53


>BC065281-1|AAH65281.1|   88|Homo sapiens HSPA14 protein protein.
          Length = 88

 Score = 59.7 bits (138), Expect = 1e-08
 Identities = 23/51 (45%), Positives = 38/51 (74%)
 Frame = +3

Query: 87  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAK 239
           A+G+ LG T +CV V++ G+  ++AND G+R TP+ VA+++ E ++G AAK
Sbjct: 3   AIGVHLGCTSACVAVYKDGRAGVVANDAGDRVTPAVVAYSENEEIVGLAAK 53


>AF112210-1|AAF17198.1|  509|Homo sapiens heat shock protein
           hsp70-related protein protein.
          Length = 509

 Score = 59.7 bits (138), Expect = 1e-08
 Identities = 23/51 (45%), Positives = 38/51 (74%)
 Frame = +3

Query: 87  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAK 239
           A+G+ LG T +CV V++ G+  ++AND G+R TP+ VA+++ E ++G AAK
Sbjct: 3   AIGVHLGCTSACVAVYKDGRAGVVANDAGDRVTPAVVAYSENEEIVGLAAK 53



 Score = 56.4 bits (130), Expect = 1e-07
 Identities = 25/54 (46%), Positives = 38/54 (70%), Gaps = 1/54 (1%)
 Frame = +3

Query: 516 FNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKG-TGERNVLIFDLGG 674
           F + Q+ A  +A   +G NVLR+I+EP+AA +AYG+ +   TG+ N+L+F LGG
Sbjct: 147 FGEKQKNALGEAARAAGFNVLRLIHEPSAALLAYGIGQDSPTGKSNILVFKLGG 200



 Score = 44.8 bits (101), Expect = 3e-04
 Identities = 21/54 (38%), Positives = 32/54 (59%)
 Frame = +1

Query: 349 VVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           V+   GK + ++    E K   PE+V+ ++ +KMKETA + LG    + VITVP
Sbjct: 91  VIEKNGKLRYEIDTGEETKFVNPEDVARLIFSKMKETAHSVLGSDANDVVITVP 144


>AF143723-1|AAF66640.1|  509|Homo sapiens heat shock protein HSP60
           protein.
          Length = 509

 Score = 57.2 bits (132), Expect = 6e-08
 Identities = 22/51 (43%), Positives = 37/51 (72%)
 Frame = +3

Query: 87  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAK 239
           A+G+ LG T +C  V++ G+  ++AND G+R TP+ VA+++ E ++G AAK
Sbjct: 3   AIGVHLGCTSACEAVYKDGRAGVVANDAGDRVTPAVVAYSENEEIVGLAAK 53



 Score = 56.4 bits (130), Expect = 1e-07
 Identities = 25/54 (46%), Positives = 38/54 (70%), Gaps = 1/54 (1%)
 Frame = +3

Query: 516 FNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKG-TGERNVLIFDLGG 674
           F + Q+ A  +A   +G NVLR+I+EP+AA +AYG+ +   TG+ N+L+F LGG
Sbjct: 147 FGEKQKNALGEAARAAGFNVLRLIHEPSAALLAYGIGQDSPTGKSNILVFKLGG 200



 Score = 44.8 bits (101), Expect = 3e-04
 Identities = 21/54 (38%), Positives = 32/54 (59%)
 Frame = +1

Query: 349 VVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           V+   GK + ++    E K   PE+V+ ++ +KMKETA + LG    + VITVP
Sbjct: 91  VIEKNGKLRYEIDTGEETKFVNPEDVARLIFSKMKETAHSVLGSDANDVVITVP 144


>AL929592-6|CAI18465.1|  476|Homo sapiens heat shock 70kDa protein
           1A protein.
          Length = 476

 Score = 55.2 bits (127), Expect = 2e-07
 Identities = 27/39 (69%), Positives = 30/39 (76%), Gaps = 2/39 (5%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVE--IIANDQGNRT 182
           MAKA A+GIDLGTTYSCVGVFQHGK E  ++  D G  T
Sbjct: 1   MAKAAAIGIDLGTTYSCVGVFQHGKGERNVLIFDLGGGT 39



 Score = 38.3 bits (85), Expect = 0.029
 Identities = 22/45 (48%), Positives = 25/45 (55%), Gaps = 1/45 (2%)
 Frame = +3

Query: 618 GLDKKGTGERNVLIFDLGGGTSTCPSLP-SRRYLRGEIHRGDTHL 749
           G+ + G GERNVLIFDLGGGT     L         +   GDTHL
Sbjct: 19  GVFQHGKGERNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHL 63


>AL671762-5|CAM25532.1|  476|Homo sapiens heat shock 70kDa protein
           1A protein.
          Length = 476

 Score = 55.2 bits (127), Expect = 2e-07
 Identities = 27/39 (69%), Positives = 30/39 (76%), Gaps = 2/39 (5%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVE--IIANDQGNRT 182
           MAKA A+GIDLGTTYSCVGVFQHGK E  ++  D G  T
Sbjct: 1   MAKAAAIGIDLGTTYSCVGVFQHGKGERNVLIFDLGGGT 39



 Score = 38.3 bits (85), Expect = 0.029
 Identities = 22/45 (48%), Positives = 25/45 (55%), Gaps = 1/45 (2%)
 Frame = +3

Query: 618 GLDKKGTGERNVLIFDLGGGTSTCPSLP-SRRYLRGEIHRGDTHL 749
           G+ + G GERNVLIFDLGGGT     L         +   GDTHL
Sbjct: 19  GVFQHGKGERNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHL 63


>AL662834-16|CAM24989.1|  476|Homo sapiens heat shock 70kDa protein
           1A protein.
          Length = 476

 Score = 55.2 bits (127), Expect = 2e-07
 Identities = 27/39 (69%), Positives = 30/39 (76%), Gaps = 2/39 (5%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVE--IIANDQGNRT 182
           MAKA A+GIDLGTTYSCVGVFQHGK E  ++  D G  T
Sbjct: 1   MAKAAAIGIDLGTTYSCVGVFQHGKGERNVLIFDLGGGT 39



 Score = 38.3 bits (85), Expect = 0.029
 Identities = 22/45 (48%), Positives = 25/45 (55%), Gaps = 1/45 (2%)
 Frame = +3

Query: 618 GLDKKGTGERNVLIFDLGGGTSTCPSLP-SRRYLRGEIHRGDTHL 749
           G+ + G GERNVLIFDLGGGT     L         +   GDTHL
Sbjct: 19  GVFQHGKGERNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHL 63


>U65785-1|AAC50947.1|  999|Homo sapiens 150 kDa oxygen-regulated
           protein ORP150 protein.
          Length = 999

 Score = 54.8 bits (126), Expect = 3e-07
 Identities = 22/62 (35%), Positives = 43/62 (69%), Gaps = 3/62 (4%)
 Frame = +3

Query: 513 YFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKK---GTGERNVLIFDLGGGTS 683
           +FN ++R+A   A  ++GL VL++IN+ TA A++YG+ ++    T  +N++ +D+G G++
Sbjct: 179 FFNQAERRAVLQAARMAGLKVLQLINDNTATALSYGVFRRKDINTTAQNIMFYDMGSGST 238

Query: 684 TC 689
            C
Sbjct: 239 VC 240



 Score = 37.1 bits (82), Expect = 0.067
 Identities = 18/58 (31%), Positives = 29/58 (50%), Gaps = 1/58 (1%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHG-KVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           + +DLG+    V + + G  +EI+ N +  R TP  V   + ER  GD+A +     P
Sbjct: 36  MSVDLGSESMKVAIVKPGVPMEIVLNKESRRKTPVIVTLKENERFFGDSAASMAIKNP 93



 Score = 33.9 bits (74), Expect = 0.63
 Identities = 16/34 (47%), Positives = 22/34 (64%)
 Frame = +1

Query: 409 FFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F PEEV  MVL   +  AE +  + +++AVITVP
Sbjct: 144 FSPEEVLGMVLNYSRSLAEDFAEQPIKDAVITVP 177


>DQ372932-1|ABD14370.1|  999|Homo sapiens 150 kDa oxygen-regulated
           protein variant 1 protein.
          Length = 999

 Score = 54.8 bits (126), Expect = 3e-07
 Identities = 22/62 (35%), Positives = 43/62 (69%), Gaps = 3/62 (4%)
 Frame = +3

Query: 513 YFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKK---GTGERNVLIFDLGGGTS 683
           +FN ++R+A   A  ++GL VL++IN+ TA A++YG+ ++    T  +N++ +D+G G++
Sbjct: 179 FFNQAERRAVLQAARMAGLKVLQLINDNTATALSYGVFRRKDINTTAQNIMFYDMGSGST 238

Query: 684 TC 689
            C
Sbjct: 239 VC 240



 Score = 37.1 bits (82), Expect = 0.067
 Identities = 18/58 (31%), Positives = 29/58 (50%), Gaps = 1/58 (1%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHG-KVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           + +DLG+    V + + G  +EI+ N +  R TP  V   + ER  GD+A +     P
Sbjct: 36  MSVDLGSESMKVAIVKPGVPMEIVLNKESRRKTPVIVTLKENERFFGDSAASMAIKNP 93



 Score = 33.9 bits (74), Expect = 0.63
 Identities = 16/34 (47%), Positives = 22/34 (64%)
 Frame = +1

Query: 409 FFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F PEEV  MVL   +  AE +  + +++AVITVP
Sbjct: 144 FSPEEVLGMVLNYSRSLAEDFAEQPIKDAVITVP 177


>DQ350134-1|ABC75106.1|  999|Homo sapiens 150 kDa oxygen-regulated
           protein protein.
          Length = 999

 Score = 54.8 bits (126), Expect = 3e-07
 Identities = 22/62 (35%), Positives = 43/62 (69%), Gaps = 3/62 (4%)
 Frame = +3

Query: 513 YFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKK---GTGERNVLIFDLGGGTS 683
           +FN ++R+A   A  ++GL VL++IN+ TA A++YG+ ++    T  +N++ +D+G G++
Sbjct: 179 FFNQAERRAVLQAARMAGLKVLQLINDNTATALSYGVFRRKDINTTAQNIMFYDMGSGST 238

Query: 684 TC 689
            C
Sbjct: 239 VC 240



 Score = 37.1 bits (82), Expect = 0.067
 Identities = 18/58 (31%), Positives = 29/58 (50%), Gaps = 1/58 (1%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHG-KVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           + +DLG+    V + + G  +EI+ N +  R TP  V   + ER  GD+A +     P
Sbjct: 36  MSVDLGSESMKVAIVKPGVPMEIVLNKESRRKTPVIVTLKENERFFGDSAASMAIKNP 93



 Score = 33.9 bits (74), Expect = 0.63
 Identities = 16/34 (47%), Positives = 22/34 (64%)
 Frame = +1

Query: 409 FFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F PEEV  MVL   +  AE +  + +++AVITVP
Sbjct: 144 FSPEEVLGMVLNYSRSLAEDFAEQPIKDAVITVP 177


>BC072436-1|AAH72436.1|  678|Homo sapiens HYOU1 protein protein.
          Length = 678

 Score = 54.8 bits (126), Expect = 3e-07
 Identities = 22/62 (35%), Positives = 43/62 (69%), Gaps = 3/62 (4%)
 Frame = +3

Query: 513 YFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKK---GTGERNVLIFDLGGGTS 683
           +FN ++R+A   A  ++GL VL++IN+ TA A++YG+ ++    T  +N++ +D+G G++
Sbjct: 179 FFNQAERRAVLQAARMAGLKVLQLINDNTATALSYGVFRRKDINTTAQNIMFYDMGSGST 238

Query: 684 TC 689
            C
Sbjct: 239 VC 240



 Score = 37.1 bits (82), Expect = 0.067
 Identities = 18/58 (31%), Positives = 29/58 (50%), Gaps = 1/58 (1%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHG-KVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           + +DLG+    V + + G  +EI+ N +  R TP  V   + ER  GD+A +     P
Sbjct: 36  MSVDLGSESMKVAIVKPGVPMEIVLNKESRRKTPVIVTLKENERFFGDSAASMAIKNP 93



 Score = 33.9 bits (74), Expect = 0.63
 Identities = 16/34 (47%), Positives = 22/34 (64%)
 Frame = +1

Query: 409 FFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F PEEV  MVL   +  AE +  + +++AVITVP
Sbjct: 144 FSPEEVLGMVLNYSRSLAEDFAEQPIKDAVITVP 177


>BC017726-1|AAH17726.1|  657|Homo sapiens Unknown (protein for
           IMAGE:3898847) protein.
          Length = 657

 Score = 54.8 bits (126), Expect = 3e-07
 Identities = 22/62 (35%), Positives = 43/62 (69%), Gaps = 3/62 (4%)
 Frame = +3

Query: 513 YFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKK---GTGERNVLIFDLGGGTS 683
           +FN ++R+A   A  ++GL VL++IN+ TA A++YG+ ++    T  +N++ +D+G G++
Sbjct: 179 FFNQAERRAVLQAARMAGLKVLQLINDNTATALSYGVFRRKDINTTAQNIMFYDMGSGST 238

Query: 684 TC 689
            C
Sbjct: 239 VC 240



 Score = 37.1 bits (82), Expect = 0.067
 Identities = 18/58 (31%), Positives = 29/58 (50%), Gaps = 1/58 (1%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHG-KVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           + +DLG+    V + + G  +EI+ N +  R TP  V   + ER  GD+A +     P
Sbjct: 36  MSVDLGSESMKVAIVKPGVPMEIVLNKESRRKTPVIVTLKENERFFGDSAASMAIKNP 93



 Score = 33.9 bits (74), Expect = 0.63
 Identities = 16/34 (47%), Positives = 22/34 (64%)
 Frame = +1

Query: 409 FFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F PEEV  MVL   +  AE +  + +++AVITVP
Sbjct: 144 FSPEEVLGMVLNYSRSLAEDFAEQPIKDAVITVP 177


>AK222756-1|BAD96476.1|  999|Homo sapiens oxygen regulated protein
           precursor variant protein.
          Length = 999

 Score = 54.8 bits (126), Expect = 3e-07
 Identities = 22/62 (35%), Positives = 43/62 (69%), Gaps = 3/62 (4%)
 Frame = +3

Query: 513 YFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKK---GTGERNVLIFDLGGGTS 683
           +FN ++R+A   A  ++GL VL++IN+ TA A++YG+ ++    T  +N++ +D+G G++
Sbjct: 179 FFNQAERRAVLQAARMAGLKVLQLINDNTATALSYGVFRRKDINTTAQNIMFYDMGSGST 238

Query: 684 TC 689
            C
Sbjct: 239 VC 240



 Score = 36.7 bits (81), Expect = 0.089
 Identities = 18/58 (31%), Positives = 29/58 (50%), Gaps = 1/58 (1%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHG-KVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           + +DLG+    V + + G  +EI+ N +  R TP  V   + ER  GD+A +     P
Sbjct: 36  MSVDLGSESMKVAIVKPGVPMEIVLNKESRRKTPVIVTLEENERFFGDSAASMAIKDP 93



 Score = 33.9 bits (74), Expect = 0.63
 Identities = 16/34 (47%), Positives = 22/34 (64%)
 Frame = +1

Query: 409 FFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F PEEV  MVL   +  AE +  + +++AVITVP
Sbjct: 144 FSPEEVLGMVLNYSRSLAEDFAEQPIKDAVITVP 177


>L12723-1|AAA02807.1|  701|Homo sapiens heat shock protein 70
           protein.
          Length = 701

 Score = 50.8 bits (116), Expect = 5e-06
 Identities = 25/66 (37%), Positives = 40/66 (60%), Gaps = 5/66 (7%)
 Frame = +3

Query: 489 ECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGE-----RNV 653
           +C      ++ D++R++  DA  I+GLN LR++NE TA A+AYG+ K+         RNV
Sbjct: 139 DCVVSVPCFYTDAERRSVMDATQIAGLNCLRLMNETTAVALAYGIYKQDLPRLEEKPRNV 198

Query: 654 LIFDLG 671
           +  D+G
Sbjct: 199 VFVDMG 204



 Score = 50.4 bits (115), Expect = 7e-06
 Identities = 26/59 (44%), Positives = 40/59 (67%), Gaps = 1/59 (1%)
 Frame = +1

Query: 337 LAFRVVS-DGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           LA+ +V    G   IKV Y  E++ F  E+V++M+L+K+KETAE+ L K V + V++VP
Sbjct: 87  LAYDIVQWPTGLTGIKVTYMEEERNFTTEQVTAMLLSKLKETAESVLKKPVVDCVVSVP 145



 Score = 48.0 bits (109), Expect = 4e-05
 Identities = 25/53 (47%), Positives = 33/53 (62%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV 248
           VGIDLG     V V + G +E IAN+  +R TP+ ++F    R IG AAK+QV
Sbjct: 4   VGIDLGFQSCYVAVARAGGIETIANEYSDRCTPACISFGPKNRSIGAAAKSQV 56


>EF197155-1|ABM69040.1|  839|Homo sapiens heat shock 70 kDa protein
           4-like protein protein.
          Length = 839

 Score = 50.8 bits (116), Expect = 5e-06
 Identities = 25/67 (37%), Positives = 41/67 (61%), Gaps = 5/67 (7%)
 Frame = +3

Query: 486 AECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKK-----GTGERN 650
           A+C     ++F D++R++   A  ++GLN LR++NE TA A+AYG+ K+         RN
Sbjct: 138 ADCVISIPSFFTDAERRSVMAAAQVAGLNCLRLMNETTAVALAYGIYKQDLPPLDEKPRN 197

Query: 651 VLIFDLG 671
           V+  D+G
Sbjct: 198 VVFIDMG 204



 Score = 46.8 bits (106), Expect = 8e-05
 Identities = 22/53 (41%), Positives = 33/53 (62%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV 248
           VGIDLG     + V + G +E IAN+  +R TP+ ++     R IG+AAK+Q+
Sbjct: 4   VGIDLGFLNCYIAVARSGGIETIANEYSDRCTPACISLGSRTRAIGNAAKSQI 56



 Score = 44.8 bits (101), Expect = 3e-04
 Identities = 21/49 (42%), Positives = 32/49 (65%)
 Frame = +1

Query: 364 GKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           G   +KV Y  E++ F  E+V+ M+L K+KET+E  L K V + VI++P
Sbjct: 97  GSAGVKVRYLEEERPFAIEQVTGMLLAKLKETSENALKKPVADCVISIP 145



 Score = 31.9 bits (69), Expect = 2.5
 Identities = 15/33 (45%), Positives = 19/33 (57%)
 Frame = +2

Query: 263 NTIFDAKRLIGRKFEDATVQADMKHWPFELSVM 361
           NTI   K+L GR F+D  VQ +    P+EL  M
Sbjct: 62  NTIHGFKKLHGRSFDDPIVQTERIRLPYELQKM 94


>D86956-1|BAA13192.2|  949|Homo sapiens KIAA0201 protein.
          Length = 949

 Score = 50.8 bits (116), Expect = 5e-06
 Identities = 28/61 (45%), Positives = 40/61 (65%), Gaps = 1/61 (1%)
 Frame = +1

Query: 331 EALAFRVVS-DGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITV 507
           E L++ +V    G   IKV Y GE+  F  E++++M+LTK+KETAE  L K V + VI+V
Sbjct: 176 ENLSYDLVPLKNGGVGIKVMYMGEEHLFSVEQITAMLLTKLKETAENSLKKPVTDCVISV 235

Query: 508 P 510
           P
Sbjct: 236 P 236



 Score = 48.4 bits (110), Expect = 3e-05
 Identities = 23/52 (44%), Positives = 33/52 (63%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ 245
           VG+D+G+    + V + G +E IAN+  +R TPS ++F    R IG AAKNQ
Sbjct: 95  VGLDVGSQSCYIAVARAGGIETIANEFSDRCTPSVISFGSKNRTIGVAAKNQ 146



 Score = 45.2 bits (102), Expect = 3e-04
 Identities = 19/48 (39%), Positives = 32/48 (66%)
 Frame = +3

Query: 489 ECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKK 632
           +C     ++F D++R++  DA  I GLN LR++N+ TA A+ YG+ K+
Sbjct: 230 DCVISVPSFFTDAERRSVLDAAQIVGLNCLRLMNDMTAVALNYGIYKQ 277


>BC040560-1|AAH40560.1|  839|Homo sapiens heat shock 70kDa protein
           4-like protein.
          Length = 839

 Score = 50.8 bits (116), Expect = 5e-06
 Identities = 25/67 (37%), Positives = 41/67 (61%), Gaps = 5/67 (7%)
 Frame = +3

Query: 486 AECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKK-----GTGERN 650
           A+C     ++F D++R++   A  ++GLN LR++NE TA A+AYG+ K+         RN
Sbjct: 138 ADCVISIPSFFTDAERRSVMAAAQVAGLNCLRLMNETTAVALAYGIYKQDLPPLDEKPRN 197

Query: 651 VLIFDLG 671
           V+  D+G
Sbjct: 198 VVFIDMG 204



 Score = 46.8 bits (106), Expect = 8e-05
 Identities = 22/53 (41%), Positives = 33/53 (62%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV 248
           VGIDLG     + V + G +E IAN+  +R TP+ ++     R IG+AAK+Q+
Sbjct: 4   VGIDLGFLNCYIAVARSGGIETIANEYSDRCTPACISLGSRTRAIGNAAKSQI 56



 Score = 44.8 bits (101), Expect = 3e-04
 Identities = 21/49 (42%), Positives = 32/49 (65%)
 Frame = +1

Query: 364 GKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           G   +KV Y  E++ F  E+V+ M+L K+KET+E  L K V + VI++P
Sbjct: 97  GSAGVKVRYLEEERPFAIEQVTGMLLAKLKETSENALKKPVADCVISIP 145



 Score = 31.9 bits (69), Expect = 2.5
 Identities = 15/33 (45%), Positives = 19/33 (57%)
 Frame = +2

Query: 263 NTIFDAKRLIGRKFEDATVQADMKHWPFELSVM 361
           NTI   K+L GR F+D  VQ +    P+EL  M
Sbjct: 62  NTIHGFKKLHGRSFDDPIVQTERIRLPYELQKM 94


>BC037553-1|AAH37553.1|  858|Homo sapiens heat shock 105kDa/110kDa
           protein 1 protein.
          Length = 858

 Score = 50.8 bits (116), Expect = 5e-06
 Identities = 28/61 (45%), Positives = 40/61 (65%), Gaps = 1/61 (1%)
 Frame = +1

Query: 331 EALAFRVVS-DGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITV 507
           E L++ +V    G   IKV Y GE+  F  E++++M+LTK+KETAE  L K V + VI+V
Sbjct: 85  ENLSYDLVPLKNGGVGIKVMYMGEEHLFSVEQITAMLLTKLKETAENSLKKPVTDCVISV 144

Query: 508 P 510
           P
Sbjct: 145 P 145



 Score = 48.4 bits (110), Expect = 3e-05
 Identities = 23/52 (44%), Positives = 33/52 (63%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ 245
           VG+D+G+    + V + G +E IAN+  +R TPS ++F    R IG AAKNQ
Sbjct: 4   VGLDVGSQSCYIAVARAGGIETIANEFSDRCTPSVISFGSKNRTIGVAAKNQ 55



 Score = 45.2 bits (102), Expect = 3e-04
 Identities = 19/48 (39%), Positives = 32/48 (66%)
 Frame = +3

Query: 489 ECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKK 632
           +C     ++F D++R++  DA  I GLN LR++N+ TA A+ YG+ K+
Sbjct: 139 DCVISVPSFFTDAERRSVLDAAQIVGLNCLRLMNDMTAVALNYGIYKQ 186


>AY290862-1|AAP44471.1|  839|Homo sapiens heat shock protein apg-1
           protein.
          Length = 839

 Score = 50.8 bits (116), Expect = 5e-06
 Identities = 25/67 (37%), Positives = 41/67 (61%), Gaps = 5/67 (7%)
 Frame = +3

Query: 486 AECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKK-----GTGERN 650
           A+C     ++F D++R++   A  ++GLN LR++NE TA A+AYG+ K+         RN
Sbjct: 138 ADCVISIPSFFTDAERRSVMAAAQVAGLNCLRLMNETTAVALAYGIYKQDLPPLDEKPRN 197

Query: 651 VLIFDLG 671
           V+  D+G
Sbjct: 198 VVFIDMG 204



 Score = 46.8 bits (106), Expect = 8e-05
 Identities = 22/53 (41%), Positives = 33/53 (62%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV 248
           VGIDLG     + V + G +E IAN+  +R TP+ ++     R IG+AAK+Q+
Sbjct: 4   VGIDLGFLNCYIAVARSGGIETIANEYSDRCTPACISLGSRTRAIGNAAKSQI 56



 Score = 44.8 bits (101), Expect = 3e-04
 Identities = 21/49 (42%), Positives = 32/49 (65%)
 Frame = +1

Query: 364 GKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           G   +KV Y  E++ F  E+V+ M+L K+KET+E  L K V + VI++P
Sbjct: 97  GSAGVKVRYLEEERPFAIEQVTGMLLAKLKETSENALKKPVADCVISIP 145



 Score = 31.9 bits (69), Expect = 2.5
 Identities = 15/33 (45%), Positives = 19/33 (57%)
 Frame = +2

Query: 263 NTIFDAKRLIGRKFEDATVQADMKHWPFELSVM 361
           NTI   K+L GR F+D  VQ +    P+EL  M
Sbjct: 62  NTIHGFKKLHGRSFDDPIVQTERIRLPYELQKM 94


>AL137142-5|CAI12430.1|  858|Homo sapiens heat shock 105kDa/110kDa
           protein 1 protein.
          Length = 858

 Score = 50.8 bits (116), Expect = 5e-06
 Identities = 28/61 (45%), Positives = 40/61 (65%), Gaps = 1/61 (1%)
 Frame = +1

Query: 331 EALAFRVVS-DGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITV 507
           E L++ +V    G   IKV Y GE+  F  E++++M+LTK+KETAE  L K V + VI+V
Sbjct: 85  ENLSYDLVPLKNGGVGIKVMYMGEEHLFSVEQITAMLLTKLKETAENSLKKPVTDCVISV 144

Query: 508 P 510
           P
Sbjct: 145 P 145



 Score = 48.4 bits (110), Expect = 3e-05
 Identities = 23/52 (44%), Positives = 33/52 (63%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ 245
           VG+D+G+    + V + G +E IAN+  +R TPS ++F    R IG AAKNQ
Sbjct: 4   VGLDVGSQSCYIAVARAGGIETIANEFSDRCTPSVISFGSKNRTIGVAAKNQ 55



 Score = 45.2 bits (102), Expect = 3e-04
 Identities = 19/48 (39%), Positives = 32/48 (66%)
 Frame = +3

Query: 489 ECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKK 632
           +C     ++F D++R++  DA  I GLN LR++N+ TA A+ YG+ K+
Sbjct: 139 DCVISVPSFFTDAERRSVLDAAQIVGLNCLRLMNDMTAVALNYGIYKQ 186


>AL137142-4|CAI12428.1|  814|Homo sapiens heat shock 105kDa/110kDa
           protein 1 protein.
          Length = 814

 Score = 50.8 bits (116), Expect = 5e-06
 Identities = 28/61 (45%), Positives = 40/61 (65%), Gaps = 1/61 (1%)
 Frame = +1

Query: 331 EALAFRVVS-DGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITV 507
           E L++ +V    G   IKV Y GE+  F  E++++M+LTK+KETAE  L K V + VI+V
Sbjct: 85  ENLSYDLVPLKNGGVGIKVMYMGEEHLFSVEQITAMLLTKLKETAENSLKKPVTDCVISV 144

Query: 508 P 510
           P
Sbjct: 145 P 145



 Score = 48.4 bits (110), Expect = 3e-05
 Identities = 23/52 (44%), Positives = 33/52 (63%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ 245
           VG+D+G+    + V + G +E IAN+  +R TPS ++F    R IG AAKNQ
Sbjct: 4   VGLDVGSQSCYIAVARAGGIETIANEFSDRCTPSVISFGSKNRTIGVAAKNQ 55



 Score = 45.2 bits (102), Expect = 3e-04
 Identities = 19/48 (39%), Positives = 32/48 (66%)
 Frame = +3

Query: 489 ECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKK 632
           +C     ++F D++R++  DA  I GLN LR++N+ TA A+ YG+ K+
Sbjct: 139 DCVISVPSFFTDAERRSVLDAAQIVGLNCLRLMNDMTAVALNYGIYKQ 186


>AF039695-1|AAC18044.1|  872|Homo sapiens antigen NY-CO-25 protein.
          Length = 872

 Score = 50.8 bits (116), Expect = 5e-06
 Identities = 28/61 (45%), Positives = 40/61 (65%), Gaps = 1/61 (1%)
 Frame = +1

Query: 331 EALAFRVVS-DGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITV 507
           E L++ +V    G   IKV Y GE+  F  E++++M+LTK+KETAE  L K V + VI+V
Sbjct: 99  ENLSYDLVPLKNGGVGIKVMYMGEEHLFSVEQITAMLLTKLKETAENSLKKPVTDCVISV 158

Query: 508 P 510
           P
Sbjct: 159 P 159



 Score = 48.4 bits (110), Expect = 3e-05
 Identities = 23/52 (44%), Positives = 33/52 (63%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ 245
           VG+D+G+    + V + G +E IAN+  +R TPS ++F    R IG AAKNQ
Sbjct: 18  VGLDVGSQSCYIAVARAGGIETIANEFSDRCTPSVISFGSKNRTIGVAAKNQ 69



 Score = 45.2 bits (102), Expect = 3e-04
 Identities = 19/48 (39%), Positives = 32/48 (66%)
 Frame = +3

Query: 489 ECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKK 632
           +C     ++F D++R++  DA  I GLN LR++N+ TA A+ YG+ K+
Sbjct: 153 DCVISVPSFFTDAERRSVLDAAQIVGLNCLRLMNDMTAVALNYGIYKQ 200


>AC093591-2|AAY40975.1|  839|Homo sapiens unknown protein.
          Length = 839

 Score = 50.8 bits (116), Expect = 5e-06
 Identities = 25/67 (37%), Positives = 41/67 (61%), Gaps = 5/67 (7%)
 Frame = +3

Query: 486 AECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKK-----GTGERN 650
           A+C     ++F D++R++   A  ++GLN LR++NE TA A+AYG+ K+         RN
Sbjct: 138 ADCVISIPSFFTDAERRSVMAAAQVAGLNCLRLMNETTAVALAYGIYKQDLPPLDEKPRN 197

Query: 651 VLIFDLG 671
           V+  D+G
Sbjct: 198 VVFIDMG 204



 Score = 46.8 bits (106), Expect = 8e-05
 Identities = 22/53 (41%), Positives = 33/53 (62%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV 248
           VGIDLG     + V + G +E IAN+  +R TP+ ++     R IG+AAK+Q+
Sbjct: 4   VGIDLGFLNCYIAVARSGGIETIANEYSDRCTPACISLGSRTRAIGNAAKSQI 56



 Score = 44.8 bits (101), Expect = 3e-04
 Identities = 21/49 (42%), Positives = 32/49 (65%)
 Frame = +1

Query: 364 GKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           G   +KV Y  E++ F  E+V+ M+L K+KET+E  L K V + VI++P
Sbjct: 97  GSAGVKVRYLEEERPFAIEQVTGMLLAKLKETSENALKKPVADCVISIP 145



 Score = 31.9 bits (69), Expect = 2.5
 Identities = 15/33 (45%), Positives = 19/33 (57%)
 Frame = +2

Query: 263 NTIFDAKRLIGRKFEDATVQADMKHWPFELSVM 361
           NTI   K+L GR F+D  VQ +    P+EL  M
Sbjct: 62  NTIHGFKKLHGRSFDDPIVQTERIRLPYELQKM 94


>AB023421-1|BAA75063.1|  839|Homo sapiens apg-1 protein.
          Length = 839

 Score = 50.8 bits (116), Expect = 5e-06
 Identities = 25/67 (37%), Positives = 41/67 (61%), Gaps = 5/67 (7%)
 Frame = +3

Query: 486 AECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKK-----GTGERN 650
           A+C     ++F D++R++   A  ++GLN LR++NE TA A+AYG+ K+         RN
Sbjct: 138 ADCVISIPSFFTDAERRSVMAAAQVAGLNCLRLMNETTAVALAYGIYKQDLPPLDEKPRN 197

Query: 651 VLIFDLG 671
           V+  D+G
Sbjct: 198 VVFIDMG 204



 Score = 46.8 bits (106), Expect = 8e-05
 Identities = 22/53 (41%), Positives = 33/53 (62%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV 248
           VGIDLG     + V + G +E IAN+  +R TP+ ++     R IG+AAK+Q+
Sbjct: 4   VGIDLGFLNCYIAVARSGGIETIANEYSDRCTPACISLGSRTRAIGNAAKSQI 56



 Score = 44.8 bits (101), Expect = 3e-04
 Identities = 21/49 (42%), Positives = 32/49 (65%)
 Frame = +1

Query: 364 GKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           G   +KV Y  E++ F  E+V+ M+L K+KET+E  L K V + VI++P
Sbjct: 97  GSAGVKVRYLEEERPFAIEQVTGMLLAKLKETSENALKKPVADCVISIP 145



 Score = 31.9 bits (69), Expect = 2.5
 Identities = 15/33 (45%), Positives = 19/33 (57%)
 Frame = +2

Query: 263 NTIFDAKRLIGRKFEDATVQADMKHWPFELSVM 361
           NTI   K+L GR F+D  VQ +    P+EL  M
Sbjct: 62  NTIHGFKKLHGRSFDDPIVQTERIRLPYELQKM 94


>AB003334-1|BAA34780.1|  858|Homo sapiens HSP105 alpha protein.
          Length = 858

 Score = 50.8 bits (116), Expect = 5e-06
 Identities = 28/61 (45%), Positives = 40/61 (65%), Gaps = 1/61 (1%)
 Frame = +1

Query: 331 EALAFRVVS-DGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITV 507
           E L++ +V    G   IKV Y GE+  F  E++++M+LTK+KETAE  L K V + VI+V
Sbjct: 85  ENLSYDLVPLKNGGVGIKVMYMGEEHLFSVEQITAMLLTKLKETAENSLKKPVTDCVISV 144

Query: 508 P 510
           P
Sbjct: 145 P 145



 Score = 48.4 bits (110), Expect = 3e-05
 Identities = 23/52 (44%), Positives = 33/52 (63%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ 245
           VG+D+G+    + V + G +E IAN+  +R TPS ++F    R IG AAKNQ
Sbjct: 4   VGLDVGSQSCYIAVARAGGIETIANEFSDRCTPSVISFGSKNRTIGVAAKNQ 55



 Score = 45.2 bits (102), Expect = 3e-04
 Identities = 19/48 (39%), Positives = 32/48 (66%)
 Frame = +3

Query: 489 ECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKK 632
           +C     ++F D++R++  DA  I GLN LR++N+ TA A+ YG+ K+
Sbjct: 139 DCVISVPSFFTDAERRSVLDAAQIVGLNCLRLMNDMTAVALNYGIYKQ 186


>AB003333-1|BAA34779.1|  814|Homo sapiens HSP105 beta protein.
          Length = 814

 Score = 50.8 bits (116), Expect = 5e-06
 Identities = 28/61 (45%), Positives = 40/61 (65%), Gaps = 1/61 (1%)
 Frame = +1

Query: 331 EALAFRVVS-DGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITV 507
           E L++ +V    G   IKV Y GE+  F  E++++M+LTK+KETAE  L K V + VI+V
Sbjct: 85  ENLSYDLVPLKNGGVGIKVMYMGEEHLFSVEQITAMLLTKLKETAENSLKKPVTDCVISV 144

Query: 508 P 510
           P
Sbjct: 145 P 145



 Score = 48.4 bits (110), Expect = 3e-05
 Identities = 23/52 (44%), Positives = 33/52 (63%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ 245
           VG+D+G+    + V + G +E IAN+  +R TPS ++F    R IG AAKNQ
Sbjct: 4   VGLDVGSQSCYIAVARAGGIETIANEFSDRCTPSVISFGSKNRTIGVAAKNQ 55



 Score = 45.2 bits (102), Expect = 3e-04
 Identities = 19/48 (39%), Positives = 32/48 (66%)
 Frame = +3

Query: 489 ECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKK 632
           +C     ++F D++R++  DA  I GLN LR++N+ TA A+ YG+ K+
Sbjct: 139 DCVISVPSFFTDAERRSVLDAAQIVGLNCLRLMNDMTAVALNYGIYKQ 186


>X67643-1|CAA47886.1|  474|Homo sapiens HS24/P52 protein.
          Length = 474

 Score = 50.4 bits (115), Expect = 7e-06
 Identities = 26/59 (44%), Positives = 40/59 (67%), Gaps = 1/59 (1%)
 Frame = +1

Query: 337 LAFRVVS-DGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           LA+ +V    G   IKV Y  E++ F  E+V++M+L+K+KETAE+ L K V + V++VP
Sbjct: 87  LAYDIVQLPTGLTGIKVTYMEEERNFTTEQVTAMLLSKLKETAESVLKKPVVDCVVSVP 145



 Score = 50.4 bits (115), Expect = 7e-06
 Identities = 25/66 (37%), Positives = 40/66 (60%), Gaps = 5/66 (7%)
 Frame = +3

Query: 489 ECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKG-----TGERNV 653
           +C      ++ D++R++  DA  I+GLN LR++NE TA A+AYG+ K+         RNV
Sbjct: 139 DCVVSVPCFYTDAERRSVMDATQIAGLNCLRLMNETTAVALAYGIYKQDLPALEEKPRNV 198

Query: 654 LIFDLG 671
           +  D+G
Sbjct: 199 VFVDMG 204



 Score = 48.0 bits (109), Expect = 4e-05
 Identities = 25/53 (47%), Positives = 33/53 (62%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV 248
           VGIDLG     V V + G +E IAN+  +R TP+ ++F    R IG AAK+QV
Sbjct: 4   VGIDLGFQSCYVAVARAGGIETIANEYSDRCTPACISFGPKNRSIGAAAKSQV 56


>X67640-1|CAA47885.1|  266|Homo sapiens HS24/P52 protein.
          Length = 266

 Score = 50.4 bits (115), Expect = 7e-06
 Identities = 26/59 (44%), Positives = 40/59 (67%), Gaps = 1/59 (1%)
 Frame = +1

Query: 337 LAFRVVS-DGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           LA+ +V    G   IKV Y  E++ F  E+V++M+L+K+KETAE+ L K V + V++VP
Sbjct: 51  LAYDIVQLPTGLTGIKVTYMEEERNFTTEQVTAMLLSKLKETAESVLKKPVVDCVVSVP 109



 Score = 50.4 bits (115), Expect = 7e-06
 Identities = 25/66 (37%), Positives = 40/66 (60%), Gaps = 5/66 (7%)
 Frame = +3

Query: 489 ECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKG-----TGERNV 653
           +C      ++ D++R++  DA  I+GLN LR++NE TA A+AYG+ K+         RNV
Sbjct: 103 DCVVSVPCFYTDAERRSVMDATQIAGLNCLRLMNETTAVALAYGIYKQDLPALEEKPRNV 162

Query: 654 LIFDLG 671
           +  D+G
Sbjct: 163 VFVDMG 168


>BC126124-1|AAI26125.1|  840|Homo sapiens heat shock 70kDa protein 4
           protein.
          Length = 840

 Score = 50.4 bits (115), Expect = 7e-06
 Identities = 26/59 (44%), Positives = 40/59 (67%), Gaps = 1/59 (1%)
 Frame = +1

Query: 337 LAFRVVS-DGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           LA+ +V    G   IKV Y  E++ F  E+V++M+L+K+KETAE+ L K V + V++VP
Sbjct: 87  LAYDIVQLPTGLTGIKVTYMEEERNFTTEQVTAMLLSKLKETAESVLKKPVVDCVVSVP 145



 Score = 50.4 bits (115), Expect = 7e-06
 Identities = 25/66 (37%), Positives = 40/66 (60%), Gaps = 5/66 (7%)
 Frame = +3

Query: 489 ECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKG-----TGERNV 653
           +C      ++ D++R++  DA  I+GLN LR++NE TA A+AYG+ K+         RNV
Sbjct: 139 DCVVSVPCFYTDAERRSVMDATQIAGLNCLRLMNETTAVALAYGIYKQDLPALEEKPRNV 198

Query: 654 LIFDLG 671
           +  D+G
Sbjct: 199 VFVDMG 204



 Score = 48.0 bits (109), Expect = 4e-05
 Identities = 25/53 (47%), Positives = 33/53 (62%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV 248
           VGIDLG     V V + G +E IAN+  +R TP+ ++F    R IG AAK+QV
Sbjct: 4   VGIDLGFQSCYVAVARAGGIETIANEYSDRCTPACISFGPKNRSIGAAAKSQV 56


>BC126122-1|AAI26123.1|  840|Homo sapiens heat shock 70kDa protein 4
           protein.
          Length = 840

 Score = 50.4 bits (115), Expect = 7e-06
 Identities = 26/59 (44%), Positives = 40/59 (67%), Gaps = 1/59 (1%)
 Frame = +1

Query: 337 LAFRVVS-DGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           LA+ +V    G   IKV Y  E++ F  E+V++M+L+K+KETAE+ L K V + V++VP
Sbjct: 87  LAYDIVQLPTGLTGIKVTYMEEERNFTTEQVTAMLLSKLKETAESVLKKPVVDCVVSVP 145



 Score = 50.4 bits (115), Expect = 7e-06
 Identities = 25/66 (37%), Positives = 40/66 (60%), Gaps = 5/66 (7%)
 Frame = +3

Query: 489 ECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKG-----TGERNV 653
           +C      ++ D++R++  DA  I+GLN LR++NE TA A+AYG+ K+         RNV
Sbjct: 139 DCVVSVPCFYTDAERRSVMDATQIAGLNCLRLMNETTAVALAYGIYKQDLPALEEKPRNV 198

Query: 654 LIFDLG 671
           +  D+G
Sbjct: 199 VFVDMG 204



 Score = 48.0 bits (109), Expect = 4e-05
 Identities = 25/53 (47%), Positives = 33/53 (62%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV 248
           VGIDLG     V V + G +E IAN+  +R TP+ ++F    R IG AAK+QV
Sbjct: 4   VGIDLGFQSCYVAVARAGGIETIANEYSDRCTPACISFGPKNRSIGAAAKSQV 56


>BC110861-1|AAI10862.1|  840|Homo sapiens heat shock 70kDa protein 4
           protein.
          Length = 840

 Score = 50.4 bits (115), Expect = 7e-06
 Identities = 26/59 (44%), Positives = 40/59 (67%), Gaps = 1/59 (1%)
 Frame = +1

Query: 337 LAFRVVS-DGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           LA+ +V    G   IKV Y  E++ F  E+V++M+L+K+KETAE+ L K V + V++VP
Sbjct: 87  LAYDIVQLPTGLTGIKVTYMEEERNFTTEQVTAMLLSKLKETAESVLKKPVVDCVVSVP 145



 Score = 50.4 bits (115), Expect = 7e-06
 Identities = 25/66 (37%), Positives = 40/66 (60%), Gaps = 5/66 (7%)
 Frame = +3

Query: 489 ECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKG-----TGERNV 653
           +C      ++ D++R++  DA  I+GLN LR++NE TA A+AYG+ K+         RNV
Sbjct: 139 DCVVSVPCFYTDAERRSVMDATQIAGLNCLRLMNETTAVALAYGIYKQDLPALEEKPRNV 198

Query: 654 LIFDLG 671
           +  D+G
Sbjct: 199 VFVDMG 204



 Score = 48.0 bits (109), Expect = 4e-05
 Identities = 25/53 (47%), Positives = 33/53 (62%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV 248
           VGIDLG     V V + G +E IAN+  +R TP+ ++F    R IG AAK+QV
Sbjct: 4   VGIDLGFQSCYVAVARAGGIETIANEYSDRCTPACISFGPKNRSIGAAAKSQV 56


>AB209151-1|BAD92388.1|  782|Homo sapiens heat shock 70kDa protein 4
           isoform a variant protein.
          Length = 782

 Score = 50.4 bits (115), Expect = 7e-06
 Identities = 26/59 (44%), Positives = 40/59 (67%), Gaps = 1/59 (1%)
 Frame = +1

Query: 337 LAFRVVS-DGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           LA+ +V    G   IKV Y  E++ F  E+V++M+L+K+KETAE+ L K V + V++VP
Sbjct: 110 LAYDIVQLPTGLTGIKVTYMEEERNFTTEQVTAMLLSKLKETAESVLKKPVVDCVVSVP 168



 Score = 50.4 bits (115), Expect = 7e-06
 Identities = 25/66 (37%), Positives = 40/66 (60%), Gaps = 5/66 (7%)
 Frame = +3

Query: 489 ECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKG-----TGERNV 653
           +C      ++ D++R++  DA  I+GLN LR++NE TA A+AYG+ K+         RNV
Sbjct: 162 DCVVSVPCFYTDAERRSVMDATQIAGLNCLRLMNETTAVALAYGIYKQDLPALEEKPRNV 221

Query: 654 LIFDLG 671
           +  D+G
Sbjct: 222 VFVDMG 227



 Score = 48.0 bits (109), Expect = 4e-05
 Identities = 25/53 (47%), Positives = 33/53 (62%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV 248
           VGIDLG     V V + G +E IAN+  +R TP+ ++F    R IG AAK+QV
Sbjct: 27  VGIDLGFQSCYVAVARAGGIETIANEYSDRCTPACISFGPKNRSIGAAAKSQV 79


>AB023420-1|BAA75062.1|  840|Homo sapiens apg-2 protein.
          Length = 840

 Score = 50.4 bits (115), Expect = 7e-06
 Identities = 26/59 (44%), Positives = 40/59 (67%), Gaps = 1/59 (1%)
 Frame = +1

Query: 337 LAFRVVS-DGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           LA+ +V    G   IKV Y  E++ F  E+V++M+L+K+KETAE+ L K V + V++VP
Sbjct: 87  LAYDIVQLPTGLTGIKVTYMEEERNFTTEQVTAMLLSKLKETAESVLKKPVVDCVVSVP 145



 Score = 50.4 bits (115), Expect = 7e-06
 Identities = 25/66 (37%), Positives = 40/66 (60%), Gaps = 5/66 (7%)
 Frame = +3

Query: 489 ECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKG-----TGERNV 653
           +C      ++ D++R++  DA  I+GLN LR++NE TA A+AYG+ K+         RNV
Sbjct: 139 DCVVSVPCFYTDAERRSVMDATQIAGLNCLRLMNETTAVALAYGIYKQDLPALEEKPRNV 198

Query: 654 LIFDLG 671
           +  D+G
Sbjct: 199 VFVDMG 204



 Score = 48.0 bits (109), Expect = 4e-05
 Identities = 25/53 (47%), Positives = 33/53 (62%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV 248
           VGIDLG     V V + G +E IAN+  +R TP+ ++F    R IG AAK+QV
Sbjct: 4   VGIDLGFQSCYVAVARAGGIETIANEYSDRCTPACISFGPKNRSIGAAAKSQV 56


>AL137142-3|CAI12429.1|  817|Homo sapiens heat shock 105kDa/110kDa
           protein 1 protein.
          Length = 817

 Score = 48.4 bits (110), Expect = 3e-05
 Identities = 23/52 (44%), Positives = 33/52 (63%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ 245
           VG+D+G+    + V + G +E IAN+  +R TPS ++F    R IG AAKNQ
Sbjct: 4   VGLDVGSQSCYIAVARAGGIETIANEFSDRCTPSVISFGSKNRTIGVAAKNQ 55



 Score = 44.0 bits (99), Expect = 6e-04
 Identities = 18/41 (43%), Positives = 30/41 (73%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKK 632
           ++F D++R++  DA  I GLN LR++N+ TA A+ YG+ K+
Sbjct: 105 SFFTDAERRSVLDAAQIVGLNCLRLMNDMTAVALNYGIYKQ 145


>BT007375-1|AAP36039.1|  148|Homo sapiens heat shock protein, 110
           kDa protein.
          Length = 148

 Score = 48.0 bits (109), Expect = 4e-05
 Identities = 25/53 (47%), Positives = 33/53 (62%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV 248
           VGIDLG     V V + G +E IAN+  +R TP+ ++F    R IG AAK+QV
Sbjct: 4   VGIDLGFQSCYVAVARAGGIETIANEYSDRCTPACISFGPKNRSIGAAAKSQV 56


>BC002526-1|AAH02526.1|  148|Homo sapiens heat shock 70kDa protein 4
           protein.
          Length = 148

 Score = 48.0 bits (109), Expect = 4e-05
 Identities = 25/53 (47%), Positives = 33/53 (62%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV 248
           VGIDLG     V V + G +E IAN+  +R TP+ ++F    R IG AAK+QV
Sbjct: 4   VGIDLGFQSCYVAVARAGGIETIANEYSDRCTPACISFGPKNRSIGAAAKSQV 56


>X04676-1|CAA28381.1|   22|Homo sapiens protein ( Human hsp 70 gene
           5' region for 70 kDa heat shock protein. ).
          Length = 22

 Score = 46.8 bits (106), Expect = 8e-05
 Identities = 21/22 (95%), Positives = 21/22 (95%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQ 137
           MAKA AVGIDLGTTYSCVGVFQ
Sbjct: 1   MAKAAAVGIDLGTTYSCVGVFQ 22


>BC004560-1|AAH04560.1|  147|Homo sapiens HYOU1 protein protein.
          Length = 147

 Score = 37.1 bits (82), Expect = 0.067
 Identities = 18/58 (31%), Positives = 29/58 (50%), Gaps = 1/58 (1%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHG-KVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           + +DLG+    V + + G  +EI+ N +  R TP  V   + ER  GD+A +     P
Sbjct: 36  MSVDLGSESMKVAIVKPGVPMEIVLNKESRRKTPVIVTLKENERFFGDSAASMAIKNP 93


>BC103893-1|AAI03894.1|  346|Homo sapiens MAGEC3 protein protein.
          Length = 346

 Score = 32.7 bits (71), Expect = 1.4
 Identities = 18/35 (51%), Positives = 25/35 (71%)
 Frame = -2

Query: 467 ASAVSFIFVSTMELTSSGKKVLSSPLYATLILGLP 363
           +S+  F+F S+  L+SS    LSSPL +TLILG+P
Sbjct: 44  SSSFHFLFPSSSSLSSSSP--LSSPLPSTLILGVP 76


>AB037748-1|BAA92565.2| 1804|Homo sapiens KIAA1327 protein protein.
          Length = 1804

 Score = 31.1 bits (67), Expect = 4.4
 Identities = 19/55 (34%), Positives = 24/55 (43%)
 Frame = +3

Query: 99  DLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           D+    S  G    GKV II+    N  TP   A TD E  + DA + +  M  T
Sbjct: 807 DITNQNSLAGGKNQGKVLIISTSTTNDYTPQVSAITDVEGGLSDALRTEENMEGT 861


>U73737-1|AAB47425.1| 1360|Homo sapiens hMSH6 protein.
          Length = 1360

 Score = 30.3 bits (65), Expect = 7.7
 Identities = 17/59 (28%), Positives = 23/59 (38%)
 Frame = +2

Query: 5   TSNRARLLSCFKNK*QD*LKIQNGKSTRSRNRSGYHVLLRWCLPAREGGDHRQRPGQQD 181
           T N  R  S  +N  +    +  G    SR    YH  L W    +   +HR+RP   D
Sbjct: 333 TKNTLRAFSAPQNS-ESQAHVSGGGDDSSRPTVWYHETLEWLKEEKRRDEHRRRPDHPD 390


>U54777-1|AAB39212.2| 1360|Homo sapiens hMSH6 protein protein.
          Length = 1360

 Score = 30.3 bits (65), Expect = 7.7
 Identities = 17/59 (28%), Positives = 23/59 (38%)
 Frame = +2

Query: 5   TSNRARLLSCFKNK*QD*LKIQNGKSTRSRNRSGYHVLLRWCLPAREGGDHRQRPGQQD 181
           T N  R  S  +N  +    +  G    SR    YH  L W    +   +HR+RP   D
Sbjct: 333 TKNTLRAFSAPQNS-ESQAHVSGGGDDSSRPTVWYHETLEWLKEEKRRDEHRRRPDHPD 390


>U28946-1|AAC50461.1| 1360|Homo sapiens G/T mismatch binding protein
           protein.
          Length = 1360

 Score = 30.3 bits (65), Expect = 7.7
 Identities = 17/59 (28%), Positives = 23/59 (38%)
 Frame = +2

Query: 5   TSNRARLLSCFKNK*QD*LKIQNGKSTRSRNRSGYHVLLRWCLPAREGGDHRQRPGQQD 181
           T N  R  S  +N  +    +  G    SR    YH  L W    +   +HR+RP   D
Sbjct: 333 TKNTLRAFSAPQNS-ESQAHVSGGGDDSSRPTVWYHETLEWLKEEKRRDEHRRRPDHPD 390


>D89646-1|BAA23675.1| 1068|Homo sapiens GTBP-ALT protein.
          Length = 1068

 Score = 30.3 bits (65), Expect = 7.7
 Identities = 17/59 (28%), Positives = 23/59 (38%)
 Frame = +2

Query: 5   TSNRARLLSCFKNK*QD*LKIQNGKSTRSRNRSGYHVLLRWCLPAREGGDHRQRPGQQD 181
           T N  R  S  +N  +    +  G    SR    YH  L W    +   +HR+RP   D
Sbjct: 333 TKNTLRAFSAPQNS-ESQAHVSGGGDDSSRPTVWYHETLEWLKEEKRRDEHRRRPDHPD 390


>D89645-2|BAA23673.1| 1068|Homo sapiens GTBP-ALT protein.
          Length = 1068

 Score = 30.3 bits (65), Expect = 7.7
 Identities = 17/59 (28%), Positives = 23/59 (38%)
 Frame = +2

Query: 5   TSNRARLLSCFKNK*QD*LKIQNGKSTRSRNRSGYHVLLRWCLPAREGGDHRQRPGQQD 181
           T N  R  S  +N  +    +  G    SR    YH  L W    +   +HR+RP   D
Sbjct: 333 TKNTLRAFSAPQNS-ESQAHVSGGGDDSSRPTVWYHETLEWLKEEKRRDEHRRRPDHPD 390


>D89645-1|BAA23674.1| 1360|Homo sapiens GTBP-N protein.
          Length = 1360

 Score = 30.3 bits (65), Expect = 7.7
 Identities = 17/59 (28%), Positives = 23/59 (38%)
 Frame = +2

Query: 5   TSNRARLLSCFKNK*QD*LKIQNGKSTRSRNRSGYHVLLRWCLPAREGGDHRQRPGQQD 181
           T N  R  S  +N  +    +  G    SR    YH  L W    +   +HR+RP   D
Sbjct: 333 TKNTLRAFSAPQNS-ESQAHVSGGGDDSSRPTVWYHETLEWLKEEKRRDEHRRRPDHPD 390


>BC004246-1|AAH04246.1| 1360|Homo sapiens mutS homolog 6 (E. coli)
           protein.
          Length = 1360

 Score = 30.3 bits (65), Expect = 7.7
 Identities = 17/59 (28%), Positives = 23/59 (38%)
 Frame = +2

Query: 5   TSNRARLLSCFKNK*QD*LKIQNGKSTRSRNRSGYHVLLRWCLPAREGGDHRQRPGQQD 181
           T N  R  S  +N  +    +  G    SR    YH  L W    +   +HR+RP   D
Sbjct: 333 TKNTLRAFSAPQNS-ESQAHVSGGGDDSSRPTVWYHETLEWLKEEKRRDEHRRRPDHPD 390


>AY082894-1|AAL87401.1| 1358|Homo sapiens mutS homolog 6 (E. coli)
           protein.
          Length = 1358

 Score = 30.3 bits (65), Expect = 7.7
 Identities = 17/59 (28%), Positives = 23/59 (38%)
 Frame = +2

Query: 5   TSNRARLLSCFKNK*QD*LKIQNGKSTRSRNRSGYHVLLRWCLPAREGGDHRQRPGQQD 181
           T N  R  S  +N  +    +  G    SR    YH  L W    +   +HR+RP   D
Sbjct: 333 TKNTLRAFSAPQNS-ESQAHVSGGGDDSSRPTVWYHETLEWLKEEKRRDEHRRRPDHPD 390


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 122,272,546
Number of Sequences: 237096
Number of extensions: 2815551
Number of successful extensions: 7906
Number of sequences better than 10.0: 124
Number of HSP's better than 10.0 without gapping: 7103
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7787
length of database: 76,859,062
effective HSP length: 88
effective length of database: 55,994,614
effective search space used: 9015132854
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -