SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20055
         (759 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Y00371-1|CAA68445.1|  646|Homo sapiens 71 Kd heat shock cognate ...   163   6e-40
U56725-1|AAD11466.1|  639|Homo sapiens heat shock protein protein.    163   6e-40
L26336-1|AAA52698.1|  639|Homo sapiens heat shock protein protein.    163   6e-40
DQ489378-1|ABE96830.1|  639|Homo sapiens heat shock 70kDa protei...   163   6e-40
BT009815-1|AAP88817.1|  639|Homo sapiens heat shock 70kDa protei...   163   6e-40
BC036107-1|AAH36107.1|  639|Homo sapiens HSPA2 protein protein.       163   6e-40
BC019816-1|AAH19816.1|  646|Homo sapiens heat shock 70kDa protei...   163   6e-40
BC016660-1|AAH16660.1|  646|Homo sapiens heat shock 70kDa protei...   163   6e-40
BC016179-1|AAH16179.1|  646|Homo sapiens heat shock 70kDa protei...   163   6e-40
BC007276-1|AAH07276.2|  587|Homo sapiens HSPA8 protein protein.       163   6e-40
BC001752-1|AAH01752.1|  639|Homo sapiens heat shock 70kDa protei...   163   6e-40
AK222628-1|BAD96348.1|  493|Homo sapiens heat shock 70kDa protei...   163   6e-40
AF352832-1|AAK17898.1|  646|Homo sapiens constitutive heat shock...   163   6e-40
AB034951-1|BAB18615.1|  493|Homo sapiens heat shock cognate prot...   163   6e-40
M59830-1|AAA63227.1|  641|Homo sapiens heat shock-induced protei...   161   2e-39
M59828-1|AAA63226.1|  641|Homo sapiens heat shock-induced protei...   161   2e-39
M11717-1|AAA52697.1|  640|Homo sapiens heat shock protein protein.    161   2e-39
DQ451402-1|ABD96830.1|  641|Homo sapiens heat shock 70kDa protei...   161   2e-39
DQ388429-1|ABD48956.1|  641|Homo sapiens heat shock 70kDa protei...   161   2e-39
BC063507-1|AAH63507.1|  641|Homo sapiens heat shock 70kDa protei...   161   2e-39
BC057397-1|AAH57397.1|  641|Homo sapiens heat shock 70kDa protei...   161   2e-39
BC018740-1|AAH18740.1|  641|Homo sapiens HSPA1A protein protein.      161   2e-39
BC009322-1|AAH09322.1|  641|Homo sapiens HSPA1A protein protein.      161   2e-39
BC002453-1|AAH02453.1|  641|Homo sapiens heat shock 70kDa protei...   161   2e-39
BA000025-9|BAB63300.1|  641|Homo sapiens heat shock protein prot...   161   2e-39
BA000025-8|BAB63299.1|  641|Homo sapiens heat shock protein prot...   161   2e-39
AL929592-7|CAI18466.1|  641|Homo sapiens heat shock 70kDa protei...   161   2e-39
AL929592-5|CAI18464.1|  641|Homo sapiens heat shock 70kDa protei...   161   2e-39
AL671762-7|CAI18217.1|  641|Homo sapiens heat shock 70kDa protei...   161   2e-39
AL671762-6|CAI18216.1|  641|Homo sapiens heat shock 70kDa protei...   161   2e-39
AL662834-18|CAI17738.1|  641|Homo sapiens heat shock 70kDa prote...   161   2e-39
AL662834-17|CAI17737.1|  641|Homo sapiens heat shock 70kDa prote...   161   2e-39
AK222785-1|BAD96505.1|  646|Homo sapiens heat shock 70kDa protei...   161   2e-39
AF134726-7|AAD21816.1|  641|Homo sapiens HSP70-1 protein.             161   2e-39
AF134726-6|AAD21815.1|  641|Homo sapiens HSP70-2 protein.             161   2e-39
AB209818-1|BAD93055.1|  709|Homo sapiens heat shock 70kDa protei...   161   2e-39
AB018045-1|BAA77235.1|  151|Homo sapiens heat shock protein 72 p...   161   2e-39
M59829-1|AAA63228.1|  641|Homo sapiens heat shock-induced protei...   160   4e-39
D85730-1|BAA32521.1|  641|Homo sapiens Heat shock protein 70 tes...   160   4e-39
DQ383515-1|ABC88476.1|  641|Homo sapiens heat shock 70kDa protei...   160   4e-39
BC034483-1|AAH34483.1|  641|Homo sapiens heat shock 70kDa protei...   160   4e-39
BA000025-10|BAB63301.1|  641|Homo sapiens heat shock protein pro...   160   4e-39
AL929592-4|CAI18463.1|  641|Homo sapiens heat shock 70kDa protei...   160   4e-39
AL671762-4|CAI18215.1|  641|Homo sapiens heat shock 70kDa protei...   160   4e-39
AL662834-15|CAI17736.1|  641|Homo sapiens heat shock 70kDa prote...   160   4e-39
AK223386-1|BAD97106.1|  641|Homo sapiens heat shock 70kDa protei...   160   4e-39
AF134726-8|AAD21817.1|  641|Homo sapiens HSP70-HOM protein.           160   4e-39
X51757-1|CAA36061.1|  643|Homo sapiens protein ( Human heat-shoc...   157   3e-38
DQ521571-1|ABF47108.1|  643|Homo sapiens heat shock 70kDa protei...   157   3e-38
BC035665-1|AAH35665.1|  643|Homo sapiens heat shock 70kDa protei...   157   3e-38
AL590385-3|CAI16120.1|  643|Homo sapiens heat shock 70kDa protei...   157   3e-38
M11236-1|AAA52696.1|  247|Homo sapiens HSPA1L protein.                156   9e-38
AK223362-1|BAD97082.1|  643|Homo sapiens heat shock 70kDa protei...   156   9e-38
X87949-1|CAA61201.1|  653|Homo sapiens BiP protein.                   146   6e-35
M19645-1|AAA52614.1|  653|Homo sapiens protein ( Human 78 kdalto...   146   6e-35
DQ385847-1|ABD04090.1|  654|Homo sapiens heat shock 70kDa protei...   146   6e-35
BC112963-1|AAI12964.1|  655|Homo sapiens HSPA5 protein protein.       146   6e-35
BC020235-1|AAH20235.1|  654|Homo sapiens heat shock 70kDa protei...   146   6e-35
AJ271729-1|CAB71335.1|  654|Homo sapiens glucose-regulated prote...   146   6e-35
AF216292-1|AAF42836.1|  654|Homo sapiens endoplasmic reticulum l...   146   6e-35
AF188611-1|AAF13605.1|  639|Homo sapiens BiP protein protein.         146   6e-35
L15189-1|AAA67526.1|  679|Homo sapiens MTHSP75 protein.               132   2e-30
DQ531046-1|ABF50973.1|  679|Homo sapiens heat shock 70kDa protei...   132   2e-30
BC030634-1|AAH30634.1|  681|Homo sapiens HSPA9 protein protein.       132   2e-30
BC024034-1|AAH24034.1|  679|Homo sapiens heat shock 70kDa protei...   132   2e-30
BC000478-1|AAH00478.1|  679|Homo sapiens heat shock 70kDa protei...   132   2e-30
DQ185038-1|ABD14419.1|  176|Homo sapiens heat shock 70 kDa prote...   130   7e-30
AK222758-1|BAD96478.1|  679|Homo sapiens heat shock 70kDa protei...   130   7e-30
U10149-1|AAC50076.1|  125|Homo sapiens heat shock protein protein.    126   1e-28
U04735-1|AAA16954.1|  471|Homo sapiens microsomal stress 70 prot...    84   6e-16
BC036370-1|AAH36370.1|  471|Homo sapiens stress 70 protein chape...    84   6e-16
AL929592-6|CAI18465.1|  476|Homo sapiens heat shock 70kDa protei...    84   6e-16
AL671762-5|CAM25532.1|  476|Homo sapiens heat shock 70kDa protei...    84   6e-16
AL662834-16|CAM24989.1|  476|Homo sapiens heat shock 70kDa prote...    84   6e-16
AL163206-1|CAB90390.1|  471|Homo sapiens human microsomal stress...    84   6e-16
AK223282-1|BAD97002.1|  471|Homo sapiens stress 70 protein chape...    84   6e-16
AF130249-1|AAD21091.1|  471|Homo sapiens STCH protein.                 84   6e-16
M24743-1|AAA59844.1|   36|Homo sapiens HSPA2 protein.                  76   1e-13
BC119690-1|AAI19691.1|  509|Homo sapiens heat shock 70kDa protei...    76   1e-13
AF143723-1|AAF66640.1|  509|Homo sapiens heat shock protein HSP6...    76   1e-13
AF112210-1|AAF17198.1|  509|Homo sapiens heat shock protein hsp7...    76   1e-13
L12723-1|AAA02807.1|  701|Homo sapiens heat shock protein 70 pro...    72   3e-12
X67643-1|CAA47886.1|  474|Homo sapiens HS24/P52 protein.               71   3e-12
X67640-1|CAA47885.1|  266|Homo sapiens HS24/P52 protein.               71   3e-12
BC126124-1|AAI26125.1|  840|Homo sapiens heat shock 70kDa protei...    71   3e-12
BC126122-1|AAI26123.1|  840|Homo sapiens heat shock 70kDa protei...    71   3e-12
BC110861-1|AAI10862.1|  840|Homo sapiens heat shock 70kDa protei...    71   3e-12
AB209151-1|BAD92388.1|  782|Homo sapiens heat shock 70kDa protei...    71   3e-12
AB023420-1|BAA75062.1|  840|Homo sapiens apg-2 protein.                71   3e-12
AY290862-1|AAP44471.1|  839|Homo sapiens heat shock protein apg-...    70   1e-11
AB023421-1|BAA75063.1|  839|Homo sapiens apg-1 protein.                70   1e-11
EF197155-1|ABM69040.1|  839|Homo sapiens heat shock 70 kDa prote...    67   6e-11
D86956-1|BAA13192.2|  949|Homo sapiens KIAA0201 protein.               67   6e-11
BC040560-1|AAH40560.1|  839|Homo sapiens heat shock 70kDa protei...    67   6e-11
BC037553-1|AAH37553.1|  858|Homo sapiens heat shock 105kDa/110kD...    67   6e-11
AL137142-5|CAI12430.1|  858|Homo sapiens heat shock 105kDa/110kD...    67   6e-11
AL137142-4|CAI12428.1|  814|Homo sapiens heat shock 105kDa/110kD...    67   6e-11
AF039695-1|AAC18044.1|  872|Homo sapiens antigen NY-CO-25 protein.     67   6e-11
AC093591-2|AAY40975.1|  839|Homo sapiens unknown protein.              67   6e-11
AB003334-1|BAA34780.1|  858|Homo sapiens HSP105 alpha protein.         67   6e-11
AB003333-1|BAA34779.1|  814|Homo sapiens HSP105 beta protein.          67   6e-11
BC108738-1|AAI08739.1|   88|Homo sapiens HSPA14 protein protein.       60   1e-08
BC065281-1|AAH65281.1|   88|Homo sapiens HSPA14 protein protein.       60   1e-08
AL137142-3|CAI12429.1|  817|Homo sapiens heat shock 105kDa/110kD...    60   1e-08
U65785-1|AAC50947.1|  999|Homo sapiens 150 kDa oxygen-regulated ...    58   5e-08
DQ372932-1|ABD14370.1|  999|Homo sapiens 150 kDa oxygen-regulate...    58   5e-08
DQ350134-1|ABC75106.1|  999|Homo sapiens 150 kDa oxygen-regulate...    58   5e-08
BC072436-1|AAH72436.1|  678|Homo sapiens HYOU1 protein protein.        58   5e-08
BC017726-1|AAH17726.1|  657|Homo sapiens Unknown (protein for IM...    58   5e-08
AK222756-1|BAD96476.1|  999|Homo sapiens oxygen regulated protei...    58   5e-08
BT007375-1|AAP36039.1|  148|Homo sapiens heat shock protein, 110...    48   4e-05
BC002526-1|AAH02526.1|  148|Homo sapiens heat shock 70kDa protei...    48   4e-05
X04676-1|CAA28381.1|   22|Homo sapiens protein ( Human hsp 70 ge...    47   8e-05
BC004560-1|AAH04560.1|  147|Homo sapiens HYOU1 protein protein.        36   0.16 
BC103893-1|AAI03894.1|  346|Homo sapiens MAGEC3 protein protein.       33   1.5  
AB208990-1|BAD92227.1|  415|Homo sapiens apolipoprotein L2 varia...    32   2.0  
BC105604-1|AAI05605.1|  196|Homo sapiens SR140 protein protein.        31   6.0  
BC016323-1|AAH16323.1|  202|Homo sapiens Unknown (protein for IM...    31   6.0  
BC006474-1|AAH06474.1| 1027|Homo sapiens Unknown (protein for IM...    31   6.0  
AY152730-1|AAN75525.1|  665|Homo sapiens Rap1-interacting adapto...    31   6.0  
AB002330-1|BAA20790.1| 1028|Homo sapiens KIAA0332 protein.             31   6.0  
BC035625-1|AAH35625.1|  499|Homo sapiens EGR2 protein protein.         30   7.9  

>Y00371-1|CAA68445.1|  646|Homo sapiens 71 Kd heat shock cognate
           protein protein.
          Length = 646

 Score =  163 bits (396), Expect = 6e-40
 Identities = 79/84 (94%), Positives = 80/84 (95%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAGTI+GLNVLRIINEPTAAAIAYGLDKK   ERNVLIFDLGGGTF
Sbjct: 146 VPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTF 205

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVSILTIEDGIFEVKSTAGDTH G
Sbjct: 206 DVSILTIEDGIFEVKSTAGDTHLG 229



 Score =  151 bits (365), Expect = 4e-36
 Identities = 66/87 (75%), Positives = 78/87 (89%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGR+F+DA VQ+DMKHWPF VV+D G+PK++V YKGE K+F+PEEVS
Sbjct: 61  MNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVS 120

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKE AEAYLGKTV NAV+T P
Sbjct: 121 SMVLTKMKEIAEAYLGKTVTNAVVTVP 147



 Score =  128 bits (309), Expect = 2e-29
 Identities = 60/64 (93%), Positives = 61/64 (95%)
 Frame = +3

Query: 75  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 254
           M+K PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 255 *TPT 266
             PT
Sbjct: 61  MNPT 64


>U56725-1|AAD11466.1|  639|Homo sapiens heat shock protein protein.
          Length = 639

 Score =  163 bits (396), Expect = 6e-40
 Identities = 80/86 (93%), Positives = 82/86 (95%), Gaps = 2/86 (2%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGT--GERNVLIFDLGGG 681
           VPAYFNDSQRQATKDAGTI+GLNVLRIINEPTAAAIAYGLDKKG   GE+NVLIFDLGGG
Sbjct: 147 VPAYFNDSQRQATKDAGTITGLNVLRIINEPTAAAIAYGLDKKGCAGGEKNVLIFDLGGG 206

Query: 682 TFDVSILTIEDGIFEVKSTAGDTHFG 759
           TFDVSILTIEDGIFEVKSTAGDTH G
Sbjct: 207 TFDVSILTIEDGIFEVKSTAGDTHLG 232



 Score =  155 bits (377), Expect = 1e-37
 Identities = 71/87 (81%), Positives = 78/87 (89%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NTIFDAKRLIGRKFEDATVQ+DMKHWPF VVS+GGKPK++V YKGE KTFFPEE+S
Sbjct: 62  MNPTNTIFDAKRLIGRKFEDATVQSDMKHWPFRVVSEGGKPKVQVEYKGETKTFFPEEIS 121

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKE AEAYLG  V +AVIT P
Sbjct: 122 SMVLTKMKEIAEAYLGGKVHSAVITVP 148



 Score =  126 bits (303), Expect = 1e-28
 Identities = 58/63 (92%), Positives = 60/63 (95%)
 Frame = +3

Query: 78  AKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA* 257
           A+ PA+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 
Sbjct: 3   ARGPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM 62

Query: 258 TPT 266
            PT
Sbjct: 63  NPT 65


>L26336-1|AAA52698.1|  639|Homo sapiens heat shock protein protein.
          Length = 639

 Score =  163 bits (396), Expect = 6e-40
 Identities = 80/86 (93%), Positives = 82/86 (95%), Gaps = 2/86 (2%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGT--GERNVLIFDLGGG 681
           VPAYFNDSQRQATKDAGTI+GLNVLRIINEPTAAAIAYGLDKKG   GE+NVLIFDLGGG
Sbjct: 147 VPAYFNDSQRQATKDAGTITGLNVLRIINEPTAAAIAYGLDKKGCAGGEKNVLIFDLGGG 206

Query: 682 TFDVSILTIEDGIFEVKSTAGDTHFG 759
           TFDVSILTIEDGIFEVKSTAGDTH G
Sbjct: 207 TFDVSILTIEDGIFEVKSTAGDTHLG 232



 Score =  155 bits (377), Expect = 1e-37
 Identities = 71/87 (81%), Positives = 78/87 (89%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NTIFDAKRLIGRKFEDATVQ+DMKHWPF VVS+GGKPK++V YKGE KTFFPEE+S
Sbjct: 62  MNPTNTIFDAKRLIGRKFEDATVQSDMKHWPFRVVSEGGKPKVQVEYKGETKTFFPEEIS 121

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKE AEAYLG  V +AVIT P
Sbjct: 122 SMVLTKMKEIAEAYLGGKVHSAVITVP 148



 Score =  126 bits (303), Expect = 1e-28
 Identities = 58/63 (92%), Positives = 60/63 (95%)
 Frame = +3

Query: 78  AKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA* 257
           A+ PA+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 
Sbjct: 3   ARGPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM 62

Query: 258 TPT 266
            PT
Sbjct: 63  NPT 65


>DQ489378-1|ABE96830.1|  639|Homo sapiens heat shock 70kDa protein 2
           protein.
          Length = 639

 Score =  163 bits (396), Expect = 6e-40
 Identities = 80/86 (93%), Positives = 82/86 (95%), Gaps = 2/86 (2%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGT--GERNVLIFDLGGG 681
           VPAYFNDSQRQATKDAGTI+GLNVLRIINEPTAAAIAYGLDKKG   GE+NVLIFDLGGG
Sbjct: 147 VPAYFNDSQRQATKDAGTITGLNVLRIINEPTAAAIAYGLDKKGCAGGEKNVLIFDLGGG 206

Query: 682 TFDVSILTIEDGIFEVKSTAGDTHFG 759
           TFDVSILTIEDGIFEVKSTAGDTH G
Sbjct: 207 TFDVSILTIEDGIFEVKSTAGDTHLG 232



 Score =  155 bits (377), Expect = 1e-37
 Identities = 71/87 (81%), Positives = 78/87 (89%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NTIFDAKRLIGRKFEDATVQ+DMKHWPF VVS+GGKPK++V YKGE KTFFPEE+S
Sbjct: 62  MNPTNTIFDAKRLIGRKFEDATVQSDMKHWPFRVVSEGGKPKVQVEYKGETKTFFPEEIS 121

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKE AEAYLG  V +AVIT P
Sbjct: 122 SMVLTKMKEIAEAYLGGKVHSAVITVP 148



 Score =  126 bits (303), Expect = 1e-28
 Identities = 58/63 (92%), Positives = 60/63 (95%)
 Frame = +3

Query: 78  AKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA* 257
           A+ PA+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 
Sbjct: 3   ARGPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM 62

Query: 258 TPT 266
            PT
Sbjct: 63  NPT 65


>BT009815-1|AAP88817.1|  639|Homo sapiens heat shock 70kDa protein 2
           protein.
          Length = 639

 Score =  163 bits (396), Expect = 6e-40
 Identities = 80/86 (93%), Positives = 82/86 (95%), Gaps = 2/86 (2%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGT--GERNVLIFDLGGG 681
           VPAYFNDSQRQATKDAGTI+GLNVLRIINEPTAAAIAYGLDKKG   GE+NVLIFDLGGG
Sbjct: 147 VPAYFNDSQRQATKDAGTITGLNVLRIINEPTAAAIAYGLDKKGCAGGEKNVLIFDLGGG 206

Query: 682 TFDVSILTIEDGIFEVKSTAGDTHFG 759
           TFDVSILTIEDGIFEVKSTAGDTH G
Sbjct: 207 TFDVSILTIEDGIFEVKSTAGDTHLG 232



 Score =  155 bits (377), Expect = 1e-37
 Identities = 71/87 (81%), Positives = 78/87 (89%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NTIFDAKRLIGRKFEDATVQ+DMKHWPF VVS+GGKPK++V YKGE KTFFPEE+S
Sbjct: 62  MNPTNTIFDAKRLIGRKFEDATVQSDMKHWPFRVVSEGGKPKVQVEYKGETKTFFPEEIS 121

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKE AEAYLG  V +AVIT P
Sbjct: 122 SMVLTKMKEIAEAYLGGKVHSAVITVP 148



 Score =  126 bits (303), Expect = 1e-28
 Identities = 58/63 (92%), Positives = 60/63 (95%)
 Frame = +3

Query: 78  AKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA* 257
           A+ PA+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 
Sbjct: 3   ARGPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM 62

Query: 258 TPT 266
            PT
Sbjct: 63  NPT 65


>BC036107-1|AAH36107.1|  639|Homo sapiens HSPA2 protein protein.
          Length = 639

 Score =  163 bits (396), Expect = 6e-40
 Identities = 80/86 (93%), Positives = 82/86 (95%), Gaps = 2/86 (2%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGT--GERNVLIFDLGGG 681
           VPAYFNDSQRQATKDAGTI+GLNVLRIINEPTAAAIAYGLDKKG   GE+NVLIFDLGGG
Sbjct: 147 VPAYFNDSQRQATKDAGTITGLNVLRIINEPTAAAIAYGLDKKGCAGGEKNVLIFDLGGG 206

Query: 682 TFDVSILTIEDGIFEVKSTAGDTHFG 759
           TFDVSILTIEDGIFEVKSTAGDTH G
Sbjct: 207 TFDVSILTIEDGIFEVKSTAGDTHLG 232



 Score =  153 bits (370), Expect = 9e-37
 Identities = 70/87 (80%), Positives = 77/87 (88%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NTIFDAKRLIGRKF DATVQ+DMKHWPF VVS+GGKPK++V YKGE KTFFPEE+S
Sbjct: 62  MNPTNTIFDAKRLIGRKFGDATVQSDMKHWPFRVVSEGGKPKVQVEYKGETKTFFPEEIS 121

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKE AEAYLG  V +AVIT P
Sbjct: 122 SMVLTKMKEIAEAYLGGKVHSAVITVP 148



 Score =  123 bits (297), Expect = 6e-28
 Identities = 57/63 (90%), Positives = 59/63 (93%)
 Frame = +3

Query: 78  AKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA* 257
           A+ PA+GIDLG TYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 
Sbjct: 3   ARGPAIGIDLGPTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM 62

Query: 258 TPT 266
            PT
Sbjct: 63  NPT 65


>BC019816-1|AAH19816.1|  646|Homo sapiens heat shock 70kDa protein 8
           protein.
          Length = 646

 Score =  163 bits (396), Expect = 6e-40
 Identities = 79/84 (94%), Positives = 80/84 (95%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAGTI+GLNVLRIINEPTAAAIAYGLDKK   ERNVLIFDLGGGTF
Sbjct: 146 VPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTF 205

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVSILTIEDGIFEVKSTAGDTH G
Sbjct: 206 DVSILTIEDGIFEVKSTAGDTHLG 229



 Score =  151 bits (365), Expect = 4e-36
 Identities = 66/87 (75%), Positives = 78/87 (89%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGR+F+DA VQ+DMKHWPF VV+D G+PK++V YKGE K+F+PEEVS
Sbjct: 61  MNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVS 120

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKE AEAYLGKTV NAV+T P
Sbjct: 121 SMVLTKMKEIAEAYLGKTVTNAVVTVP 147



 Score =  128 bits (309), Expect = 2e-29
 Identities = 60/64 (93%), Positives = 61/64 (95%)
 Frame = +3

Query: 75  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 254
           M+K PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 255 *TPT 266
             PT
Sbjct: 61  MNPT 64


>BC016660-1|AAH16660.1|  646|Homo sapiens heat shock 70kDa protein 8
           protein.
          Length = 646

 Score =  163 bits (396), Expect = 6e-40
 Identities = 79/84 (94%), Positives = 80/84 (95%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAGTI+GLNVLRIINEPTAAAIAYGLDKK   ERNVLIFDLGGGTF
Sbjct: 146 VPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTF 205

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVSILTIEDGIFEVKSTAGDTH G
Sbjct: 206 DVSILTIEDGIFEVKSTAGDTHLG 229



 Score =  151 bits (365), Expect = 4e-36
 Identities = 66/87 (75%), Positives = 78/87 (89%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGR+F+DA VQ+DMKHWPF VV+D G+PK++V YKGE K+F+PEEVS
Sbjct: 61  MNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVS 120

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKE AEAYLGKTV NAV+T P
Sbjct: 121 SMVLTKMKEIAEAYLGKTVTNAVVTVP 147



 Score =  128 bits (309), Expect = 2e-29
 Identities = 60/64 (93%), Positives = 61/64 (95%)
 Frame = +3

Query: 75  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 254
           M+K PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 255 *TPT 266
             PT
Sbjct: 61  MNPT 64


>BC016179-1|AAH16179.1|  646|Homo sapiens heat shock 70kDa protein 8
           protein.
          Length = 646

 Score =  163 bits (396), Expect = 6e-40
 Identities = 79/84 (94%), Positives = 80/84 (95%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAGTI+GLNVLRIINEPTAAAIAYGLDKK   ERNVLIFDLGGGTF
Sbjct: 146 VPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTF 205

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVSILTIEDGIFEVKSTAGDTH G
Sbjct: 206 DVSILTIEDGIFEVKSTAGDTHLG 229



 Score =  151 bits (365), Expect = 4e-36
 Identities = 66/87 (75%), Positives = 78/87 (89%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGR+F+DA VQ+DMKHWPF VV+D G+PK++V YKGE K+F+PEEVS
Sbjct: 61  MNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVS 120

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKE AEAYLGKTV NAV+T P
Sbjct: 121 SMVLTKMKEIAEAYLGKTVTNAVVTVP 147



 Score =  128 bits (309), Expect = 2e-29
 Identities = 60/64 (93%), Positives = 61/64 (95%)
 Frame = +3

Query: 75  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 254
           M+K PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 255 *TPT 266
             PT
Sbjct: 61  MNPT 64


>BC007276-1|AAH07276.2|  587|Homo sapiens HSPA8 protein protein.
          Length = 587

 Score =  163 bits (396), Expect = 6e-40
 Identities = 79/84 (94%), Positives = 80/84 (95%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAGTI+GLNVLRIINEPTAAAIAYGLDKK   ERNVLIFDLGGGTF
Sbjct: 87  VPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTF 146

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVSILTIEDGIFEVKSTAGDTH G
Sbjct: 147 DVSILTIEDGIFEVKSTAGDTHLG 170



 Score =  151 bits (365), Expect = 4e-36
 Identities = 66/87 (75%), Positives = 78/87 (89%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGR+F+DA VQ+DMKHWPF VV+D G+PK++V YKGE K+F+PEEVS
Sbjct: 2   MNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVS 61

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKE AEAYLGKTV NAV+T P
Sbjct: 62  SMVLTKMKEIAEAYLGKTVTNAVVTVP 88


>BC001752-1|AAH01752.1|  639|Homo sapiens heat shock 70kDa protein 2
           protein.
          Length = 639

 Score =  163 bits (396), Expect = 6e-40
 Identities = 80/86 (93%), Positives = 82/86 (95%), Gaps = 2/86 (2%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGT--GERNVLIFDLGGG 681
           VPAYFNDSQRQATKDAGTI+GLNVLRIINEPTAAAIAYGLDKKG   GE+NVLIFDLGGG
Sbjct: 147 VPAYFNDSQRQATKDAGTITGLNVLRIINEPTAAAIAYGLDKKGCAGGEKNVLIFDLGGG 206

Query: 682 TFDVSILTIEDGIFEVKSTAGDTHFG 759
           TFDVSILTIEDGIFEVKSTAGDTH G
Sbjct: 207 TFDVSILTIEDGIFEVKSTAGDTHLG 232



 Score =  155 bits (377), Expect = 1e-37
 Identities = 71/87 (81%), Positives = 78/87 (89%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NTIFDAKRLIGRKFEDATVQ+DMKHWPF VVS+GGKPK++V YKGE KTFFPEE+S
Sbjct: 62  MNPTNTIFDAKRLIGRKFEDATVQSDMKHWPFRVVSEGGKPKVQVEYKGETKTFFPEEIS 121

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKE AEAYLG  V +AVIT P
Sbjct: 122 SMVLTKMKEIAEAYLGGKVHSAVITVP 148



 Score =  126 bits (303), Expect = 1e-28
 Identities = 58/63 (92%), Positives = 60/63 (95%)
 Frame = +3

Query: 78  AKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA* 257
           A+ PA+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 
Sbjct: 3   ARGPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM 62

Query: 258 TPT 266
            PT
Sbjct: 63  NPT 65


>AK222628-1|BAD96348.1|  493|Homo sapiens heat shock 70kDa protein 8
           isoform 2 variant protein.
          Length = 493

 Score =  163 bits (396), Expect = 6e-40
 Identities = 79/84 (94%), Positives = 80/84 (95%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAGTI+GLNVLRIINEPTAAAIAYGLDKK   ERNVLIFDLGGGTF
Sbjct: 146 VPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTF 205

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVSILTIEDGIFEVKSTAGDTH G
Sbjct: 206 DVSILTIEDGIFEVKSTAGDTHLG 229



 Score =  151 bits (365), Expect = 4e-36
 Identities = 66/87 (75%), Positives = 78/87 (89%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGR+F+DA VQ+DMKHWPF VV+D G+PK++V YKGE K+F+PEEVS
Sbjct: 61  MNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVS 120

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKE AEAYLGKTV NAV+T P
Sbjct: 121 SMVLTKMKEIAEAYLGKTVTNAVVTVP 147



 Score =  128 bits (309), Expect = 2e-29
 Identities = 60/64 (93%), Positives = 61/64 (95%)
 Frame = +3

Query: 75  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 254
           M+K PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 255 *TPT 266
             PT
Sbjct: 61  MNPT 64


>AF352832-1|AAK17898.1|  646|Homo sapiens constitutive heat shock
           protein 70 protein.
          Length = 646

 Score =  163 bits (396), Expect = 6e-40
 Identities = 79/84 (94%), Positives = 80/84 (95%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAGTI+GLNVLRIINEPTAAAIAYGLDKK   ERNVLIFDLGGGTF
Sbjct: 146 VPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTF 205

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVSILTIEDGIFEVKSTAGDTH G
Sbjct: 206 DVSILTIEDGIFEVKSTAGDTHLG 229



 Score =  151 bits (365), Expect = 4e-36
 Identities = 66/87 (75%), Positives = 78/87 (89%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGR+F+DA VQ+DMKHWPF VV+D G+PK++V YKGE K+F+PEEVS
Sbjct: 61  MNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVS 120

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKE AEAYLGKTV NAV+T P
Sbjct: 121 SMVLTKMKEIAEAYLGKTVTNAVVTVP 147



 Score =  128 bits (309), Expect = 2e-29
 Identities = 60/64 (93%), Positives = 61/64 (95%)
 Frame = +3

Query: 75  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 254
           M+K PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 255 *TPT 266
             PT
Sbjct: 61  MNPT 64


>AB034951-1|BAB18615.1|  493|Homo sapiens heat shock cognate protein
           54 protein.
          Length = 493

 Score =  163 bits (396), Expect = 6e-40
 Identities = 79/84 (94%), Positives = 80/84 (95%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAGTI+GLNVLRIINEPTAAAIAYGLDKK   ERNVLIFDLGGGTF
Sbjct: 146 VPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTF 205

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVSILTIEDGIFEVKSTAGDTH G
Sbjct: 206 DVSILTIEDGIFEVKSTAGDTHLG 229



 Score =  151 bits (365), Expect = 4e-36
 Identities = 66/87 (75%), Positives = 78/87 (89%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGR+F+DA VQ+DMKHWPF VV+D G+PK++V YKGE K+F+PEEVS
Sbjct: 61  MNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVS 120

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKE AEAYLGKTV NAV+T P
Sbjct: 121 SMVLTKMKEIAEAYLGKTVTNAVVTVP 147



 Score =  128 bits (309), Expect = 2e-29
 Identities = 60/64 (93%), Positives = 61/64 (95%)
 Frame = +3

Query: 75  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 254
           M+K PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 255 *TPT 266
             PT
Sbjct: 61  MNPT 64


>M59830-1|AAA63227.1|  641|Homo sapiens heat shock-induced protein
           protein.
          Length = 641

 Score =  161 bits (392), Expect = 2e-39
 Identities = 76/84 (90%), Positives = 80/84 (95%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLD+ G GERNVLIFDLGGGTF
Sbjct: 146 VPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDRTGKGERNVLIFDLGGGTF 205

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVSILTI+DGIFEVK+TAGDTH G
Sbjct: 206 DVSILTIDDGIFEVKATAGDTHLG 229



 Score =  145 bits (352), Expect = 1e-34
 Identities = 64/87 (73%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRKF D  VQ+DMKHWPF+V++DG KPK++V+YKGE K F+PEE+S
Sbjct: 61  LNPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEEIS 120

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKE AEAYLG  V NAVIT P
Sbjct: 121 SMVLTKMKEIAEAYLGYPVTNAVITVP 147



 Score =  125 bits (302), Expect = 2e-28
 Identities = 59/63 (93%), Positives = 60/63 (95%)
 Frame = +3

Query: 75  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 254
           MAKA A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 255 *TP 263
             P
Sbjct: 61  LNP 63


>M59828-1|AAA63226.1|  641|Homo sapiens heat shock-induced protein
           protein.
          Length = 641

 Score =  161 bits (392), Expect = 2e-39
 Identities = 76/84 (90%), Positives = 80/84 (95%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLD+ G GERNVLIFDLGGGTF
Sbjct: 146 VPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDRTGKGERNVLIFDLGGGTF 205

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVSILTI+DGIFEVK+TAGDTH G
Sbjct: 206 DVSILTIDDGIFEVKATAGDTHLG 229



 Score =  145 bits (352), Expect = 1e-34
 Identities = 64/87 (73%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRKF D  VQ+DMKHWPF+V++DG KPK++V+YKGE K F+PEE+S
Sbjct: 61  LNPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEEIS 120

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKE AEAYLG  V NAVIT P
Sbjct: 121 SMVLTKMKEIAEAYLGYPVTNAVITVP 147



 Score =  125 bits (302), Expect = 2e-28
 Identities = 59/63 (93%), Positives = 60/63 (95%)
 Frame = +3

Query: 75  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 254
           MAKA A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 255 *TP 263
             P
Sbjct: 61  LNP 63


>M11717-1|AAA52697.1|  640|Homo sapiens heat shock protein protein.
          Length = 640

 Score =  161 bits (392), Expect = 2e-39
 Identities = 76/84 (90%), Positives = 80/84 (95%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLD+ G GERNVLIFDLGGGTF
Sbjct: 146 VPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDRTGKGERNVLIFDLGGGTF 205

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVSILTI+DGIFEVK+TAGDTH G
Sbjct: 206 DVSILTIDDGIFEVKATAGDTHLG 229



 Score =  145 bits (352), Expect = 1e-34
 Identities = 64/87 (73%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRKF D  VQ+DMKHWPF+V++DG KPK++V+YKGE K F+PEE+S
Sbjct: 61  LNPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEEIS 120

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKE AEAYLG  V NAVIT P
Sbjct: 121 SMVLTKMKEIAEAYLGYPVTNAVITVP 147



 Score =  126 bits (303), Expect = 1e-28
 Identities = 60/63 (95%), Positives = 60/63 (95%)
 Frame = +3

Query: 75  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 254
           MAKA AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MAKAAAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 255 *TP 263
             P
Sbjct: 61  LNP 63


>DQ451402-1|ABD96830.1|  641|Homo sapiens heat shock 70kDa protein
           1A protein.
          Length = 641

 Score =  161 bits (392), Expect = 2e-39
 Identities = 76/84 (90%), Positives = 80/84 (95%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLD+ G GERNVLIFDLGGGTF
Sbjct: 146 VPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDRTGKGERNVLIFDLGGGTF 205

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVSILTI+DGIFEVK+TAGDTH G
Sbjct: 206 DVSILTIDDGIFEVKATAGDTHLG 229



 Score =  145 bits (352), Expect = 1e-34
 Identities = 64/87 (73%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRKF D  VQ+DMKHWPF+V++DG KPK++V+YKGE K F+PEE+S
Sbjct: 61  LNPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEEIS 120

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKE AEAYLG  V NAVIT P
Sbjct: 121 SMVLTKMKEIAEAYLGYPVTNAVITVP 147



 Score =  125 bits (302), Expect = 2e-28
 Identities = 59/63 (93%), Positives = 60/63 (95%)
 Frame = +3

Query: 75  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 254
           MAKA A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 255 *TP 263
             P
Sbjct: 61  LNP 63


>DQ388429-1|ABD48956.1|  641|Homo sapiens heat shock 70kDa protein
           1B protein.
          Length = 641

 Score =  161 bits (392), Expect = 2e-39
 Identities = 76/84 (90%), Positives = 80/84 (95%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLD+ G GERNVLIFDLGGGTF
Sbjct: 146 VPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDRTGKGERNVLIFDLGGGTF 205

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVSILTI+DGIFEVK+TAGDTH G
Sbjct: 206 DVSILTIDDGIFEVKATAGDTHLG 229



 Score =  145 bits (352), Expect = 1e-34
 Identities = 64/87 (73%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRKF D  VQ+DMKHWPF+V++DG KPK++V+YKGE K F+PEE+S
Sbjct: 61  LNPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEEIS 120

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKE AEAYLG  V NAVIT P
Sbjct: 121 SMVLTKMKEIAEAYLGYPVTNAVITVP 147



 Score =  125 bits (302), Expect = 2e-28
 Identities = 59/63 (93%), Positives = 60/63 (95%)
 Frame = +3

Query: 75  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 254
           MAKA A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 255 *TP 263
             P
Sbjct: 61  LNP 63


>BC063507-1|AAH63507.1|  641|Homo sapiens heat shock 70kDa protein
           1B protein.
          Length = 641

 Score =  161 bits (392), Expect = 2e-39
 Identities = 76/84 (90%), Positives = 80/84 (95%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLD+ G GERNVLIFDLGGGTF
Sbjct: 146 VPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDRTGKGERNVLIFDLGGGTF 205

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVSILTI+DGIFEVK+TAGDTH G
Sbjct: 206 DVSILTIDDGIFEVKATAGDTHLG 229



 Score =  145 bits (352), Expect = 1e-34
 Identities = 64/87 (73%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRKF D  VQ+DMKHWPF+V++DG KPK++V+YKGE K F+PEE+S
Sbjct: 61  LNPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEEIS 120

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKE AEAYLG  V NAVIT P
Sbjct: 121 SMVLTKMKEIAEAYLGYPVTNAVITVP 147



 Score =  125 bits (302), Expect = 2e-28
 Identities = 59/63 (93%), Positives = 60/63 (95%)
 Frame = +3

Query: 75  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 254
           MAKA A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 255 *TP 263
             P
Sbjct: 61  LNP 63


>BC057397-1|AAH57397.1|  641|Homo sapiens heat shock 70kDa protein
           1B protein.
          Length = 641

 Score =  161 bits (392), Expect = 2e-39
 Identities = 76/84 (90%), Positives = 80/84 (95%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLD+ G GERNVLIFDLGGGTF
Sbjct: 146 VPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDRTGKGERNVLIFDLGGGTF 205

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVSILTI+DGIFEVK+TAGDTH G
Sbjct: 206 DVSILTIDDGIFEVKATAGDTHLG 229



 Score =  145 bits (352), Expect = 1e-34
 Identities = 64/87 (73%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRKF D  VQ+DMKHWPF+V++DG KPK++V+YKGE K F+PEE+S
Sbjct: 61  LNPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEEIS 120

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKE AEAYLG  V NAVIT P
Sbjct: 121 SMVLTKMKEIAEAYLGYPVTNAVITVP 147



 Score =  125 bits (302), Expect = 2e-28
 Identities = 59/63 (93%), Positives = 60/63 (95%)
 Frame = +3

Query: 75  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 254
           MAKA A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 255 *TP 263
             P
Sbjct: 61  LNP 63


>BC018740-1|AAH18740.1|  641|Homo sapiens HSPA1A protein protein.
          Length = 641

 Score =  161 bits (392), Expect = 2e-39
 Identities = 76/84 (90%), Positives = 80/84 (95%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLD+ G GERNVLIFDLGGGTF
Sbjct: 146 VPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDRTGKGERNVLIFDLGGGTF 205

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVSILTI+DGIFEVK+TAGDTH G
Sbjct: 206 DVSILTIDDGIFEVKATAGDTHLG 229



 Score =  145 bits (352), Expect = 1e-34
 Identities = 64/87 (73%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRKF D  VQ+DMKHWPF+V++DG KPK++V+YKGE K F+PEE+S
Sbjct: 61  LNPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEEIS 120

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKE AEAYLG  V NAVIT P
Sbjct: 121 SMVLTKMKEIAEAYLGYPVTNAVITVP 147



 Score =  125 bits (302), Expect = 2e-28
 Identities = 59/63 (93%), Positives = 60/63 (95%)
 Frame = +3

Query: 75  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 254
           MAKA A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 255 *TP 263
             P
Sbjct: 61  LNP 63


>BC009322-1|AAH09322.1|  641|Homo sapiens HSPA1A protein protein.
          Length = 641

 Score =  161 bits (392), Expect = 2e-39
 Identities = 76/84 (90%), Positives = 80/84 (95%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLD+ G GERNVLIFDLGGGTF
Sbjct: 146 VPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDRTGKGERNVLIFDLGGGTF 205

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVSILTI+DGIFEVK+TAGDTH G
Sbjct: 206 DVSILTIDDGIFEVKATAGDTHLG 229



 Score =  145 bits (352), Expect = 1e-34
 Identities = 64/87 (73%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRKF D  VQ+DMKHWPF+V++DG KPK++V+YKGE K F+PEE+S
Sbjct: 61  LNPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEEIS 120

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKE AEAYLG  V NAVIT P
Sbjct: 121 SMVLTKMKEIAEAYLGYPVTNAVITVP 147



 Score =  125 bits (302), Expect = 2e-28
 Identities = 59/63 (93%), Positives = 60/63 (95%)
 Frame = +3

Query: 75  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 254
           MAKA A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 255 *TP 263
             P
Sbjct: 61  LNP 63


>BC002453-1|AAH02453.1|  641|Homo sapiens heat shock 70kDa protein
           1A protein.
          Length = 641

 Score =  161 bits (392), Expect = 2e-39
 Identities = 76/84 (90%), Positives = 80/84 (95%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLD+ G GERNVLIFDLGGGTF
Sbjct: 146 VPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDRTGKGERNVLIFDLGGGTF 205

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVSILTI+DGIFEVK+TAGDTH G
Sbjct: 206 DVSILTIDDGIFEVKATAGDTHLG 229



 Score =  145 bits (352), Expect = 1e-34
 Identities = 64/87 (73%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRKF D  VQ+DMKHWPF+V++DG KPK++V+YKGE K F+PEE+S
Sbjct: 61  LNPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEEIS 120

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKE AEAYLG  V NAVIT P
Sbjct: 121 SMVLTKMKEIAEAYLGYPVTNAVITVP 147



 Score =  125 bits (302), Expect = 2e-28
 Identities = 59/63 (93%), Positives = 60/63 (95%)
 Frame = +3

Query: 75  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 254
           MAKA A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 255 *TP 263
             P
Sbjct: 61  LNP 63


>BA000025-9|BAB63300.1|  641|Homo sapiens heat shock protein
           protein.
          Length = 641

 Score =  161 bits (392), Expect = 2e-39
 Identities = 76/84 (90%), Positives = 80/84 (95%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLD+ G GERNVLIFDLGGGTF
Sbjct: 146 VPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDRTGKGERNVLIFDLGGGTF 205

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVSILTI+DGIFEVK+TAGDTH G
Sbjct: 206 DVSILTIDDGIFEVKATAGDTHLG 229



 Score =  145 bits (352), Expect = 1e-34
 Identities = 64/87 (73%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRKF D  VQ+DMKHWPF+V++DG KPK++V+YKGE K F+PEE+S
Sbjct: 61  LNPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEEIS 120

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKE AEAYLG  V NAVIT P
Sbjct: 121 SMVLTKMKEIAEAYLGYPVTNAVITVP 147



 Score =  125 bits (302), Expect = 2e-28
 Identities = 59/63 (93%), Positives = 60/63 (95%)
 Frame = +3

Query: 75  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 254
           MAKA A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 255 *TP 263
             P
Sbjct: 61  LNP 63


>BA000025-8|BAB63299.1|  641|Homo sapiens heat shock protein
           protein.
          Length = 641

 Score =  161 bits (392), Expect = 2e-39
 Identities = 76/84 (90%), Positives = 80/84 (95%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLD+ G GERNVLIFDLGGGTF
Sbjct: 146 VPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDRTGKGERNVLIFDLGGGTF 205

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVSILTI+DGIFEVK+TAGDTH G
Sbjct: 206 DVSILTIDDGIFEVKATAGDTHLG 229



 Score =  145 bits (352), Expect = 1e-34
 Identities = 64/87 (73%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRKF D  VQ+DMKHWPF+V++DG KPK++V+YKGE K F+PEE+S
Sbjct: 61  LNPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEEIS 120

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKE AEAYLG  V NAVIT P
Sbjct: 121 SMVLTKMKEIAEAYLGYPVTNAVITVP 147



 Score =  125 bits (302), Expect = 2e-28
 Identities = 59/63 (93%), Positives = 60/63 (95%)
 Frame = +3

Query: 75  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 254
           MAKA A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 255 *TP 263
             P
Sbjct: 61  LNP 63


>AL929592-7|CAI18466.1|  641|Homo sapiens heat shock 70kDa protein
           1B protein.
          Length = 641

 Score =  161 bits (392), Expect = 2e-39
 Identities = 76/84 (90%), Positives = 80/84 (95%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLD+ G GERNVLIFDLGGGTF
Sbjct: 146 VPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDRTGKGERNVLIFDLGGGTF 205

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVSILTI+DGIFEVK+TAGDTH G
Sbjct: 206 DVSILTIDDGIFEVKATAGDTHLG 229



 Score =  145 bits (352), Expect = 1e-34
 Identities = 64/87 (73%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRKF D  VQ+DMKHWPF+V++DG KPK++V+YKGE K F+PEE+S
Sbjct: 61  LNPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEEIS 120

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKE AEAYLG  V NAVIT P
Sbjct: 121 SMVLTKMKEIAEAYLGYPVTNAVITVP 147



 Score =  125 bits (302), Expect = 2e-28
 Identities = 59/63 (93%), Positives = 60/63 (95%)
 Frame = +3

Query: 75  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 254
           MAKA A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 255 *TP 263
             P
Sbjct: 61  LNP 63


>AL929592-5|CAI18464.1|  641|Homo sapiens heat shock 70kDa protein
           1A protein.
          Length = 641

 Score =  161 bits (392), Expect = 2e-39
 Identities = 76/84 (90%), Positives = 80/84 (95%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLD+ G GERNVLIFDLGGGTF
Sbjct: 146 VPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDRTGKGERNVLIFDLGGGTF 205

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVSILTI+DGIFEVK+TAGDTH G
Sbjct: 206 DVSILTIDDGIFEVKATAGDTHLG 229



 Score =  144 bits (349), Expect = 3e-34
 Identities = 63/87 (72%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRKF D  VQ+DMKHWPF+V++DG KPK++V+YKG+ K F+PEE+S
Sbjct: 61  LNPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGDTKAFYPEEIS 120

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKE AEAYLG  V NAVIT P
Sbjct: 121 SMVLTKMKEIAEAYLGYPVTNAVITVP 147



 Score =  125 bits (302), Expect = 2e-28
 Identities = 59/63 (93%), Positives = 60/63 (95%)
 Frame = +3

Query: 75  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 254
           MAKA A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 255 *TP 263
             P
Sbjct: 61  LNP 63


>AL671762-7|CAI18217.1|  641|Homo sapiens heat shock 70kDa protein
           1B protein.
          Length = 641

 Score =  161 bits (392), Expect = 2e-39
 Identities = 76/84 (90%), Positives = 80/84 (95%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLD+ G GERNVLIFDLGGGTF
Sbjct: 146 VPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDRTGKGERNVLIFDLGGGTF 205

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVSILTI+DGIFEVK+TAGDTH G
Sbjct: 206 DVSILTIDDGIFEVKATAGDTHLG 229



 Score =  145 bits (352), Expect = 1e-34
 Identities = 64/87 (73%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRKF D  VQ+DMKHWPF+V++DG KPK++V+YKGE K F+PEE+S
Sbjct: 61  LNPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEEIS 120

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKE AEAYLG  V NAVIT P
Sbjct: 121 SMVLTKMKEIAEAYLGYPVTNAVITVP 147



 Score =  125 bits (302), Expect = 2e-28
 Identities = 59/63 (93%), Positives = 60/63 (95%)
 Frame = +3

Query: 75  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 254
           MAKA A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 255 *TP 263
             P
Sbjct: 61  LNP 63


>AL671762-6|CAI18216.1|  641|Homo sapiens heat shock 70kDa protein
           1A protein.
          Length = 641

 Score =  161 bits (392), Expect = 2e-39
 Identities = 76/84 (90%), Positives = 80/84 (95%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLD+ G GERNVLIFDLGGGTF
Sbjct: 146 VPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDRTGKGERNVLIFDLGGGTF 205

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVSILTI+DGIFEVK+TAGDTH G
Sbjct: 206 DVSILTIDDGIFEVKATAGDTHLG 229



 Score =  145 bits (352), Expect = 1e-34
 Identities = 64/87 (73%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRKF D  VQ+DMKHWPF+V++DG KPK++V+YKGE K F+PEE+S
Sbjct: 61  LNPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEEIS 120

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKE AEAYLG  V NAVIT P
Sbjct: 121 SMVLTKMKEIAEAYLGYPVTNAVITVP 147



 Score =  125 bits (302), Expect = 2e-28
 Identities = 59/63 (93%), Positives = 60/63 (95%)
 Frame = +3

Query: 75  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 254
           MAKA A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 255 *TP 263
             P
Sbjct: 61  LNP 63


>AL662834-18|CAI17738.1|  641|Homo sapiens heat shock 70kDa protein
           1B protein.
          Length = 641

 Score =  161 bits (392), Expect = 2e-39
 Identities = 76/84 (90%), Positives = 80/84 (95%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLD+ G GERNVLIFDLGGGTF
Sbjct: 146 VPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDRTGKGERNVLIFDLGGGTF 205

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVSILTI+DGIFEVK+TAGDTH G
Sbjct: 206 DVSILTIDDGIFEVKATAGDTHLG 229



 Score =  145 bits (352), Expect = 1e-34
 Identities = 64/87 (73%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRKF D  VQ+DMKHWPF+V++DG KPK++V+YKGE K F+PEE+S
Sbjct: 61  LNPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEEIS 120

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKE AEAYLG  V NAVIT P
Sbjct: 121 SMVLTKMKEIAEAYLGYPVTNAVITVP 147



 Score =  125 bits (302), Expect = 2e-28
 Identities = 59/63 (93%), Positives = 60/63 (95%)
 Frame = +3

Query: 75  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 254
           MAKA A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 255 *TP 263
             P
Sbjct: 61  LNP 63


>AL662834-17|CAI17737.1|  641|Homo sapiens heat shock 70kDa protein
           1A protein.
          Length = 641

 Score =  161 bits (392), Expect = 2e-39
 Identities = 76/84 (90%), Positives = 80/84 (95%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLD+ G GERNVLIFDLGGGTF
Sbjct: 146 VPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDRTGKGERNVLIFDLGGGTF 205

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVSILTI+DGIFEVK+TAGDTH G
Sbjct: 206 DVSILTIDDGIFEVKATAGDTHLG 229



 Score =  145 bits (352), Expect = 1e-34
 Identities = 64/87 (73%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRKF D  VQ+DMKHWPF+V++DG KPK++V+YKGE K F+PEE+S
Sbjct: 61  LNPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEEIS 120

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKE AEAYLG  V NAVIT P
Sbjct: 121 SMVLTKMKEIAEAYLGYPVTNAVITVP 147



 Score =  125 bits (302), Expect = 2e-28
 Identities = 59/63 (93%), Positives = 60/63 (95%)
 Frame = +3

Query: 75  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 254
           MAKA A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 255 *TP 263
             P
Sbjct: 61  LNP 63


>AK222785-1|BAD96505.1|  646|Homo sapiens heat shock 70kDa protein 8
           isoform 1 variant protein.
          Length = 646

 Score =  161 bits (392), Expect = 2e-39
 Identities = 78/84 (92%), Positives = 80/84 (95%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAGTI+GLNVLRIINEPTAAAIAYGLD+K   ERNVLIFDLGGGTF
Sbjct: 146 VPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDEKVGAERNVLIFDLGGGTF 205

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVSILTIEDGIFEVKSTAGDTH G
Sbjct: 206 DVSILTIEDGIFEVKSTAGDTHLG 229



 Score =  151 bits (365), Expect = 4e-36
 Identities = 66/87 (75%), Positives = 78/87 (89%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGR+F+DA VQ+DMKHWPF VV+D G+PK++V YKGE K+F+PEEVS
Sbjct: 61  MNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVS 120

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKE AEAYLGKTV NAV+T P
Sbjct: 121 SMVLTKMKEIAEAYLGKTVTNAVVTVP 147



 Score =  128 bits (309), Expect = 2e-29
 Identities = 60/64 (93%), Positives = 61/64 (95%)
 Frame = +3

Query: 75  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 254
           M+K PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 255 *TPT 266
             PT
Sbjct: 61  MNPT 64


>AF134726-7|AAD21816.1|  641|Homo sapiens HSP70-1 protein.
          Length = 641

 Score =  161 bits (392), Expect = 2e-39
 Identities = 76/84 (90%), Positives = 80/84 (95%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLD+ G GERNVLIFDLGGGTF
Sbjct: 146 VPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDRTGKGERNVLIFDLGGGTF 205

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVSILTI+DGIFEVK+TAGDTH G
Sbjct: 206 DVSILTIDDGIFEVKATAGDTHLG 229



 Score =  144 bits (349), Expect = 3e-34
 Identities = 63/87 (72%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRKF D  VQ+DMKHWPF+V++DG KPK++V+YKG+ K F+PEE+S
Sbjct: 61  LNPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGDTKAFYPEEIS 120

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKE AEAYLG  V NAVIT P
Sbjct: 121 SMVLTKMKEIAEAYLGYPVTNAVITVP 147



 Score =  125 bits (302), Expect = 2e-28
 Identities = 59/63 (93%), Positives = 60/63 (95%)
 Frame = +3

Query: 75  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 254
           MAKA A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 255 *TP 263
             P
Sbjct: 61  LNP 63


>AF134726-6|AAD21815.1|  641|Homo sapiens HSP70-2 protein.
          Length = 641

 Score =  161 bits (392), Expect = 2e-39
 Identities = 76/84 (90%), Positives = 80/84 (95%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLD+ G GERNVLIFDLGGGTF
Sbjct: 146 VPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDRTGKGERNVLIFDLGGGTF 205

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVSILTI+DGIFEVK+TAGDTH G
Sbjct: 206 DVSILTIDDGIFEVKATAGDTHLG 229



 Score =  145 bits (352), Expect = 1e-34
 Identities = 64/87 (73%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRKF D  VQ+DMKHWPF+V++DG KPK++V+YKGE K F+PEE+S
Sbjct: 61  LNPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEEIS 120

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKE AEAYLG  V NAVIT P
Sbjct: 121 SMVLTKMKEIAEAYLGYPVTNAVITVP 147



 Score =  125 bits (302), Expect = 2e-28
 Identities = 59/63 (93%), Positives = 60/63 (95%)
 Frame = +3

Query: 75  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 254
           MAKA A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 255 *TP 263
             P
Sbjct: 61  LNP 63


>AB209818-1|BAD93055.1|  709|Homo sapiens heat shock 70kDa protein
           1A variant protein.
          Length = 709

 Score =  161 bits (392), Expect = 2e-39
 Identities = 76/84 (90%), Positives = 80/84 (95%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLD+ G GERNVLIFDLGGGTF
Sbjct: 214 VPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDRTGKGERNVLIFDLGGGTF 273

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVSILTI+DGIFEVK+TAGDTH G
Sbjct: 274 DVSILTIDDGIFEVKATAGDTHLG 297



 Score =  144 bits (349), Expect = 3e-34
 Identities = 63/87 (72%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRKF D  VQ+DMKHWPF+V++DG KPK++V+YKG+ K F+PEE+S
Sbjct: 129 LNPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGDTKAFYPEEIS 188

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKE AEAYLG  V NAVIT P
Sbjct: 189 SMVLTKMKEIAEAYLGYPVTNAVITVP 215



 Score =  125 bits (302), Expect = 2e-28
 Identities = 59/63 (93%), Positives = 60/63 (95%)
 Frame = +3

Query: 75  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 254
           MAKA A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 69  MAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 128

Query: 255 *TP 263
             P
Sbjct: 129 LNP 131


>AB018045-1|BAA77235.1|  151|Homo sapiens heat shock protein 72
           protein.
          Length = 151

 Score =  161 bits (392), Expect = 2e-39
 Identities = 76/84 (90%), Positives = 80/84 (95%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLD+ G GERNVLIFDLGGGTF
Sbjct: 60  VPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDRTGKGERNVLIFDLGGGTF 119

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVSILTI+DGIFEVK+TAGDTH G
Sbjct: 120 DVSILTIDDGIFEVKATAGDTHLG 143



 Score =  104 bits (249), Expect = 4e-22
 Identities = 45/61 (73%), Positives = 53/61 (86%)
 Frame = +2

Query: 332 MKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITF 511
           MKHWPF+V++DG KPK++V+YKGE K F+PEE+SSMVLTKMKE AEAYLG  V NAVIT 
Sbjct: 1   MKHWPFQVINDGDKPKVQVSYKGETKAFYPEEISSMVLTKMKEIAEAYLGYPVTNAVITV 60

Query: 512 P 514
           P
Sbjct: 61  P 61


>M59829-1|AAA63228.1|  641|Homo sapiens heat shock-induced protein
           protein.
          Length = 641

 Score =  160 bits (389), Expect = 4e-39
 Identities = 76/84 (90%), Positives = 80/84 (95%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDK G GER+VLIFDLGGGTF
Sbjct: 148 VPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKGGQGERHVLIFDLGGGTF 207

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVSILTI+DGIFEVK+TAGDTH G
Sbjct: 208 DVSILTIDDGIFEVKATAGDTHLG 231



 Score =  144 bits (348), Expect = 4e-34
 Identities = 63/87 (72%), Positives = 76/87 (87%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRKF D  VQADMK WPF+V+++GGKPK+ V+YKGE+K F+PEE+S
Sbjct: 63  MNPQNTVFDAKRLIGRKFNDPVVQADMKLWPFQVINEGGKPKVLVSYKGENKAFYPEEIS 122

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTK+KETAEA+LG  V NAVIT P
Sbjct: 123 SMVLTKLKETAEAFLGHPVTNAVITVP 149



 Score =  121 bits (291), Expect = 3e-27
 Identities = 57/62 (91%), Positives = 58/62 (93%)
 Frame = +3

Query: 78  AKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA* 257
           AK  A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 
Sbjct: 4   AKGIAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM 63

Query: 258 TP 263
            P
Sbjct: 64  NP 65


>D85730-1|BAA32521.1|  641|Homo sapiens Heat shock protein 70 testis
           variant protein.
          Length = 641

 Score =  160 bits (389), Expect = 4e-39
 Identities = 76/84 (90%), Positives = 80/84 (95%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDK G GER+VLIFDLGGGTF
Sbjct: 148 VPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKGGQGERHVLIFDLGGGTF 207

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVSILTI+DGIFEVK+TAGDTH G
Sbjct: 208 DVSILTIDDGIFEVKATAGDTHLG 231



 Score =  144 bits (348), Expect = 4e-34
 Identities = 63/87 (72%), Positives = 76/87 (87%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRKF D  VQADMK WPF+V+++GGKPK+ V+YKGE+K F+PEE+S
Sbjct: 63  MNPQNTVFDAKRLIGRKFNDPVVQADMKLWPFQVINEGGKPKVLVSYKGENKAFYPEEIS 122

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTK+KETAEA+LG  V NAVIT P
Sbjct: 123 SMVLTKLKETAEAFLGHPVTNAVITVP 149



 Score =  121 bits (291), Expect = 3e-27
 Identities = 57/62 (91%), Positives = 58/62 (93%)
 Frame = +3

Query: 78  AKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA* 257
           AK  A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 
Sbjct: 4   AKGIAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM 63

Query: 258 TP 263
            P
Sbjct: 64  NP 65


>DQ383515-1|ABC88476.1|  641|Homo sapiens heat shock 70kDa protein
           1-like protein.
          Length = 641

 Score =  160 bits (389), Expect = 4e-39
 Identities = 76/84 (90%), Positives = 80/84 (95%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDK G GER+VLIFDLGGGTF
Sbjct: 148 VPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKGGQGERHVLIFDLGGGTF 207

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVSILTI+DGIFEVK+TAGDTH G
Sbjct: 208 DVSILTIDDGIFEVKATAGDTHLG 231



 Score =  144 bits (348), Expect = 4e-34
 Identities = 63/87 (72%), Positives = 76/87 (87%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRKF D  VQADMK WPF+V+++GGKPK+ V+YKGE+K F+PEE+S
Sbjct: 63  MNPQNTVFDAKRLIGRKFNDPVVQADMKLWPFQVINEGGKPKVLVSYKGENKAFYPEEIS 122

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTK+KETAEA+LG  V NAVIT P
Sbjct: 123 SMVLTKLKETAEAFLGHPVTNAVITVP 149



 Score =  121 bits (291), Expect = 3e-27
 Identities = 57/62 (91%), Positives = 58/62 (93%)
 Frame = +3

Query: 78  AKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA* 257
           AK  A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 
Sbjct: 4   AKGIAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM 63

Query: 258 TP 263
            P
Sbjct: 64  NP 65


>BC034483-1|AAH34483.1|  641|Homo sapiens heat shock 70kDa protein
           1-like protein.
          Length = 641

 Score =  160 bits (389), Expect = 4e-39
 Identities = 76/84 (90%), Positives = 80/84 (95%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDK G GER+VLIFDLGGGTF
Sbjct: 148 VPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKGGQGERHVLIFDLGGGTF 207

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVSILTI+DGIFEVK+TAGDTH G
Sbjct: 208 DVSILTIDDGIFEVKATAGDTHLG 231



 Score =  144 bits (348), Expect = 4e-34
 Identities = 63/87 (72%), Positives = 76/87 (87%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRKF D  VQADMK WPF+V+++GGKPK+ V+YKGE+K F+PEE+S
Sbjct: 63  MNPQNTVFDAKRLIGRKFNDPVVQADMKLWPFQVINEGGKPKVLVSYKGENKAFYPEEIS 122

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTK+KETAEA+LG  V NAVIT P
Sbjct: 123 SMVLTKLKETAEAFLGHPVTNAVITVP 149



 Score =  121 bits (291), Expect = 3e-27
 Identities = 57/62 (91%), Positives = 58/62 (93%)
 Frame = +3

Query: 78  AKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA* 257
           AK  A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 
Sbjct: 4   AKGIAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM 63

Query: 258 TP 263
            P
Sbjct: 64  NP 65


>BA000025-10|BAB63301.1|  641|Homo sapiens heat shock protein
           protein.
          Length = 641

 Score =  160 bits (389), Expect = 4e-39
 Identities = 76/84 (90%), Positives = 80/84 (95%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDK G GER+VLIFDLGGGTF
Sbjct: 148 VPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKGGQGERHVLIFDLGGGTF 207

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVSILTI+DGIFEVK+TAGDTH G
Sbjct: 208 DVSILTIDDGIFEVKATAGDTHLG 231



 Score =  144 bits (348), Expect = 4e-34
 Identities = 63/87 (72%), Positives = 76/87 (87%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRKF D  VQADMK WPF+V+++GGKPK+ V+YKGE+K F+PEE+S
Sbjct: 63  MNPQNTVFDAKRLIGRKFNDPVVQADMKLWPFQVINEGGKPKVLVSYKGENKAFYPEEIS 122

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTK+KETAEA+LG  V NAVIT P
Sbjct: 123 SMVLTKLKETAEAFLGHPVTNAVITVP 149



 Score =  121 bits (291), Expect = 3e-27
 Identities = 57/62 (91%), Positives = 58/62 (93%)
 Frame = +3

Query: 78  AKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA* 257
           AK  A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 
Sbjct: 4   AKGIAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM 63

Query: 258 TP 263
            P
Sbjct: 64  NP 65


>AL929592-4|CAI18463.1|  641|Homo sapiens heat shock 70kDa protein
           1-like protein.
          Length = 641

 Score =  160 bits (389), Expect = 4e-39
 Identities = 76/84 (90%), Positives = 80/84 (95%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDK G GER+VLIFDLGGGTF
Sbjct: 148 VPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKGGQGERHVLIFDLGGGTF 207

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVSILTI+DGIFEVK+TAGDTH G
Sbjct: 208 DVSILTIDDGIFEVKATAGDTHLG 231



 Score =  144 bits (348), Expect = 4e-34
 Identities = 63/87 (72%), Positives = 76/87 (87%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRKF D  VQADMK WPF+V+++GGKPK+ V+YKGE+K F+PEE+S
Sbjct: 63  MNPQNTVFDAKRLIGRKFNDPVVQADMKLWPFQVINEGGKPKVLVSYKGENKAFYPEEIS 122

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTK+KETAEA+LG  V NAVIT P
Sbjct: 123 SMVLTKLKETAEAFLGHPVTNAVITVP 149



 Score =  121 bits (291), Expect = 3e-27
 Identities = 57/62 (91%), Positives = 58/62 (93%)
 Frame = +3

Query: 78  AKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA* 257
           AK  A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 
Sbjct: 4   AKGIAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM 63

Query: 258 TP 263
            P
Sbjct: 64  NP 65


>AL671762-4|CAI18215.1|  641|Homo sapiens heat shock 70kDa protein
           1-like protein.
          Length = 641

 Score =  160 bits (389), Expect = 4e-39
 Identities = 76/84 (90%), Positives = 80/84 (95%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDK G GER+VLIFDLGGGTF
Sbjct: 148 VPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKGGQGERHVLIFDLGGGTF 207

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVSILTI+DGIFEVK+TAGDTH G
Sbjct: 208 DVSILTIDDGIFEVKATAGDTHLG 231



 Score =  144 bits (348), Expect = 4e-34
 Identities = 63/87 (72%), Positives = 76/87 (87%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRKF D  VQADMK WPF+V+++GGKPK+ V+YKGE+K F+PEE+S
Sbjct: 63  MNPQNTVFDAKRLIGRKFNDPVVQADMKLWPFQVINEGGKPKVLVSYKGENKAFYPEEIS 122

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTK+KETAEA+LG  V NAVIT P
Sbjct: 123 SMVLTKLKETAEAFLGHPVTNAVITVP 149



 Score =  121 bits (291), Expect = 3e-27
 Identities = 57/62 (91%), Positives = 58/62 (93%)
 Frame = +3

Query: 78  AKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA* 257
           AK  A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 
Sbjct: 4   AKGIAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM 63

Query: 258 TP 263
            P
Sbjct: 64  NP 65


>AL662834-15|CAI17736.1|  641|Homo sapiens heat shock 70kDa protein
           1-like protein.
          Length = 641

 Score =  160 bits (389), Expect = 4e-39
 Identities = 76/84 (90%), Positives = 80/84 (95%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDK G GER+VLIFDLGGGTF
Sbjct: 148 VPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKGGQGERHVLIFDLGGGTF 207

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVSILTI+DGIFEVK+TAGDTH G
Sbjct: 208 DVSILTIDDGIFEVKATAGDTHLG 231



 Score =  144 bits (348), Expect = 4e-34
 Identities = 63/87 (72%), Positives = 76/87 (87%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRKF D  VQADMK WPF+V+++GGKPK+ V+YKGE+K F+PEE+S
Sbjct: 63  MNPQNTVFDAKRLIGRKFNDPVVQADMKLWPFQVINEGGKPKVLVSYKGENKAFYPEEIS 122

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTK+KETAEA+LG  V NAVIT P
Sbjct: 123 SMVLTKLKETAEAFLGHPVTNAVITVP 149



 Score =  121 bits (291), Expect = 3e-27
 Identities = 57/62 (91%), Positives = 58/62 (93%)
 Frame = +3

Query: 78  AKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA* 257
           AK  A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 
Sbjct: 4   AKGIAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM 63

Query: 258 TP 263
            P
Sbjct: 64  NP 65


>AK223386-1|BAD97106.1|  641|Homo sapiens heat shock 70kDa protein
           1-like variant protein.
          Length = 641

 Score =  160 bits (389), Expect = 4e-39
 Identities = 76/84 (90%), Positives = 80/84 (95%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDK G GER+VLIFDLGGGTF
Sbjct: 148 VPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKGGQGERHVLIFDLGGGTF 207

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVSILTI+DGIFEVK+TAGDTH G
Sbjct: 208 DVSILTIDDGIFEVKATAGDTHLG 231



 Score =  144 bits (348), Expect = 4e-34
 Identities = 63/87 (72%), Positives = 76/87 (87%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRKF D  VQADMK WPF+V+++GGKPK+ V+YKGE+K F+PEE+S
Sbjct: 63  MNPQNTVFDAKRLIGRKFNDPVVQADMKLWPFQVINEGGKPKVLVSYKGENKAFYPEEIS 122

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTK+KETAEA+LG  V NAVIT P
Sbjct: 123 SMVLTKLKETAEAFLGHPVTNAVITVP 149



 Score =  121 bits (291), Expect = 3e-27
 Identities = 57/62 (91%), Positives = 58/62 (93%)
 Frame = +3

Query: 78  AKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA* 257
           AK  A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 
Sbjct: 4   AKGIAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM 63

Query: 258 TP 263
            P
Sbjct: 64  NP 65


>AF134726-8|AAD21817.1|  641|Homo sapiens HSP70-HOM protein.
          Length = 641

 Score =  160 bits (389), Expect = 4e-39
 Identities = 76/84 (90%), Positives = 80/84 (95%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDK G GER+VLIFDLGGGTF
Sbjct: 148 VPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKGGQGERHVLIFDLGGGTF 207

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVSILTI+DGIFEVK+TAGDTH G
Sbjct: 208 DVSILTIDDGIFEVKATAGDTHLG 231



 Score =  144 bits (348), Expect = 4e-34
 Identities = 63/87 (72%), Positives = 76/87 (87%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRKF D  VQADMK WPF+V+++GGKPK+ V+YKGE+K F+PEE+S
Sbjct: 63  MNPQNTVFDAKRLIGRKFNDPVVQADMKLWPFQVINEGGKPKVLVSYKGENKAFYPEEIS 122

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTK+KETAEA+LG  V NAVIT P
Sbjct: 123 SMVLTKLKETAEAFLGHPVTNAVITVP 149



 Score =  121 bits (291), Expect = 3e-27
 Identities = 57/62 (91%), Positives = 58/62 (93%)
 Frame = +3

Query: 78  AKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA* 257
           AK  A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 
Sbjct: 4   AKGIAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM 63

Query: 258 TP 263
            P
Sbjct: 64  NP 65


>X51757-1|CAA36061.1|  643|Homo sapiens protein ( Human heat-shock
           protein HSP70B' gene. ).
          Length = 643

 Score =  157 bits (382), Expect = 3e-38
 Identities = 72/84 (85%), Positives = 80/84 (95%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLD++G GERNVLIFDLGGGTF
Sbjct: 148 VPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDRRGAGERNVLIFDLGGGTF 207

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVS+L+I+ G+FEVK+TAGDTH G
Sbjct: 208 DVSVLSIDAGVFEVKATAGDTHLG 231



 Score =  154 bits (374), Expect = 3e-37
 Identities = 67/87 (77%), Positives = 81/87 (93%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP+NT+FDAKRLIGRKF D TVQ+DMKHWPF VVS+GGKPK+ V+Y+GEDKTF+PEE+S
Sbjct: 63  LNPHNTVFDAKRLIGRKFADTTVQSDMKHWPFRVVSEGGKPKVPVSYRGEDKTFYPEEIS 122

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVL+KMKETAEAYLG+ V++AVIT P
Sbjct: 123 SMVLSKMKETAEAYLGQPVKHAVITVP 149



 Score =  109 bits (263), Expect = 8e-24
 Identities = 50/58 (86%), Positives = 54/58 (93%)
 Frame = +3

Query: 90  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           AVGIDLGTTYSCVGVFQ G+VEI+ANDQGNRTTPSYVAFTDTERL+GDAAK+Q A  P
Sbjct: 8   AVGIDLGTTYSCVGVFQQGRVEILANDQGNRTTPSYVAFTDTERLVGDAAKSQAALNP 65


>DQ521571-1|ABF47108.1|  643|Homo sapiens heat shock 70kDa protein 6
           (HSP70B') protein.
          Length = 643

 Score =  157 bits (382), Expect = 3e-38
 Identities = 72/84 (85%), Positives = 80/84 (95%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLD++G GERNVLIFDLGGGTF
Sbjct: 148 VPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDRRGAGERNVLIFDLGGGTF 207

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVS+L+I+ G+FEVK+TAGDTH G
Sbjct: 208 DVSVLSIDAGVFEVKATAGDTHLG 231



 Score =  155 bits (376), Expect = 2e-37
 Identities = 67/87 (77%), Positives = 81/87 (93%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP+NT+FDAKRLIGRKF D TVQ+DMKHWPF VVS+GGKPK++V Y+GEDKTF+PEE+S
Sbjct: 63  LNPHNTVFDAKRLIGRKFADTTVQSDMKHWPFRVVSEGGKPKVRVCYRGEDKTFYPEEIS 122

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVL+KMKETAEAYLG+ V++AVIT P
Sbjct: 123 SMVLSKMKETAEAYLGQPVKHAVITVP 149



 Score =  109 bits (263), Expect = 8e-24
 Identities = 50/58 (86%), Positives = 54/58 (93%)
 Frame = +3

Query: 90  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           AVGIDLGTTYSCVGVFQ G+VEI+ANDQGNRTTPSYVAFTDTERL+GDAAK+Q A  P
Sbjct: 8   AVGIDLGTTYSCVGVFQQGRVEILANDQGNRTTPSYVAFTDTERLVGDAAKSQAALNP 65


>BC035665-1|AAH35665.1|  643|Homo sapiens heat shock 70kDa protein 6
           (HSP70B') protein.
          Length = 643

 Score =  157 bits (382), Expect = 3e-38
 Identities = 72/84 (85%), Positives = 80/84 (95%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLD++G GERNVLIFDLGGGTF
Sbjct: 148 VPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDRRGAGERNVLIFDLGGGTF 207

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVS+L+I+ G+FEVK+TAGDTH G
Sbjct: 208 DVSVLSIDAGVFEVKATAGDTHLG 231



 Score =  155 bits (376), Expect = 2e-37
 Identities = 67/87 (77%), Positives = 81/87 (93%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP+NT+FDAKRLIGRKF D TVQ+DMKHWPF VVS+GGKPK++V Y+GEDKTF+PEE+S
Sbjct: 63  LNPHNTVFDAKRLIGRKFADTTVQSDMKHWPFRVVSEGGKPKVRVCYRGEDKTFYPEEIS 122

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVL+KMKETAEAYLG+ V++AVIT P
Sbjct: 123 SMVLSKMKETAEAYLGQPVKHAVITVP 149



 Score =  109 bits (263), Expect = 8e-24
 Identities = 50/58 (86%), Positives = 54/58 (93%)
 Frame = +3

Query: 90  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           AVGIDLGTTYSCVGVFQ G+VEI+ANDQGNRTTPSYVAFTDTERL+GDAAK+Q A  P
Sbjct: 8   AVGIDLGTTYSCVGVFQQGRVEILANDQGNRTTPSYVAFTDTERLVGDAAKSQAALNP 65


>AL590385-3|CAI16120.1|  643|Homo sapiens heat shock 70kDa protein 6
           (HSP70B') protein.
          Length = 643

 Score =  157 bits (382), Expect = 3e-38
 Identities = 72/84 (85%), Positives = 80/84 (95%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLD++G GERNVLIFDLGGGTF
Sbjct: 148 VPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDRRGAGERNVLIFDLGGGTF 207

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVS+L+I+ G+FEVK+TAGDTH G
Sbjct: 208 DVSVLSIDAGVFEVKATAGDTHLG 231



 Score =  155 bits (376), Expect = 2e-37
 Identities = 67/87 (77%), Positives = 81/87 (93%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP+NT+FDAKRLIGRKF D TVQ+DMKHWPF VVS+GGKPK++V Y+GEDKTF+PEE+S
Sbjct: 63  LNPHNTVFDAKRLIGRKFADTTVQSDMKHWPFRVVSEGGKPKVRVCYRGEDKTFYPEEIS 122

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVL+KMKETAEAYLG+ V++AVIT P
Sbjct: 123 SMVLSKMKETAEAYLGQPVKHAVITVP 149



 Score =  109 bits (263), Expect = 8e-24
 Identities = 50/58 (86%), Positives = 54/58 (93%)
 Frame = +3

Query: 90  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           AVGIDLGTTYSCVGVFQ G+VEI+ANDQGNRTTPSYVAFTDTERL+GDAAK+Q A  P
Sbjct: 8   AVGIDLGTTYSCVGVFQQGRVEILANDQGNRTTPSYVAFTDTERLVGDAAKSQAALNP 65


>M11236-1|AAA52696.1|  247|Homo sapiens HSPA1L protein.
          Length = 247

 Score =  156 bits (378), Expect = 9e-38
 Identities = 68/87 (78%), Positives = 81/87 (93%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP+NT+FDAKRLIGRKF D TVQ+DMKHWPF+VVS GGKPK++V Y+GEDKTF+PEE+S
Sbjct: 63  LNPHNTVFDAKRLIGRKFADTTVQSDMKHWPFKVVSGGGKPKVRVCYRGEDKTFYPEEIS 122

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLG+ V++AVIT P
Sbjct: 123 SMVLTKMKETAEAYLGQPVKHAVITVP 149



 Score =  140 bits (339), Expect = 5e-33
 Identities = 65/84 (77%), Positives = 75/84 (89%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VP YF++SQRQATKDAG I+GL VL IINE TAAAIAYGLD++  G+RNVLIFDLGGGTF
Sbjct: 148 VPTYFSNSQRQATKDAGAIAGLKVLPIINEATAAAIAYGLDRRRAGKRNVLIFDLGGGTF 207

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVS+LTI+ G+FEVK+TAGDTH G
Sbjct: 208 DVSVLTIDAGVFEVKATAGDTHLG 231



 Score =  111 bits (268), Expect = 2e-24
 Identities = 51/58 (87%), Positives = 54/58 (93%)
 Frame = +3

Query: 90  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           AVGIDLGTTYSCVGVFQ G+VEI+ANDQGNRTTPSYVAFTDTERL+GDAAKNQ A  P
Sbjct: 8   AVGIDLGTTYSCVGVFQQGRVEILANDQGNRTTPSYVAFTDTERLVGDAAKNQAALNP 65


>AK223362-1|BAD97082.1|  643|Homo sapiens heat shock 70kDa protein 6
           (HSP70B') variant protein.
          Length = 643

 Score =  156 bits (378), Expect = 9e-38
 Identities = 71/84 (84%), Positives = 79/84 (94%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLD++G GERNV IFDLGGGTF
Sbjct: 148 VPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDRRGAGERNVFIFDLGGGTF 207

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVS+L+I+ G+FEVK+TAGDTH G
Sbjct: 208 DVSVLSIDAGVFEVKATAGDTHLG 231



 Score =  155 bits (376), Expect = 2e-37
 Identities = 67/87 (77%), Positives = 81/87 (93%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP+NT+FDAKRLIGRKF D TVQ+DMKHWPF VVS+GGKPK++V Y+GEDKTF+PEE+S
Sbjct: 63  LNPHNTVFDAKRLIGRKFADTTVQSDMKHWPFRVVSEGGKPKVRVCYRGEDKTFYPEEIS 122

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVL+KMKETAEAYLG+ V++AVIT P
Sbjct: 123 SMVLSKMKETAEAYLGQPVKHAVITVP 149



 Score =  109 bits (263), Expect = 8e-24
 Identities = 50/58 (86%), Positives = 54/58 (93%)
 Frame = +3

Query: 90  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           AVGIDLGTTYSCVGVFQ G+VEI+ANDQGNRTTPSYVAFTDTERL+GDAAK+Q A  P
Sbjct: 8   AVGIDLGTTYSCVGVFQQGRVEILANDQGNRTTPSYVAFTDTERLVGDAAKSQAALNP 65


>X87949-1|CAA61201.1|  653|Homo sapiens BiP protein.
          Length = 653

 Score =  146 bits (355), Expect = 6e-35
 Identities = 67/84 (79%), Positives = 79/84 (94%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFND+QRQATKDAGTI+GLNV+RIINEPTAAAIAYGLDK+  GE+N+L+FDLGGGTF
Sbjct: 172 VPAYFNDAQRQATKDAGTIAGLNVMRIINEPTAAAIAYGLDKR-EGEKNILVFDLGGGTF 230

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVS+LTI++G+FEV +T GDTH G
Sbjct: 231 DVSLLTIDNGVFEVVATNGDTHLG 254



 Score =  110 bits (264), Expect = 6e-24
 Identities = 55/87 (63%), Positives = 66/87 (75%), Gaps = 1/87 (1%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKG-EDKTFFPEEVS 433
           NP NT+FDAKRLIGR + D +VQ D+K  PF+VV    KP I+V   G + KTF PEE+S
Sbjct: 87  NPENTVFDAKRLIGRTWNDPSVQQDIKFLPFKVVEKKTKPYIQVDIGGGQTKTFAPEEIS 146

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           +MVLTKMKETAEAYLGK V +AV+T P
Sbjct: 147 AMVLTKMKETAEAYLGKKVTHAVVTVP 173



 Score = 97.9 bits (233), Expect = 3e-20
 Identities = 47/58 (81%), Positives = 52/58 (89%), Gaps = 1/58 (1%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVA*TP 263
           VGIDLGTTYSCVGVF++G+VEIIANDQGNR TPSYVAFT + ERLIGDAAKNQ+   P
Sbjct: 31  VGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTPEGERLIGDAAKNQLTSNP 88


>M19645-1|AAA52614.1|  653|Homo sapiens protein ( Human 78 kdalton
           glucose-regulated protein (GRP78) gene, complete cds. ).
          Length = 653

 Score =  146 bits (355), Expect = 6e-35
 Identities = 67/84 (79%), Positives = 79/84 (94%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFND+QRQATKDAGTI+GLNV+RIINEPTAAAIAYGLDK+  GE+N+L+FDLGGGTF
Sbjct: 172 VPAYFNDAQRQATKDAGTIAGLNVMRIINEPTAAAIAYGLDKR-EGEKNILVFDLGGGTF 230

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVS+LTI++G+FEV +T GDTH G
Sbjct: 231 DVSLLTIDNGVFEVVATNGDTHLG 254



 Score =  110 bits (264), Expect = 6e-24
 Identities = 55/87 (63%), Positives = 66/87 (75%), Gaps = 1/87 (1%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKG-EDKTFFPEEVS 433
           NP NT+FDAKRLIGR + D +VQ D+K  PF+VV    KP I+V   G + KTF PEE+S
Sbjct: 87  NPENTVFDAKRLIGRTWNDPSVQQDIKFLPFKVVEKKTKPYIQVDIGGGQTKTFAPEEIS 146

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           +MVLTKMKETAEAYLGK V +AV+T P
Sbjct: 147 AMVLTKMKETAEAYLGKKVTHAVVTVP 173



 Score = 97.9 bits (233), Expect = 3e-20
 Identities = 47/58 (81%), Positives = 52/58 (89%), Gaps = 1/58 (1%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVA*TP 263
           VGIDLGTTYSCVGVF++G+VEIIANDQGNR TPSYVAFT + ERLIGDAAKNQ+   P
Sbjct: 31  VGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTPEGERLIGDAAKNQLTSNP 88


>DQ385847-1|ABD04090.1|  654|Homo sapiens heat shock 70kDa protein 5
           (glucose-regulated protein, 78kDa) protein.
          Length = 654

 Score =  146 bits (355), Expect = 6e-35
 Identities = 67/84 (79%), Positives = 79/84 (94%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFND+QRQATKDAGTI+GLNV+RIINEPTAAAIAYGLDK+  GE+N+L+FDLGGGTF
Sbjct: 172 VPAYFNDAQRQATKDAGTIAGLNVMRIINEPTAAAIAYGLDKR-EGEKNILVFDLGGGTF 230

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVS+LTI++G+FEV +T GDTH G
Sbjct: 231 DVSLLTIDNGVFEVVATNGDTHLG 254



 Score =  110 bits (264), Expect = 6e-24
 Identities = 55/87 (63%), Positives = 66/87 (75%), Gaps = 1/87 (1%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKG-EDKTFFPEEVS 433
           NP NT+FDAKRLIGR + D +VQ D+K  PF+VV    KP I+V   G + KTF PEE+S
Sbjct: 87  NPENTVFDAKRLIGRTWNDPSVQQDIKFLPFKVVEKKTKPYIQVDIGGGQTKTFAPEEIS 146

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           +MVLTKMKETAEAYLGK V +AV+T P
Sbjct: 147 AMVLTKMKETAEAYLGKKVTHAVVTVP 173



 Score = 97.9 bits (233), Expect = 3e-20
 Identities = 47/58 (81%), Positives = 52/58 (89%), Gaps = 1/58 (1%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVA*TP 263
           VGIDLGTTYSCVGVF++G+VEIIANDQGNR TPSYVAFT + ERLIGDAAKNQ+   P
Sbjct: 31  VGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTPEGERLIGDAAKNQLTSNP 88


>BC112963-1|AAI12964.1|  655|Homo sapiens HSPA5 protein protein.
          Length = 655

 Score =  146 bits (355), Expect = 6e-35
 Identities = 67/84 (79%), Positives = 79/84 (94%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFND+QRQATKDAGTI+GLNV+RIINEPTAAAIAYGLDK+  GE+N+L+FDLGGGTF
Sbjct: 173 VPAYFNDAQRQATKDAGTIAGLNVMRIINEPTAAAIAYGLDKR-EGEKNILVFDLGGGTF 231

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVS+LTI++G+FEV +T GDTH G
Sbjct: 232 DVSLLTIDNGVFEVVATNGDTHLG 255



 Score =  110 bits (264), Expect = 6e-24
 Identities = 55/87 (63%), Positives = 66/87 (75%), Gaps = 1/87 (1%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKG-EDKTFFPEEVS 433
           NP NT+FDAKRLIGR + D +VQ D+K  PF+VV    KP I+V   G + KTF PEE+S
Sbjct: 88  NPENTVFDAKRLIGRTWNDPSVQQDIKFLPFKVVEKKTKPYIQVDIGGGQTKTFAPEEIS 147

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           +MVLTKMKETAEAYLGK V +AV+T P
Sbjct: 148 AMVLTKMKETAEAYLGKKVTHAVVTVP 174



 Score = 97.9 bits (233), Expect = 3e-20
 Identities = 47/58 (81%), Positives = 52/58 (89%), Gaps = 1/58 (1%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVA*TP 263
           VGIDLGTTYSCVGVF++G+VEIIANDQGNR TPSYVAFT + ERLIGDAAKNQ+   P
Sbjct: 32  VGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTPEGERLIGDAAKNQLTSNP 89


>BC020235-1|AAH20235.1|  654|Homo sapiens heat shock 70kDa protein 5
           (glucose-regulated protein, 78kDa) protein.
          Length = 654

 Score =  146 bits (355), Expect = 6e-35
 Identities = 67/84 (79%), Positives = 79/84 (94%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFND+QRQATKDAGTI+GLNV+RIINEPTAAAIAYGLDK+  GE+N+L+FDLGGGTF
Sbjct: 172 VPAYFNDAQRQATKDAGTIAGLNVMRIINEPTAAAIAYGLDKR-EGEKNILVFDLGGGTF 230

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVS+LTI++G+FEV +T GDTH G
Sbjct: 231 DVSLLTIDNGVFEVVATNGDTHLG 254



 Score =  110 bits (264), Expect = 6e-24
 Identities = 55/87 (63%), Positives = 66/87 (75%), Gaps = 1/87 (1%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKG-EDKTFFPEEVS 433
           NP NT+FDAKRLIGR + D +VQ D+K  PF+VV    KP I+V   G + KTF PEE+S
Sbjct: 87  NPENTVFDAKRLIGRTWNDPSVQQDIKFLPFKVVEKKTKPYIQVDIGGGQTKTFAPEEIS 146

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           +MVLTKMKETAEAYLGK V +AV+T P
Sbjct: 147 AMVLTKMKETAEAYLGKKVTHAVVTVP 173



 Score = 97.9 bits (233), Expect = 3e-20
 Identities = 47/58 (81%), Positives = 52/58 (89%), Gaps = 1/58 (1%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVA*TP 263
           VGIDLGTTYSCVGVF++G+VEIIANDQGNR TPSYVAFT + ERLIGDAAKNQ+   P
Sbjct: 31  VGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTPEGERLIGDAAKNQLTSNP 88


>AJ271729-1|CAB71335.1|  654|Homo sapiens glucose-regulated protein
           protein.
          Length = 654

 Score =  146 bits (355), Expect = 6e-35
 Identities = 67/84 (79%), Positives = 79/84 (94%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFND+QRQATKDAGTI+GLNV+RIINEPTAAAIAYGLDK+  GE+N+L+FDLGGGTF
Sbjct: 172 VPAYFNDAQRQATKDAGTIAGLNVMRIINEPTAAAIAYGLDKR-EGEKNILVFDLGGGTF 230

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVS+LTI++G+FEV +T GDTH G
Sbjct: 231 DVSLLTIDNGVFEVVATNGDTHLG 254



 Score =  110 bits (264), Expect = 6e-24
 Identities = 55/87 (63%), Positives = 66/87 (75%), Gaps = 1/87 (1%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKG-EDKTFFPEEVS 433
           NP NT+FDAKRLIGR + D +VQ D+K  PF+VV    KP I+V   G + KTF PEE+S
Sbjct: 87  NPENTVFDAKRLIGRTWNDPSVQQDIKFLPFKVVEKKTKPYIQVDIGGGQTKTFAPEEIS 146

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           +MVLTKMKETAEAYLGK V +AV+T P
Sbjct: 147 AMVLTKMKETAEAYLGKKVTHAVVTVP 173



 Score = 97.9 bits (233), Expect = 3e-20
 Identities = 47/58 (81%), Positives = 52/58 (89%), Gaps = 1/58 (1%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVA*TP 263
           VGIDLGTTYSCVGVF++G+VEIIANDQGNR TPSYVAFT + ERLIGDAAKNQ+   P
Sbjct: 31  VGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTPEGERLIGDAAKNQLTSNP 88


>AF216292-1|AAF42836.1|  654|Homo sapiens endoplasmic reticulum
           lumenal Ca2+ binding protein grp78 protein.
          Length = 654

 Score =  146 bits (355), Expect = 6e-35
 Identities = 67/84 (79%), Positives = 79/84 (94%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFND+QRQATKDAGTI+GLNV+RIINEPTAAAIAYGLDK+  GE+N+L+FDLGGGTF
Sbjct: 172 VPAYFNDAQRQATKDAGTIAGLNVMRIINEPTAAAIAYGLDKR-EGEKNILVFDLGGGTF 230

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVS+LTI++G+FEV +T GDTH G
Sbjct: 231 DVSLLTIDNGVFEVVATNGDTHLG 254



 Score =  110 bits (264), Expect = 6e-24
 Identities = 55/87 (63%), Positives = 66/87 (75%), Gaps = 1/87 (1%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKG-EDKTFFPEEVS 433
           NP NT+FDAKRLIGR + D +VQ D+K  PF+VV    KP I+V   G + KTF PEE+S
Sbjct: 87  NPENTVFDAKRLIGRTWNDPSVQQDIKFLPFKVVEKKTKPYIQVDIGGGQTKTFAPEEIS 146

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           +MVLTKMKETAEAYLGK V +AV+T P
Sbjct: 147 AMVLTKMKETAEAYLGKKVTHAVVTVP 173



 Score = 97.9 bits (233), Expect = 3e-20
 Identities = 47/58 (81%), Positives = 52/58 (89%), Gaps = 1/58 (1%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVA*TP 263
           VGIDLGTTYSCVGVF++G+VEIIANDQGNR TPSYVAFT + ERLIGDAAKNQ+   P
Sbjct: 31  VGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTPEGERLIGDAAKNQLTSNP 88


>AF188611-1|AAF13605.1|  639|Homo sapiens BiP protein protein.
          Length = 639

 Score =  146 bits (355), Expect = 6e-35
 Identities = 67/84 (79%), Positives = 79/84 (94%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFND+QRQATKDAGTI+GLNV+RIINEPTAAAIAYGLDK+  GE+N+L+FDLGGGTF
Sbjct: 154 VPAYFNDAQRQATKDAGTIAGLNVMRIINEPTAAAIAYGLDKR-EGEKNILVFDLGGGTF 212

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVS+LTI++G+FEV +T GDTH G
Sbjct: 213 DVSLLTIDNGVFEVVATNGDTHLG 236



 Score =  110 bits (264), Expect = 6e-24
 Identities = 55/87 (63%), Positives = 66/87 (75%), Gaps = 1/87 (1%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKG-EDKTFFPEEVS 433
           NP NT+FDAKRLIGR + D +VQ D+K  PF+VV    KP I+V   G + KTF PEE+S
Sbjct: 69  NPENTVFDAKRLIGRTWNDPSVQQDIKFLPFKVVEKKTKPYIQVDIGGGQTKTFAPEEIS 128

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           +MVLTKMKETAEAYLGK V +AV+T P
Sbjct: 129 AMVLTKMKETAEAYLGKKVTHAVVTVP 155



 Score = 97.9 bits (233), Expect = 3e-20
 Identities = 47/58 (81%), Positives = 52/58 (89%), Gaps = 1/58 (1%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVA*TP 263
           VGIDLGTTYSCVGVF++G+VEIIANDQGNR TPSYVAFT + ERLIGDAAKNQ+   P
Sbjct: 13  VGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTPEGERLIGDAAKNQLTSNP 70


>L15189-1|AAA67526.1|  679|Homo sapiens MTHSP75 protein.
          Length = 679

 Score =  132 bits (318), Expect = 2e-30
 Identities = 62/84 (73%), Positives = 73/84 (86%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG ISGLNVLR+INEPTAAA+AYGLDK  + ++ + ++DLGGGTF
Sbjct: 193 VPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDK--SEDKVIAVYDLGGGTF 250

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           D+SIL I+ G+FEVKST GDT  G
Sbjct: 251 DISILEIQKGVFEVKSTNGDTFLG 274



 Score = 82.6 bits (195), Expect = 1e-15
 Identities = 41/87 (47%), Positives = 57/87 (65%), Gaps = 1/87 (1%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVV-SDGGKPKIKVAYKGEDKTFFPEEVS 433
           NPNNT +  KRLIGR+++D  VQ D+K+ PF++V +  G   +    +   K + P ++ 
Sbjct: 112 NPNNTFYATKRLIGRRYDDPEVQKDIKNVPFKIVRASNGDAWV----EAHGKLYSPSQIG 167

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           + VL KMKETAE YLG T +NAVIT P
Sbjct: 168 AFVLMKMKETAENYLGHTAKNAVITVP 194



 Score = 66.1 bits (154), Expect = 1e-10
 Identities = 35/79 (44%), Positives = 46/79 (58%), Gaps = 1/79 (1%)
 Frame = +3

Query: 42  RTSNKTD*KYKMAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTE 218
           R  ++ D   +  K   VGIDLGTT SCV V +  + +++ N +G RTTPS VAFT D E
Sbjct: 39  RLVSRRDYASEAIKGAVVGIDLGTTNSCVAVMEGKQAKVLENAEGARTTPSVVAFTADGE 98

Query: 219 RLIGDAAKNQVA*TPTTQY 275
           RL+G  AK Q    P   +
Sbjct: 99  RLVGMPAKRQAVTNPNNTF 117


>DQ531046-1|ABF50973.1|  679|Homo sapiens heat shock 70kDa protein
           9B (mortalin-2) protein.
          Length = 679

 Score =  132 bits (318), Expect = 2e-30
 Identities = 62/84 (73%), Positives = 73/84 (86%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG ISGLNVLR+INEPTAAA+AYGLDK  + ++ + ++DLGGGTF
Sbjct: 193 VPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDK--SEDKVIAVYDLGGGTF 250

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           D+SIL I+ G+FEVKST GDT  G
Sbjct: 251 DISILEIQKGVFEVKSTNGDTFLG 274



 Score = 82.6 bits (195), Expect = 1e-15
 Identities = 41/87 (47%), Positives = 57/87 (65%), Gaps = 1/87 (1%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVV-SDGGKPKIKVAYKGEDKTFFPEEVS 433
           NPNNT +  KRLIGR+++D  VQ D+K+ PF++V +  G   +    +   K + P ++ 
Sbjct: 112 NPNNTFYATKRLIGRRYDDPEVQKDIKNVPFKIVRASNGDAWV----EAHGKLYSPSQIG 167

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           + VL KMKETAE YLG T +NAVIT P
Sbjct: 168 AFVLMKMKETAENYLGHTAKNAVITVP 194



 Score = 66.1 bits (154), Expect = 1e-10
 Identities = 35/79 (44%), Positives = 46/79 (58%), Gaps = 1/79 (1%)
 Frame = +3

Query: 42  RTSNKTD*KYKMAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTE 218
           R  ++ D   +  K   VGIDLGTT SCV V +  + +++ N +G RTTPS VAFT D E
Sbjct: 39  RLVSRRDYASEAIKGAVVGIDLGTTNSCVAVMEGKQAKVLENAEGARTTPSVVAFTADGE 98

Query: 219 RLIGDAAKNQVA*TPTTQY 275
           RL+G  AK Q    P   +
Sbjct: 99  RLVGMPAKRQAVTNPNNTF 117


>BC030634-1|AAH30634.1|  681|Homo sapiens HSPA9 protein protein.
          Length = 681

 Score =  132 bits (318), Expect = 2e-30
 Identities = 62/84 (73%), Positives = 73/84 (86%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG ISGLNVLR+INEPTAAA+AYGLDK  + ++ + ++DLGGGTF
Sbjct: 195 VPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDK--SEDKVIAVYDLGGGTF 252

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           D+SIL I+ G+FEVKST GDT  G
Sbjct: 253 DISILEIQKGVFEVKSTNGDTFLG 276



 Score = 83.8 bits (198), Expect = 6e-16
 Identities = 41/87 (47%), Positives = 58/87 (66%), Gaps = 1/87 (1%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVV-SDGGKPKIKVAYKGEDKTFFPEEVS 433
           NPNNT +  KRLIGR+++D  VQ D+K+ PF++V +  G   ++       K + P ++ 
Sbjct: 114 NPNNTFYATKRLIGRRYDDPEVQKDIKNVPFKIVRASNGDAWVEA----HGKLYSPSQIG 169

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           + VL KMKETAE YLG+T +NAVIT P
Sbjct: 170 AFVLMKMKETAENYLGRTAKNAVITVP 196



 Score = 66.5 bits (155), Expect = 1e-10
 Identities = 35/79 (44%), Positives = 46/79 (58%), Gaps = 1/79 (1%)
 Frame = +3

Query: 42  RTSNKTD*KYKMAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTE 218
           R  ++ D   +  K   VGIDLGTT SCV V +  + +++ N +G RTTPS VAFT D E
Sbjct: 41  RLVSRRDYASEAIKGAVVGIDLGTTNSCVAVMEGKRAKVLENAEGARTTPSVVAFTADGE 100

Query: 219 RLIGDAAKNQVA*TPTTQY 275
           RL+G  AK Q    P   +
Sbjct: 101 RLVGMPAKRQAVTNPNNTF 119


>BC024034-1|AAH24034.1|  679|Homo sapiens heat shock 70kDa protein 9
           (mortalin) protein.
          Length = 679

 Score =  132 bits (318), Expect = 2e-30
 Identities = 62/84 (73%), Positives = 73/84 (86%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG ISGLNVLR+INEPTAAA+AYGLDK  + ++ + ++DLGGGTF
Sbjct: 193 VPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDK--SEDKVIAVYDLGGGTF 250

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           D+SIL I+ G+FEVKST GDT  G
Sbjct: 251 DISILEIQKGVFEVKSTNGDTFLG 274



 Score = 83.8 bits (198), Expect = 6e-16
 Identities = 41/87 (47%), Positives = 58/87 (66%), Gaps = 1/87 (1%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVV-SDGGKPKIKVAYKGEDKTFFPEEVS 433
           NPNNT +  KRLIGR+++D  VQ D+K+ PF++V +  G   ++       K + P ++ 
Sbjct: 112 NPNNTFYATKRLIGRRYDDPEVQKDIKNVPFKIVRASNGDAWVEA----HGKLYSPSQIG 167

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           + VL KMKETAE YLG+T +NAVIT P
Sbjct: 168 AFVLMKMKETAENYLGRTAKNAVITVP 194



 Score = 66.5 bits (155), Expect = 1e-10
 Identities = 35/79 (44%), Positives = 46/79 (58%), Gaps = 1/79 (1%)
 Frame = +3

Query: 42  RTSNKTD*KYKMAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTE 218
           R  ++ D   +  K   VGIDLGTT SCV V +  + +++ N +G RTTPS VAFT D E
Sbjct: 39  RLVSRRDYASEAIKGAVVGIDLGTTNSCVAVMEGKRAKVLENAEGARTTPSVVAFTADGE 98

Query: 219 RLIGDAAKNQVA*TPTTQY 275
           RL+G  AK Q    P   +
Sbjct: 99  RLVGMPAKRQAVTNPNNTF 117


>BC000478-1|AAH00478.1|  679|Homo sapiens heat shock 70kDa protein 9
           (mortalin) protein.
          Length = 679

 Score =  132 bits (318), Expect = 2e-30
 Identities = 62/84 (73%), Positives = 73/84 (86%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG ISGLNVLR+INEPTAAA+AYGLDK  + ++ + ++DLGGGTF
Sbjct: 193 VPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDK--SEDKVIAVYDLGGGTF 250

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           D+SIL I+ G+FEVKST GDT  G
Sbjct: 251 DISILEIQKGVFEVKSTNGDTFLG 274



 Score = 83.8 bits (198), Expect = 6e-16
 Identities = 41/87 (47%), Positives = 58/87 (66%), Gaps = 1/87 (1%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVV-SDGGKPKIKVAYKGEDKTFFPEEVS 433
           NPNNT +  KRLIGR+++D  VQ D+K+ PF++V +  G   ++       K + P ++ 
Sbjct: 112 NPNNTFYATKRLIGRRYDDPEVQKDIKNVPFKIVRASNGDAWVEA----HGKLYSPSQIG 167

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           + VL KMKETAE YLG+T +NAVIT P
Sbjct: 168 AFVLMKMKETAENYLGRTAKNAVITVP 194



 Score = 66.5 bits (155), Expect = 1e-10
 Identities = 35/79 (44%), Positives = 46/79 (58%), Gaps = 1/79 (1%)
 Frame = +3

Query: 42  RTSNKTD*KYKMAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTE 218
           R  ++ D   +  K   VGIDLGTT SCV V +  + +++ N +G RTTPS VAFT D E
Sbjct: 39  RLVSRRDYASEAIKGAVVGIDLGTTNSCVAVMEGKRAKVLENAEGARTTPSVVAFTADGE 98

Query: 219 RLIGDAAKNQVA*TPTTQY 275
           RL+G  AK Q    P   +
Sbjct: 99  RLVGMPAKRQAVTNPNNTF 117


>DQ185038-1|ABD14419.1|  176|Homo sapiens heat shock 70 kDa protein
           9B protein.
          Length = 176

 Score =  130 bits (313), Expect = 7e-30
 Identities = 61/84 (72%), Positives = 73/84 (86%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG ISGL+VLR+INEPTAAA+AYGLDK  + ++ + ++DLGGGTF
Sbjct: 61  VPAYFNDSQRQATKDAGQISGLSVLRVINEPTAAALAYGLDK--SEDKVIAVYDLGGGTF 118

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           D+SIL I+ G+FEVKST GDT  G
Sbjct: 119 DISILEIQKGVFEVKSTNGDTFLG 142



 Score = 56.0 bits (129), Expect = 1e-07
 Identities = 29/66 (43%), Positives = 42/66 (63%), Gaps = 1/66 (1%)
 Frame = +2

Query: 320 VQADMKHWPFEVV-SDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQN 496
           VQ D+K+ PF++V +  G  +++       K + P ++ + VL KMKETAE YLG T +N
Sbjct: 1   VQKDIKNVPFKIVRASNGDARVEA----HGKLYSPSQIGAFVLMKMKETAENYLGHTAKN 56

Query: 497 AVITFP 514
           AVIT P
Sbjct: 57  AVITVP 62


>AK222758-1|BAD96478.1|  679|Homo sapiens heat shock 70kDa protein
           9B precursor variant protein.
          Length = 679

 Score =  130 bits (313), Expect = 7e-30
 Identities = 61/84 (72%), Positives = 72/84 (85%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG ISGLNVLR+INEPTAAA+AYGLDK  + ++ + ++DLGGG F
Sbjct: 193 VPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDK--SEDKVIAVYDLGGGAF 250

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           D+SIL I+ G+FEVKST GDT  G
Sbjct: 251 DISILEIQKGVFEVKSTNGDTFLG 274



 Score = 82.6 bits (195), Expect = 1e-15
 Identities = 41/87 (47%), Positives = 57/87 (65%), Gaps = 1/87 (1%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVV-SDGGKPKIKVAYKGEDKTFFPEEVS 433
           NPNNT +  KRLIGR+++D  VQ D+K+ PF++V +  G   +    +   K + P ++ 
Sbjct: 112 NPNNTFYATKRLIGRRYDDPEVQKDIKNVPFKIVRASNGDAWV----EAHGKLYSPSQIG 167

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           + VL KMKETAE YLG T +NAVIT P
Sbjct: 168 AFVLMKMKETAENYLGHTAKNAVITVP 194



 Score = 66.1 bits (154), Expect = 1e-10
 Identities = 35/79 (44%), Positives = 46/79 (58%), Gaps = 1/79 (1%)
 Frame = +3

Query: 42  RTSNKTD*KYKMAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTE 218
           R  ++ D   +  K   VGIDLGTT SCV V +  + +++ N +G RTTPS VAFT D E
Sbjct: 39  RLVSRRDYASEAIKGAVVGIDLGTTNSCVAVMEGKQAKVLENAEGARTTPSVVAFTADGE 98

Query: 219 RLIGDAAKNQVA*TPTTQY 275
           RL+G  AK Q    P   +
Sbjct: 99  RLVGMPAKRQAVTNPNNTF 117


>U10149-1|AAC50076.1|  125|Homo sapiens heat shock protein protein.
          Length = 125

 Score =  126 bits (303), Expect = 1e-28
 Identities = 55/65 (84%), Positives = 61/65 (93%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NTIFDAKRLIGRKFEDATVQ+DMKHWPF VVS+GGKPK++V YKGE KTFFPEE+S
Sbjct: 61  MNPTNTIFDAKRLIGRKFEDATVQSDMKHWPFRVVSEGGKPKVQVEYKGETKTFFPEEIS 120

Query: 434 SMVLT 448
           SMVLT
Sbjct: 121 SMVLT 125



 Score =  119 bits (286), Expect = 1e-26
 Identities = 57/63 (90%), Positives = 59/63 (93%)
 Frame = +3

Query: 78  AKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA* 257
           A+ PA+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIG AAKNQVA 
Sbjct: 3   ARGPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIG-AAKNQVAM 61

Query: 258 TPT 266
            PT
Sbjct: 62  NPT 64


>U04735-1|AAA16954.1|  471|Homo sapiens microsomal stress 70 protein
           ATPase core protein.
          Length = 471

 Score = 83.8 bits (198), Expect = 6e-16
 Identities = 41/84 (48%), Positives = 58/84 (69%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPA F+  QR +T +A  ++GL +LR+INEPTAAA+AYGL K      +VL+ DLGGGT 
Sbjct: 174 VPAEFDLKQRNSTIEAANLAGLKILRVINEPTAAAMAYGLHKADV--FHVLVIDLGGGTL 231

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVS+L  + G+F  ++ +G+   G
Sbjct: 232 DVSLLNKQGGMFLTRAMSGNNKLG 255



 Score = 80.6 bits (190), Expect = 6e-15
 Identities = 44/105 (41%), Positives = 62/105 (59%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 436
           NP NTI+DAKR IG+ F    ++A++  +PF+V++  G  +  V    E  T  PE V S
Sbjct: 91  NPQNTIYDAKRFIGKIFTAEELEAEIGRYPFKVLNKNGMVEFSVT-SNETITVSPEYVGS 149

Query: 437 MVLTKMKETAEAYLGKTVQNAVITFPRTSMTLKDKPQKMQVPSLA 571
            +L K+KE AEAYLG  V NAVI+ P     LK +   ++  +LA
Sbjct: 150 RLLLKLKEMAEAYLGMPVANAVISVP-AEFDLKQRNSTIEAANLA 193



 Score = 50.4 bits (115), Expect = 7e-06
 Identities = 24/48 (50%), Positives = 34/48 (70%), Gaps = 2/48 (4%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVF--QHGKVEIIANDQGNRTTPSYVAFTDTERLIG 230
           +GIDLGTTY  VGVF    GKV++I ++ G+ + PS V+FTD +  +G
Sbjct: 34  IGIDLGTTYCSVGVFFPGTGKVKVIPDENGHISIPSMVSFTDNDVYVG 81


>BC036370-1|AAH36370.1|  471|Homo sapiens stress 70 protein
           chaperone, microsome-associated, 60kDa protein.
          Length = 471

 Score = 83.8 bits (198), Expect = 6e-16
 Identities = 41/84 (48%), Positives = 58/84 (69%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPA F+  QR +T +A  ++GL +LR+INEPTAAA+AYGL K      +VL+ DLGGGT 
Sbjct: 174 VPAEFDLKQRNSTIEAANLAGLKILRVINEPTAAAMAYGLHKADV--FHVLVIDLGGGTL 231

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVS+L  + G+F  ++ +G+   G
Sbjct: 232 DVSLLNKQGGMFLTRAMSGNNKLG 255



 Score = 80.6 bits (190), Expect = 6e-15
 Identities = 44/105 (41%), Positives = 62/105 (59%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 436
           NP NTI+DAKR IG+ F    ++A++  +PF+V++  G  +  V    E  T  PE V S
Sbjct: 91  NPQNTIYDAKRFIGKIFTAEELEAEIGRYPFKVLNKNGMVEFSVT-SNETITVSPEYVGS 149

Query: 437 MVLTKMKETAEAYLGKTVQNAVITFPRTSMTLKDKPQKMQVPSLA 571
            +L K+KE AEAYLG  V NAVI+ P     LK +   ++  +LA
Sbjct: 150 RLLLKLKEMAEAYLGMPVANAVISVP-AEFDLKQRNSTIEAANLA 193



 Score = 50.4 bits (115), Expect = 7e-06
 Identities = 24/48 (50%), Positives = 34/48 (70%), Gaps = 2/48 (4%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVF--QHGKVEIIANDQGNRTTPSYVAFTDTERLIG 230
           +GIDLGTTY  VGVF    GKV++I ++ G+ + PS V+FTD +  +G
Sbjct: 34  IGIDLGTTYCSVGVFFPGTGKVKVIPDENGHISIPSMVSFTDNDVYVG 81


>AL929592-6|CAI18465.1|  476|Homo sapiens heat shock 70kDa protein
           1A protein.
          Length = 476

 Score = 83.8 bits (198), Expect = 6e-16
 Identities = 38/46 (82%), Positives = 42/46 (91%)
 Frame = +1

Query: 622 GLDKKGTGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHFG 759
           G+ + G GERNVLIFDLGGGTFDVSILTI+DGIFEVK+TAGDTH G
Sbjct: 19  GVFQHGKGERNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLG 64



 Score = 55.2 bits (127), Expect = 2e-07
 Identities = 27/39 (69%), Positives = 30/39 (76%), Gaps = 2/39 (5%)
 Frame = +3

Query: 75  MAKAPAVGIDLGTTYSCVGVFQHGKVE--IIANDQGNRT 185
           MAKA A+GIDLGTTYSCVGVFQHGK E  ++  D G  T
Sbjct: 1   MAKAAAIGIDLGTTYSCVGVFQHGKGERNVLIFDLGGGT 39


>AL671762-5|CAM25532.1|  476|Homo sapiens heat shock 70kDa protein
           1A protein.
          Length = 476

 Score = 83.8 bits (198), Expect = 6e-16
 Identities = 38/46 (82%), Positives = 42/46 (91%)
 Frame = +1

Query: 622 GLDKKGTGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHFG 759
           G+ + G GERNVLIFDLGGGTFDVSILTI+DGIFEVK+TAGDTH G
Sbjct: 19  GVFQHGKGERNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLG 64



 Score = 55.2 bits (127), Expect = 2e-07
 Identities = 27/39 (69%), Positives = 30/39 (76%), Gaps = 2/39 (5%)
 Frame = +3

Query: 75  MAKAPAVGIDLGTTYSCVGVFQHGKVE--IIANDQGNRT 185
           MAKA A+GIDLGTTYSCVGVFQHGK E  ++  D G  T
Sbjct: 1   MAKAAAIGIDLGTTYSCVGVFQHGKGERNVLIFDLGGGT 39


>AL662834-16|CAM24989.1|  476|Homo sapiens heat shock 70kDa protein
           1A protein.
          Length = 476

 Score = 83.8 bits (198), Expect = 6e-16
 Identities = 38/46 (82%), Positives = 42/46 (91%)
 Frame = +1

Query: 622 GLDKKGTGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHFG 759
           G+ + G GERNVLIFDLGGGTFDVSILTI+DGIFEVK+TAGDTH G
Sbjct: 19  GVFQHGKGERNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLG 64



 Score = 55.2 bits (127), Expect = 2e-07
 Identities = 27/39 (69%), Positives = 30/39 (76%), Gaps = 2/39 (5%)
 Frame = +3

Query: 75  MAKAPAVGIDLGTTYSCVGVFQHGKVE--IIANDQGNRT 185
           MAKA A+GIDLGTTYSCVGVFQHGK E  ++  D G  T
Sbjct: 1   MAKAAAIGIDLGTTYSCVGVFQHGKGERNVLIFDLGGGT 39


>AL163206-1|CAB90390.1|  471|Homo sapiens human microsomal stress70
           protein ATPase core precursor protein.
          Length = 471

 Score = 83.8 bits (198), Expect = 6e-16
 Identities = 41/84 (48%), Positives = 58/84 (69%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPA F+  QR +T +A  ++GL +LR+INEPTAAA+AYGL K      +VL+ DLGGGT 
Sbjct: 174 VPAEFDLKQRNSTIEAANLAGLKILRVINEPTAAAMAYGLHKADV--FHVLVIDLGGGTL 231

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVS+L  + G+F  ++ +G+   G
Sbjct: 232 DVSLLNKQGGMFLTRAMSGNNKLG 255



 Score = 80.6 bits (190), Expect = 6e-15
 Identities = 44/105 (41%), Positives = 62/105 (59%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 436
           NP NTI+DAKR IG+ F    ++A++  +PF+V++  G  +  V    E  T  PE V S
Sbjct: 91  NPQNTIYDAKRFIGKIFTAEELEAEIGRYPFKVLNKNGMVEFSVT-SNETITVSPEYVGS 149

Query: 437 MVLTKMKETAEAYLGKTVQNAVITFPRTSMTLKDKPQKMQVPSLA 571
            +L K+KE AEAYLG  V NAVI+ P     LK +   ++  +LA
Sbjct: 150 RLLLKLKEMAEAYLGMPVANAVISVP-AEFDLKQRNSTIEAANLA 193



 Score = 50.4 bits (115), Expect = 7e-06
 Identities = 24/48 (50%), Positives = 34/48 (70%), Gaps = 2/48 (4%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVF--QHGKVEIIANDQGNRTTPSYVAFTDTERLIG 230
           +GIDLGTTY  VGVF    GKV++I ++ G+ + PS V+FTD +  +G
Sbjct: 34  IGIDLGTTYCSVGVFFPGTGKVKVIPDENGHISIPSMVSFTDNDVYVG 81


>AK223282-1|BAD97002.1|  471|Homo sapiens stress 70 protein
           chaperone, microsome-associated, 60kDa precursor variant
           protein.
          Length = 471

 Score = 83.8 bits (198), Expect = 6e-16
 Identities = 41/84 (48%), Positives = 58/84 (69%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPA F+  QR +T +A  ++GL +LR+INEPTAAA+AYGL K      +VL+ DLGGGT 
Sbjct: 174 VPAEFDLKQRNSTIEAANLAGLKILRVINEPTAAAMAYGLHKADV--FHVLVIDLGGGTL 231

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVS+L  + G+F  ++ +G+   G
Sbjct: 232 DVSLLNKQGGMFLTRAMSGNNKLG 255



 Score = 78.6 bits (185), Expect = 2e-14
 Identities = 44/105 (41%), Positives = 61/105 (58%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 436
           NP NTI DAKR IG+ F    ++A++  +PF+V++  G  +  V    E  T  PE V S
Sbjct: 91  NPQNTICDAKRFIGKIFTAEELEAEIGRYPFKVLNKNGMVEFSVT-SNETITVSPEYVGS 149

Query: 437 MVLTKMKETAEAYLGKTVQNAVITFPRTSMTLKDKPQKMQVPSLA 571
            +L K+KE AEAYLG  V NAVI+ P     LK +   ++  +LA
Sbjct: 150 RLLLKLKEMAEAYLGMPVANAVISVP-AEFDLKQRNSTIEAANLA 193



 Score = 50.4 bits (115), Expect = 7e-06
 Identities = 24/48 (50%), Positives = 34/48 (70%), Gaps = 2/48 (4%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVF--QHGKVEIIANDQGNRTTPSYVAFTDTERLIG 230
           +GIDLGTTY  VGVF    GKV++I ++ G+ + PS V+FTD +  +G
Sbjct: 34  IGIDLGTTYCSVGVFFPGTGKVKVIPDENGHISIPSMVSFTDNDVYVG 81


>AF130249-1|AAD21091.1|  471|Homo sapiens STCH protein.
          Length = 471

 Score = 83.8 bits (198), Expect = 6e-16
 Identities = 41/84 (48%), Positives = 58/84 (69%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPA F+  QR +T +A  ++GL +LR+INEPTAAA+AYGL K      +VL+ DLGGGT 
Sbjct: 174 VPAEFDLKQRNSTIEAANLAGLKILRVINEPTAAAMAYGLHKADV--FHVLVIDLGGGTL 231

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVS+L  + G+F  ++ +G+   G
Sbjct: 232 DVSLLNKQGGMFLTRAMSGNNKLG 255



 Score = 80.6 bits (190), Expect = 6e-15
 Identities = 44/105 (41%), Positives = 62/105 (59%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 436
           NP NTI+DAKR IG+ F    ++A++  +PF+V++  G  +  V    E  T  PE V S
Sbjct: 91  NPQNTIYDAKRFIGKIFTAEELEAEIGRYPFKVLNKNGMVEFSVT-SNETITVSPEYVGS 149

Query: 437 MVLTKMKETAEAYLGKTVQNAVITFPRTSMTLKDKPQKMQVPSLA 571
            +L K+KE AEAYLG  V NAVI+ P     LK +   ++  +LA
Sbjct: 150 RLLLKLKEMAEAYLGMPVANAVISVP-AEFDLKQRNSTIEAANLA 193



 Score = 50.4 bits (115), Expect = 7e-06
 Identities = 24/48 (50%), Positives = 34/48 (70%), Gaps = 2/48 (4%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVF--QHGKVEIIANDQGNRTTPSYVAFTDTERLIG 230
           +GIDLGTTY  VGVF    GKV++I ++ G+ + PS V+FTD +  +G
Sbjct: 34  IGIDLGTTYCSVGVFFPGTGKVKVIPDENGHISIPSMVSFTDNDVYVG 81


>M24743-1|AAA59844.1|   36|Homo sapiens HSPA2 protein.
          Length = 36

 Score = 76.2 bits (179), Expect = 1e-13
 Identities = 34/36 (94%), Positives = 35/36 (97%)
 Frame = +3

Query: 75  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNR 182
           MAKA A+GIDLGTTYSCVGVFQHGKVEIIANDQGNR
Sbjct: 1   MAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNR 36


>BC119690-1|AAI19691.1|  509|Homo sapiens heat shock 70kDa protein
           14 protein.
          Length = 509

 Score = 76.2 bits (179), Expect = 1e-13
 Identities = 35/85 (41%), Positives = 55/85 (64%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKG-TGERNVLIFDLGGGT 684
           VP  F + Q+ A  +A   +G NVLR+I+EP+AA +AYG+ +   TG+ N+L+F LGG +
Sbjct: 143 VPFDFGEKQKNALGEAARAAGFNVLRLIHEPSAALLAYGIGQDSPTGKSNILVFKLGGTS 202

Query: 685 FDVSILTIEDGIFEVKSTAGDTHFG 759
             +S++ +  GI+ V ST  D + G
Sbjct: 203 LSLSVMEVNSGIYRVLSTNTDDNIG 227



 Score = 59.7 bits (138), Expect = 1e-08
 Identities = 23/51 (45%), Positives = 38/51 (74%)
 Frame = +3

Query: 90  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAK 242
           A+G+ LG T +CV V++ G+  ++AND G+R TP+ VA+++ E ++G AAK
Sbjct: 3   AIGVHLGCTSACVAVYKDGRAGVVANDAGDRVTPAVVAYSENEEIVGLAAK 53



 Score = 55.6 bits (128), Expect = 2e-07
 Identities = 28/86 (32%), Positives = 45/86 (52%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 436
           N +NT+   K+++GR   D   Q  +      V+   GK + ++    E K   PE+V+ 
Sbjct: 59  NISNTVMKVKQILGRSSSDPQAQKYIAESKCLVIEKNGKLRYEIDTGEETKFVNPEDVAR 118

Query: 437 MVLTKMKETAEAYLGKTVQNAVITFP 514
           ++ +KMKETA + LG    + VIT P
Sbjct: 119 LIFSKMKETAHSVLGSDANDVVITVP 144


>AF143723-1|AAF66640.1|  509|Homo sapiens heat shock protein HSP60
           protein.
          Length = 509

 Score = 76.2 bits (179), Expect = 1e-13
 Identities = 35/85 (41%), Positives = 55/85 (64%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKG-TGERNVLIFDLGGGT 684
           VP  F + Q+ A  +A   +G NVLR+I+EP+AA +AYG+ +   TG+ N+L+F LGG +
Sbjct: 143 VPFDFGEKQKNALGEAARAAGFNVLRLIHEPSAALLAYGIGQDSPTGKSNILVFKLGGTS 202

Query: 685 FDVSILTIEDGIFEVKSTAGDTHFG 759
             +S++ +  GI+ V ST  D + G
Sbjct: 203 LSLSVMEVNSGIYRVLSTNTDDNIG 227



 Score = 57.2 bits (132), Expect = 6e-08
 Identities = 22/51 (43%), Positives = 37/51 (72%)
 Frame = +3

Query: 90  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAK 242
           A+G+ LG T +C  V++ G+  ++AND G+R TP+ VA+++ E ++G AAK
Sbjct: 3   AIGVHLGCTSACEAVYKDGRAGVVANDAGDRVTPAVVAYSENEEIVGLAAK 53



 Score = 55.6 bits (128), Expect = 2e-07
 Identities = 28/86 (32%), Positives = 45/86 (52%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 436
           N +NT+   K+++GR   D   Q  +      V+   GK + ++    E K   PE+V+ 
Sbjct: 59  NISNTVMKVKQILGRSSSDPQAQKYIAESKCLVIEKNGKLRYEIDTGEETKFVNPEDVAR 118

Query: 437 MVLTKMKETAEAYLGKTVQNAVITFP 514
           ++ +KMKETA + LG    + VIT P
Sbjct: 119 LIFSKMKETAHSVLGSDANDVVITVP 144


>AF112210-1|AAF17198.1|  509|Homo sapiens heat shock protein
           hsp70-related protein protein.
          Length = 509

 Score = 76.2 bits (179), Expect = 1e-13
 Identities = 35/85 (41%), Positives = 55/85 (64%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKG-TGERNVLIFDLGGGT 684
           VP  F + Q+ A  +A   +G NVLR+I+EP+AA +AYG+ +   TG+ N+L+F LGG +
Sbjct: 143 VPFDFGEKQKNALGEAARAAGFNVLRLIHEPSAALLAYGIGQDSPTGKSNILVFKLGGTS 202

Query: 685 FDVSILTIEDGIFEVKSTAGDTHFG 759
             +S++ +  GI+ V ST  D + G
Sbjct: 203 LSLSVMEVNSGIYRVLSTNTDDNIG 227



 Score = 59.7 bits (138), Expect = 1e-08
 Identities = 23/51 (45%), Positives = 38/51 (74%)
 Frame = +3

Query: 90  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAK 242
           A+G+ LG T +CV V++ G+  ++AND G+R TP+ VA+++ E ++G AAK
Sbjct: 3   AIGVHLGCTSACVAVYKDGRAGVVANDAGDRVTPAVVAYSENEEIVGLAAK 53



 Score = 55.6 bits (128), Expect = 2e-07
 Identities = 28/86 (32%), Positives = 45/86 (52%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 436
           N +NT+   K+++GR   D   Q  +      V+   GK + ++    E K   PE+V+ 
Sbjct: 59  NISNTVMKVKQILGRSSSDPQAQKYIAESKCLVIEKNGKLRYEIDTGEETKFVNPEDVAR 118

Query: 437 MVLTKMKETAEAYLGKTVQNAVITFP 514
           ++ +KMKETA + LG    + VIT P
Sbjct: 119 LIFSKMKETAHSVLGSDANDVVITVP 144


>L12723-1|AAA02807.1|  701|Homo sapiens heat shock protein 70
           protein.
          Length = 701

 Score = 71.7 bits (168), Expect = 3e-12
 Identities = 36/94 (38%), Positives = 55/94 (58%), Gaps = 5/94 (5%)
 Frame = +1

Query: 493 ECSYHVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGE-----RNV 657
           +C   VP ++ D++R++  DA  I+GLN LR++NE TA A+AYG+ K+         RNV
Sbjct: 139 DCVVSVPCFYTDAERRSVMDATQIAGLNCLRLMNETTAVALAYGIYKQDLPRLEEKPRNV 198

Query: 658 LIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHFG 759
           +  D+G   + VS+     G  +V +TA DT  G
Sbjct: 199 VFVDMGHSAYQVSVCAFNRGKLKVLATAFDTTLG 232



 Score = 66.1 bits (154), Expect = 1e-10
 Identities = 34/87 (39%), Positives = 53/87 (60%), Gaps = 1/87 (1%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVS-DGGKPKIKVAYKGEDKTFFPEEVS 433
           N  NT+   KR  GR F D  V+A+  +  +++V    G   IKV Y  E++ F  E+V+
Sbjct: 59  NAKNTVQGFKRFHGRAFSDPFVEAEKSNLAYDIVQWPTGLTGIKVTYMEEERNFTTEQVT 118

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           +M+L+K+KETAE+ L K V + V++ P
Sbjct: 119 AMLLSKLKETAESVLKKPVVDCVVSVP 145



 Score = 48.0 bits (109), Expect = 4e-05
 Identities = 25/53 (47%), Positives = 33/53 (62%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV 251
           VGIDLG     V V + G +E IAN+  +R TP+ ++F    R IG AAK+QV
Sbjct: 4   VGIDLGFQSCYVAVARAGGIETIANEYSDRCTPACISFGPKNRSIGAAAKSQV 56


>X67643-1|CAA47886.1|  474|Homo sapiens HS24/P52 protein.
          Length = 474

 Score = 71.3 bits (167), Expect = 3e-12
 Identities = 36/94 (38%), Positives = 55/94 (58%), Gaps = 5/94 (5%)
 Frame = +1

Query: 493 ECSYHVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKG-----TGERNV 657
           +C   VP ++ D++R++  DA  I+GLN LR++NE TA A+AYG+ K+         RNV
Sbjct: 139 DCVVSVPCFYTDAERRSVMDATQIAGLNCLRLMNETTAVALAYGIYKQDLPALEEKPRNV 198

Query: 658 LIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHFG 759
           +  D+G   + VS+     G  +V +TA DT  G
Sbjct: 199 VFVDMGHSAYQVSVCAFNRGKLKVLATAFDTTLG 232



 Score = 66.1 bits (154), Expect = 1e-10
 Identities = 34/87 (39%), Positives = 53/87 (60%), Gaps = 1/87 (1%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVS-DGGKPKIKVAYKGEDKTFFPEEVS 433
           N  NT+   KR  GR F D  V+A+  +  +++V    G   IKV Y  E++ F  E+V+
Sbjct: 59  NAKNTVQGFKRFHGRAFSDPFVEAEKSNLAYDIVQLPTGLTGIKVTYMEEERNFTTEQVT 118

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           +M+L+K+KETAE+ L K V + V++ P
Sbjct: 119 AMLLSKLKETAESVLKKPVVDCVVSVP 145



 Score = 48.0 bits (109), Expect = 4e-05
 Identities = 25/53 (47%), Positives = 33/53 (62%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV 251
           VGIDLG     V V + G +E IAN+  +R TP+ ++F    R IG AAK+QV
Sbjct: 4   VGIDLGFQSCYVAVARAGGIETIANEYSDRCTPACISFGPKNRSIGAAAKSQV 56


>X67640-1|CAA47885.1|  266|Homo sapiens HS24/P52 protein.
          Length = 266

 Score = 71.3 bits (167), Expect = 3e-12
 Identities = 36/94 (38%), Positives = 55/94 (58%), Gaps = 5/94 (5%)
 Frame = +1

Query: 493 ECSYHVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKG-----TGERNV 657
           +C   VP ++ D++R++  DA  I+GLN LR++NE TA A+AYG+ K+         RNV
Sbjct: 103 DCVVSVPCFYTDAERRSVMDATQIAGLNCLRLMNETTAVALAYGIYKQDLPALEEKPRNV 162

Query: 658 LIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHFG 759
           +  D+G   + VS+     G  +V +TA DT  G
Sbjct: 163 VFVDMGHSAYQVSVCAFNRGKLKVLATAFDTTLG 196



 Score = 66.1 bits (154), Expect = 1e-10
 Identities = 34/87 (39%), Positives = 53/87 (60%), Gaps = 1/87 (1%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVS-DGGKPKIKVAYKGEDKTFFPEEVS 433
           N  NT+   KR  GR F D  V+A+  +  +++V    G   IKV Y  E++ F  E+V+
Sbjct: 23  NAKNTVQGFKRFHGRAFSDPFVEAEKSNLAYDIVQLPTGLTGIKVTYMEEERNFTTEQVT 82

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           +M+L+K+KETAE+ L K V + V++ P
Sbjct: 83  AMLLSKLKETAESVLKKPVVDCVVSVP 109


>BC126124-1|AAI26125.1|  840|Homo sapiens heat shock 70kDa protein 4
           protein.
          Length = 840

 Score = 71.3 bits (167), Expect = 3e-12
 Identities = 36/94 (38%), Positives = 55/94 (58%), Gaps = 5/94 (5%)
 Frame = +1

Query: 493 ECSYHVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKG-----TGERNV 657
           +C   VP ++ D++R++  DA  I+GLN LR++NE TA A+AYG+ K+         RNV
Sbjct: 139 DCVVSVPCFYTDAERRSVMDATQIAGLNCLRLMNETTAVALAYGIYKQDLPALEEKPRNV 198

Query: 658 LIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHFG 759
           +  D+G   + VS+     G  +V +TA DT  G
Sbjct: 199 VFVDMGHSAYQVSVCAFNRGKLKVLATAFDTTLG 232



 Score = 66.1 bits (154), Expect = 1e-10
 Identities = 34/87 (39%), Positives = 53/87 (60%), Gaps = 1/87 (1%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVS-DGGKPKIKVAYKGEDKTFFPEEVS 433
           N  NT+   KR  GR F D  V+A+  +  +++V    G   IKV Y  E++ F  E+V+
Sbjct: 59  NAKNTVQGFKRFHGRAFSDPFVEAEKSNLAYDIVQLPTGLTGIKVTYMEEERNFTTEQVT 118

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           +M+L+K+KETAE+ L K V + V++ P
Sbjct: 119 AMLLSKLKETAESVLKKPVVDCVVSVP 145



 Score = 48.0 bits (109), Expect = 4e-05
 Identities = 25/53 (47%), Positives = 33/53 (62%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV 251
           VGIDLG     V V + G +E IAN+  +R TP+ ++F    R IG AAK+QV
Sbjct: 4   VGIDLGFQSCYVAVARAGGIETIANEYSDRCTPACISFGPKNRSIGAAAKSQV 56


>BC126122-1|AAI26123.1|  840|Homo sapiens heat shock 70kDa protein 4
           protein.
          Length = 840

 Score = 71.3 bits (167), Expect = 3e-12
 Identities = 36/94 (38%), Positives = 55/94 (58%), Gaps = 5/94 (5%)
 Frame = +1

Query: 493 ECSYHVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKG-----TGERNV 657
           +C   VP ++ D++R++  DA  I+GLN LR++NE TA A+AYG+ K+         RNV
Sbjct: 139 DCVVSVPCFYTDAERRSVMDATQIAGLNCLRLMNETTAVALAYGIYKQDLPALEEKPRNV 198

Query: 658 LIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHFG 759
           +  D+G   + VS+     G  +V +TA DT  G
Sbjct: 199 VFVDMGHSAYQVSVCAFNRGKLKVLATAFDTTLG 232



 Score = 66.1 bits (154), Expect = 1e-10
 Identities = 34/87 (39%), Positives = 53/87 (60%), Gaps = 1/87 (1%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVS-DGGKPKIKVAYKGEDKTFFPEEVS 433
           N  NT+   KR  GR F D  V+A+  +  +++V    G   IKV Y  E++ F  E+V+
Sbjct: 59  NAKNTVQGFKRFHGRAFSDPFVEAEKSNLAYDIVQLPTGLTGIKVTYMEEERNFTTEQVT 118

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           +M+L+K+KETAE+ L K V + V++ P
Sbjct: 119 AMLLSKLKETAESVLKKPVVDCVVSVP 145



 Score = 48.0 bits (109), Expect = 4e-05
 Identities = 25/53 (47%), Positives = 33/53 (62%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV 251
           VGIDLG     V V + G +E IAN+  +R TP+ ++F    R IG AAK+QV
Sbjct: 4   VGIDLGFQSCYVAVARAGGIETIANEYSDRCTPACISFGPKNRSIGAAAKSQV 56


>BC110861-1|AAI10862.1|  840|Homo sapiens heat shock 70kDa protein 4
           protein.
          Length = 840

 Score = 71.3 bits (167), Expect = 3e-12
 Identities = 36/94 (38%), Positives = 55/94 (58%), Gaps = 5/94 (5%)
 Frame = +1

Query: 493 ECSYHVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKG-----TGERNV 657
           +C   VP ++ D++R++  DA  I+GLN LR++NE TA A+AYG+ K+         RNV
Sbjct: 139 DCVVSVPCFYTDAERRSVMDATQIAGLNCLRLMNETTAVALAYGIYKQDLPALEEKPRNV 198

Query: 658 LIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHFG 759
           +  D+G   + VS+     G  +V +TA DT  G
Sbjct: 199 VFVDMGHSAYQVSVCAFNRGKLKVLATAFDTTLG 232



 Score = 66.1 bits (154), Expect = 1e-10
 Identities = 34/87 (39%), Positives = 53/87 (60%), Gaps = 1/87 (1%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVS-DGGKPKIKVAYKGEDKTFFPEEVS 433
           N  NT+   KR  GR F D  V+A+  +  +++V    G   IKV Y  E++ F  E+V+
Sbjct: 59  NAKNTVQGFKRFHGRAFSDPFVEAEKSNLAYDIVQLPTGLTGIKVTYMEEERNFTTEQVT 118

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           +M+L+K+KETAE+ L K V + V++ P
Sbjct: 119 AMLLSKLKETAESVLKKPVVDCVVSVP 145



 Score = 48.0 bits (109), Expect = 4e-05
 Identities = 25/53 (47%), Positives = 33/53 (62%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV 251
           VGIDLG     V V + G +E IAN+  +R TP+ ++F    R IG AAK+QV
Sbjct: 4   VGIDLGFQSCYVAVARAGGIETIANEYSDRCTPACISFGPKNRSIGAAAKSQV 56


>AB209151-1|BAD92388.1|  782|Homo sapiens heat shock 70kDa protein 4
           isoform a variant protein.
          Length = 782

 Score = 71.3 bits (167), Expect = 3e-12
 Identities = 36/94 (38%), Positives = 55/94 (58%), Gaps = 5/94 (5%)
 Frame = +1

Query: 493 ECSYHVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKG-----TGERNV 657
           +C   VP ++ D++R++  DA  I+GLN LR++NE TA A+AYG+ K+         RNV
Sbjct: 162 DCVVSVPCFYTDAERRSVMDATQIAGLNCLRLMNETTAVALAYGIYKQDLPALEEKPRNV 221

Query: 658 LIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHFG 759
           +  D+G   + VS+     G  +V +TA DT  G
Sbjct: 222 VFVDMGHSAYQVSVCAFNRGKLKVLATAFDTTLG 255



 Score = 66.1 bits (154), Expect = 1e-10
 Identities = 34/87 (39%), Positives = 53/87 (60%), Gaps = 1/87 (1%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVS-DGGKPKIKVAYKGEDKTFFPEEVS 433
           N  NT+   KR  GR F D  V+A+  +  +++V    G   IKV Y  E++ F  E+V+
Sbjct: 82  NAKNTVQGFKRFHGRAFSDPFVEAEKSNLAYDIVQLPTGLTGIKVTYMEEERNFTTEQVT 141

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           +M+L+K+KETAE+ L K V + V++ P
Sbjct: 142 AMLLSKLKETAESVLKKPVVDCVVSVP 168



 Score = 48.0 bits (109), Expect = 4e-05
 Identities = 25/53 (47%), Positives = 33/53 (62%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV 251
           VGIDLG     V V + G +E IAN+  +R TP+ ++F    R IG AAK+QV
Sbjct: 27  VGIDLGFQSCYVAVARAGGIETIANEYSDRCTPACISFGPKNRSIGAAAKSQV 79


>AB023420-1|BAA75062.1|  840|Homo sapiens apg-2 protein.
          Length = 840

 Score = 71.3 bits (167), Expect = 3e-12
 Identities = 36/94 (38%), Positives = 55/94 (58%), Gaps = 5/94 (5%)
 Frame = +1

Query: 493 ECSYHVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKG-----TGERNV 657
           +C   VP ++ D++R++  DA  I+GLN LR++NE TA A+AYG+ K+         RNV
Sbjct: 139 DCVVSVPCFYTDAERRSVMDATQIAGLNCLRLMNETTAVALAYGIYKQDLPALEEKPRNV 198

Query: 658 LIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHFG 759
           +  D+G   + VS+     G  +V +TA DT  G
Sbjct: 199 VFVDMGHSAYQVSVCAFNRGKLKVLATAFDTTLG 232



 Score = 66.1 bits (154), Expect = 1e-10
 Identities = 34/87 (39%), Positives = 53/87 (60%), Gaps = 1/87 (1%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVS-DGGKPKIKVAYKGEDKTFFPEEVS 433
           N  NT+   KR  GR F D  V+A+  +  +++V    G   IKV Y  E++ F  E+V+
Sbjct: 59  NAKNTVQGFKRFHGRAFSDPFVEAEKSNLAYDIVQLPTGLTGIKVTYMEEERNFTTEQVT 118

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           +M+L+K+KETAE+ L K V + V++ P
Sbjct: 119 AMLLSKLKETAESVLKKPVVDCVVSVP 145



 Score = 48.0 bits (109), Expect = 4e-05
 Identities = 25/53 (47%), Positives = 33/53 (62%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV 251
           VGIDLG     V V + G +E IAN+  +R TP+ ++F    R IG AAK+QV
Sbjct: 4   VGIDLGFQSCYVAVARAGGIETIANEYSDRCTPACISFGPKNRSIGAAAKSQV 56


>AY290862-1|AAP44471.1|  839|Homo sapiens heat shock protein apg-1
           protein.
          Length = 839

 Score = 69.7 bits (163), Expect = 1e-11
 Identities = 33/95 (34%), Positives = 55/95 (57%), Gaps = 5/95 (5%)
 Frame = +1

Query: 490 AECSYHVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKK-----GTGERN 654
           A+C   +P++F D++R++   A  ++GLN LR++NE TA A+AYG+ K+         RN
Sbjct: 138 ADCVISIPSFFTDAERRSVMAAAQVAGLNCLRLMNETTAVALAYGIYKQDLPPLDEKPRN 197

Query: 655 VLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHFG 759
           V+  D+G   + VS+     G  +V +T  D + G
Sbjct: 198 VVFIDMGHSAYQVSVCAFNKGKLKVLATTFDPYLG 232



 Score = 64.9 bits (151), Expect = 3e-10
 Identities = 35/87 (40%), Positives = 50/87 (57%), Gaps = 1/87 (1%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVS-DGGKPKIKVAYKGEDKTFFPEEVS 433
           N  NTI   K+L GR F+D  VQ +    P+E+     G   +KV Y  E++ F  E+V+
Sbjct: 59  NVRNTIHGFKKLHGRSFDDPIVQTERIRLPYELQKMPNGSAGVKVRYLEEERPFAIEQVT 118

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
            M+L K+KET+E  L K V + VI+ P
Sbjct: 119 GMLLAKLKETSENALKKPVADCVISIP 145



 Score = 46.8 bits (106), Expect = 8e-05
 Identities = 22/53 (41%), Positives = 33/53 (62%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV 251
           VGIDLG     + V + G +E IAN+  +R TP+ ++     R IG+AAK+Q+
Sbjct: 4   VGIDLGFLNCYIAVARSGGIETIANEYSDRCTPACISLGSRTRAIGNAAKSQI 56


>AB023421-1|BAA75063.1|  839|Homo sapiens apg-1 protein.
          Length = 839

 Score = 69.7 bits (163), Expect = 1e-11
 Identities = 33/95 (34%), Positives = 55/95 (57%), Gaps = 5/95 (5%)
 Frame = +1

Query: 490 AECSYHVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKK-----GTGERN 654
           A+C   +P++F D++R++   A  ++GLN LR++NE TA A+AYG+ K+         RN
Sbjct: 138 ADCVISIPSFFTDAERRSVMAAAQVAGLNCLRLMNETTAVALAYGIYKQDLPPLDEKPRN 197

Query: 655 VLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHFG 759
           V+  D+G   + VS+     G  +V +T  D + G
Sbjct: 198 VVFIDMGHSAYQVSVCAFNKGKLKVLATTFDPYLG 232



 Score = 64.9 bits (151), Expect = 3e-10
 Identities = 35/87 (40%), Positives = 50/87 (57%), Gaps = 1/87 (1%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVS-DGGKPKIKVAYKGEDKTFFPEEVS 433
           N  NTI   K+L GR F+D  VQ +    P+E+     G   +KV Y  E++ F  E+V+
Sbjct: 59  NVRNTIHGFKKLHGRSFDDPIVQTERIRLPYELQKMPNGSAGVKVRYLEEERPFAIEQVT 118

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
            M+L K+KET+E  L K V + VI+ P
Sbjct: 119 GMLLAKLKETSENALKKPVADCVISIP 145



 Score = 46.8 bits (106), Expect = 8e-05
 Identities = 22/53 (41%), Positives = 33/53 (62%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV 251
           VGIDLG     + V + G +E IAN+  +R TP+ ++     R IG+AAK+Q+
Sbjct: 4   VGIDLGFLNCYIAVARSGGIETIANEYSDRCTPACISLGSRTRAIGNAAKSQI 56


>EF197155-1|ABM69040.1|  839|Homo sapiens heat shock 70 kDa protein
           4-like protein protein.
          Length = 839

 Score = 67.3 bits (157), Expect = 6e-11
 Identities = 32/95 (33%), Positives = 54/95 (56%), Gaps = 5/95 (5%)
 Frame = +1

Query: 490 AECSYHVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKK-----GTGERN 654
           A+C   +P++F D++R++   A  ++GLN LR++NE TA A+AYG+ K+         RN
Sbjct: 138 ADCVISIPSFFTDAERRSVMAAAQVAGLNCLRLMNETTAVALAYGIYKQDLPPLDEKPRN 197

Query: 655 VLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHFG 759
           V+  D+G   + V +     G  +V +T  D + G
Sbjct: 198 VVFIDMGHSAYQVLVCAFNKGKLKVLATTFDPYLG 232



 Score = 64.9 bits (151), Expect = 3e-10
 Identities = 35/87 (40%), Positives = 50/87 (57%), Gaps = 1/87 (1%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVS-DGGKPKIKVAYKGEDKTFFPEEVS 433
           N  NTI   K+L GR F+D  VQ +    P+E+     G   +KV Y  E++ F  E+V+
Sbjct: 59  NVRNTIHGFKKLHGRSFDDPIVQTERIRLPYELQKMPNGSAGVKVRYLEEERPFAIEQVT 118

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
            M+L K+KET+E  L K V + VI+ P
Sbjct: 119 GMLLAKLKETSENALKKPVADCVISIP 145



 Score = 46.8 bits (106), Expect = 8e-05
 Identities = 22/53 (41%), Positives = 33/53 (62%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV 251
           VGIDLG     + V + G +E IAN+  +R TP+ ++     R IG+AAK+Q+
Sbjct: 4   VGIDLGFLNCYIAVARSGGIETIANEYSDRCTPACISLGSRTRAIGNAAKSQI 56


>D86956-1|BAA13192.2|  949|Homo sapiens KIAA0201 protein.
          Length = 949

 Score = 67.3 bits (157), Expect = 6e-11
 Identities = 35/85 (41%), Positives = 53/85 (62%), Gaps = 1/85 (1%)
 Frame = +2

Query: 263 NNTIFDAKRLIGRKFEDATVQADMKHWPFEVVS-DGGKPKIKVAYKGEDKTFFPEEVSSM 439
           NNT+ + KR  GR F D  +Q + ++  +++V    G   IKV Y GE+  F  E++++M
Sbjct: 152 NNTVSNFKRFHGRAFNDPFIQKEKENLSYDLVPLKNGGVGIKVMYMGEEHLFSVEQITAM 211

Query: 440 VLTKMKETAEAYLGKTVQNAVITFP 514
           +LTK+KETAE  L K V + VI+ P
Sbjct: 212 LLTKLKETAENSLKKPVTDCVISVP 236



 Score = 62.5 bits (145), Expect = 2e-09
 Identities = 34/94 (36%), Positives = 50/94 (53%), Gaps = 5/94 (5%)
 Frame = +1

Query: 493 ECSYHVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGE-----RNV 657
           +C   VP++F D++R++  DA  I GLN LR++N+ TA A+ YG+ K+         R V
Sbjct: 230 DCVISVPSFFTDAERRSVLDAAQIVGLNCLRLMNDMTAVALNYGIYKQDLPSLDEKPRIV 289

Query: 658 LIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHFG 759
           +  D+G   F VS      G  +V  TA D   G
Sbjct: 290 VFVDMGHSAFQVSACAFNKGKLKVLGTAFDPFLG 323



 Score = 48.4 bits (110), Expect = 3e-05
 Identities = 23/52 (44%), Positives = 33/52 (63%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ 248
           VG+D+G+    + V + G +E IAN+  +R TPS ++F    R IG AAKNQ
Sbjct: 95  VGLDVGSQSCYIAVARAGGIETIANEFSDRCTPSVISFGSKNRTIGVAAKNQ 146


>BC040560-1|AAH40560.1|  839|Homo sapiens heat shock 70kDa protein
           4-like protein.
          Length = 839

 Score = 67.3 bits (157), Expect = 6e-11
 Identities = 32/95 (33%), Positives = 54/95 (56%), Gaps = 5/95 (5%)
 Frame = +1

Query: 490 AECSYHVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKK-----GTGERN 654
           A+C   +P++F D++R++   A  ++GLN LR++NE TA A+AYG+ K+         RN
Sbjct: 138 ADCVISIPSFFTDAERRSVMAAAQVAGLNCLRLMNETTAVALAYGIYKQDLPPLDEKPRN 197

Query: 655 VLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHFG 759
           V+  D+G   + V +     G  +V +T  D + G
Sbjct: 198 VVFIDMGHSAYQVLVCAFNKGKLKVLATTFDPYLG 232



 Score = 64.9 bits (151), Expect = 3e-10
 Identities = 35/87 (40%), Positives = 50/87 (57%), Gaps = 1/87 (1%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVS-DGGKPKIKVAYKGEDKTFFPEEVS 433
           N  NTI   K+L GR F+D  VQ +    P+E+     G   +KV Y  E++ F  E+V+
Sbjct: 59  NVRNTIHGFKKLHGRSFDDPIVQTERIRLPYELQKMPNGSAGVKVRYLEEERPFAIEQVT 118

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
            M+L K+KET+E  L K V + VI+ P
Sbjct: 119 GMLLAKLKETSENALKKPVADCVISIP 145



 Score = 46.8 bits (106), Expect = 8e-05
 Identities = 22/53 (41%), Positives = 33/53 (62%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV 251
           VGIDLG     + V + G +E IAN+  +R TP+ ++     R IG+AAK+Q+
Sbjct: 4   VGIDLGFLNCYIAVARSGGIETIANEYSDRCTPACISLGSRTRAIGNAAKSQI 56


>BC037553-1|AAH37553.1|  858|Homo sapiens heat shock 105kDa/110kDa
           protein 1 protein.
          Length = 858

 Score = 67.3 bits (157), Expect = 6e-11
 Identities = 35/85 (41%), Positives = 53/85 (62%), Gaps = 1/85 (1%)
 Frame = +2

Query: 263 NNTIFDAKRLIGRKFEDATVQADMKHWPFEVVS-DGGKPKIKVAYKGEDKTFFPEEVSSM 439
           NNT+ + KR  GR F D  +Q + ++  +++V    G   IKV Y GE+  F  E++++M
Sbjct: 61  NNTVSNFKRFHGRAFNDPFIQKEKENLSYDLVPLKNGGVGIKVMYMGEEHLFSVEQITAM 120

Query: 440 VLTKMKETAEAYLGKTVQNAVITFP 514
           +LTK+KETAE  L K V + VI+ P
Sbjct: 121 LLTKLKETAENSLKKPVTDCVISVP 145



 Score = 62.5 bits (145), Expect = 2e-09
 Identities = 34/94 (36%), Positives = 50/94 (53%), Gaps = 5/94 (5%)
 Frame = +1

Query: 493 ECSYHVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGE-----RNV 657
           +C   VP++F D++R++  DA  I GLN LR++N+ TA A+ YG+ K+         R V
Sbjct: 139 DCVISVPSFFTDAERRSVLDAAQIVGLNCLRLMNDMTAVALNYGIYKQDLPSLDEKPRIV 198

Query: 658 LIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHFG 759
           +  D+G   F VS      G  +V  TA D   G
Sbjct: 199 VFVDMGHSAFQVSACAFNKGKLKVLGTAFDPFLG 232



 Score = 48.4 bits (110), Expect = 3e-05
 Identities = 23/52 (44%), Positives = 33/52 (63%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ 248
           VG+D+G+    + V + G +E IAN+  +R TPS ++F    R IG AAKNQ
Sbjct: 4   VGLDVGSQSCYIAVARAGGIETIANEFSDRCTPSVISFGSKNRTIGVAAKNQ 55


>AL137142-5|CAI12430.1|  858|Homo sapiens heat shock 105kDa/110kDa
           protein 1 protein.
          Length = 858

 Score = 67.3 bits (157), Expect = 6e-11
 Identities = 35/85 (41%), Positives = 53/85 (62%), Gaps = 1/85 (1%)
 Frame = +2

Query: 263 NNTIFDAKRLIGRKFEDATVQADMKHWPFEVVS-DGGKPKIKVAYKGEDKTFFPEEVSSM 439
           NNT+ + KR  GR F D  +Q + ++  +++V    G   IKV Y GE+  F  E++++M
Sbjct: 61  NNTVSNFKRFHGRAFNDPFIQKEKENLSYDLVPLKNGGVGIKVMYMGEEHLFSVEQITAM 120

Query: 440 VLTKMKETAEAYLGKTVQNAVITFP 514
           +LTK+KETAE  L K V + VI+ P
Sbjct: 121 LLTKLKETAENSLKKPVTDCVISVP 145



 Score = 62.5 bits (145), Expect = 2e-09
 Identities = 34/94 (36%), Positives = 50/94 (53%), Gaps = 5/94 (5%)
 Frame = +1

Query: 493 ECSYHVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGE-----RNV 657
           +C   VP++F D++R++  DA  I GLN LR++N+ TA A+ YG+ K+         R V
Sbjct: 139 DCVISVPSFFTDAERRSVLDAAQIVGLNCLRLMNDMTAVALNYGIYKQDLPSLDEKPRIV 198

Query: 658 LIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHFG 759
           +  D+G   F VS      G  +V  TA D   G
Sbjct: 199 VFVDMGHSAFQVSACAFNKGKLKVLGTAFDPFLG 232



 Score = 48.4 bits (110), Expect = 3e-05
 Identities = 23/52 (44%), Positives = 33/52 (63%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ 248
           VG+D+G+    + V + G +E IAN+  +R TPS ++F    R IG AAKNQ
Sbjct: 4   VGLDVGSQSCYIAVARAGGIETIANEFSDRCTPSVISFGSKNRTIGVAAKNQ 55


>AL137142-4|CAI12428.1|  814|Homo sapiens heat shock 105kDa/110kDa
           protein 1 protein.
          Length = 814

 Score = 67.3 bits (157), Expect = 6e-11
 Identities = 35/85 (41%), Positives = 53/85 (62%), Gaps = 1/85 (1%)
 Frame = +2

Query: 263 NNTIFDAKRLIGRKFEDATVQADMKHWPFEVVS-DGGKPKIKVAYKGEDKTFFPEEVSSM 439
           NNT+ + KR  GR F D  +Q + ++  +++V    G   IKV Y GE+  F  E++++M
Sbjct: 61  NNTVSNFKRFHGRAFNDPFIQKEKENLSYDLVPLKNGGVGIKVMYMGEEHLFSVEQITAM 120

Query: 440 VLTKMKETAEAYLGKTVQNAVITFP 514
           +LTK+KETAE  L K V + VI+ P
Sbjct: 121 LLTKLKETAENSLKKPVTDCVISVP 145



 Score = 62.5 bits (145), Expect = 2e-09
 Identities = 34/94 (36%), Positives = 50/94 (53%), Gaps = 5/94 (5%)
 Frame = +1

Query: 493 ECSYHVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGE-----RNV 657
           +C   VP++F D++R++  DA  I GLN LR++N+ TA A+ YG+ K+         R V
Sbjct: 139 DCVISVPSFFTDAERRSVLDAAQIVGLNCLRLMNDMTAVALNYGIYKQDLPSLDEKPRIV 198

Query: 658 LIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHFG 759
           +  D+G   F VS      G  +V  TA D   G
Sbjct: 199 VFVDMGHSAFQVSACAFNKGKLKVLGTAFDPFLG 232



 Score = 48.4 bits (110), Expect = 3e-05
 Identities = 23/52 (44%), Positives = 33/52 (63%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ 248
           VG+D+G+    + V + G +E IAN+  +R TPS ++F    R IG AAKNQ
Sbjct: 4   VGLDVGSQSCYIAVARAGGIETIANEFSDRCTPSVISFGSKNRTIGVAAKNQ 55


>AF039695-1|AAC18044.1|  872|Homo sapiens antigen NY-CO-25 protein.
          Length = 872

 Score = 67.3 bits (157), Expect = 6e-11
 Identities = 35/85 (41%), Positives = 53/85 (62%), Gaps = 1/85 (1%)
 Frame = +2

Query: 263 NNTIFDAKRLIGRKFEDATVQADMKHWPFEVVS-DGGKPKIKVAYKGEDKTFFPEEVSSM 439
           NNT+ + KR  GR F D  +Q + ++  +++V    G   IKV Y GE+  F  E++++M
Sbjct: 75  NNTVSNFKRFHGRAFNDPFIQKEKENLSYDLVPLKNGGVGIKVMYMGEEHLFSVEQITAM 134

Query: 440 VLTKMKETAEAYLGKTVQNAVITFP 514
           +LTK+KETAE  L K V + VI+ P
Sbjct: 135 LLTKLKETAENSLKKPVTDCVISVP 159



 Score = 62.5 bits (145), Expect = 2e-09
 Identities = 34/94 (36%), Positives = 50/94 (53%), Gaps = 5/94 (5%)
 Frame = +1

Query: 493 ECSYHVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGE-----RNV 657
           +C   VP++F D++R++  DA  I GLN LR++N+ TA A+ YG+ K+         R V
Sbjct: 153 DCVISVPSFFTDAERRSVLDAAQIVGLNCLRLMNDMTAVALNYGIYKQDLPSLDEKPRIV 212

Query: 658 LIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHFG 759
           +  D+G   F VS      G  +V  TA D   G
Sbjct: 213 VFVDMGHSAFQVSACAFNKGKLKVLGTAFDPFLG 246



 Score = 48.4 bits (110), Expect = 3e-05
 Identities = 23/52 (44%), Positives = 33/52 (63%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ 248
           VG+D+G+    + V + G +E IAN+  +R TPS ++F    R IG AAKNQ
Sbjct: 18  VGLDVGSQSCYIAVARAGGIETIANEFSDRCTPSVISFGSKNRTIGVAAKNQ 69


>AC093591-2|AAY40975.1|  839|Homo sapiens unknown protein.
          Length = 839

 Score = 67.3 bits (157), Expect = 6e-11
 Identities = 32/95 (33%), Positives = 54/95 (56%), Gaps = 5/95 (5%)
 Frame = +1

Query: 490 AECSYHVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKK-----GTGERN 654
           A+C   +P++F D++R++   A  ++GLN LR++NE TA A+AYG+ K+         RN
Sbjct: 138 ADCVISIPSFFTDAERRSVMAAAQVAGLNCLRLMNETTAVALAYGIYKQDLPPLDEKPRN 197

Query: 655 VLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHFG 759
           V+  D+G   + V +     G  +V +T  D + G
Sbjct: 198 VVFIDMGHSAYQVLVCAFNKGKLKVLATTFDPYLG 232



 Score = 64.9 bits (151), Expect = 3e-10
 Identities = 35/87 (40%), Positives = 50/87 (57%), Gaps = 1/87 (1%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVS-DGGKPKIKVAYKGEDKTFFPEEVS 433
           N  NTI   K+L GR F+D  VQ +    P+E+     G   +KV Y  E++ F  E+V+
Sbjct: 59  NVRNTIHGFKKLHGRSFDDPIVQTERIRLPYELQKMPNGSAGVKVRYLEEERPFAIEQVT 118

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
            M+L K+KET+E  L K V + VI+ P
Sbjct: 119 GMLLAKLKETSENALKKPVADCVISIP 145



 Score = 46.8 bits (106), Expect = 8e-05
 Identities = 22/53 (41%), Positives = 33/53 (62%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV 251
           VGIDLG     + V + G +E IAN+  +R TP+ ++     R IG+AAK+Q+
Sbjct: 4   VGIDLGFLNCYIAVARSGGIETIANEYSDRCTPACISLGSRTRAIGNAAKSQI 56


>AB003334-1|BAA34780.1|  858|Homo sapiens HSP105 alpha protein.
          Length = 858

 Score = 67.3 bits (157), Expect = 6e-11
 Identities = 35/85 (41%), Positives = 53/85 (62%), Gaps = 1/85 (1%)
 Frame = +2

Query: 263 NNTIFDAKRLIGRKFEDATVQADMKHWPFEVVS-DGGKPKIKVAYKGEDKTFFPEEVSSM 439
           NNT+ + KR  GR F D  +Q + ++  +++V    G   IKV Y GE+  F  E++++M
Sbjct: 61  NNTVSNFKRFHGRAFNDPFIQKEKENLSYDLVPLKNGGVGIKVMYMGEEHLFSVEQITAM 120

Query: 440 VLTKMKETAEAYLGKTVQNAVITFP 514
           +LTK+KETAE  L K V + VI+ P
Sbjct: 121 LLTKLKETAENSLKKPVTDCVISVP 145



 Score = 62.5 bits (145), Expect = 2e-09
 Identities = 34/94 (36%), Positives = 50/94 (53%), Gaps = 5/94 (5%)
 Frame = +1

Query: 493 ECSYHVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGE-----RNV 657
           +C   VP++F D++R++  DA  I GLN LR++N+ TA A+ YG+ K+         R V
Sbjct: 139 DCVISVPSFFTDAERRSVLDAAQIVGLNCLRLMNDMTAVALNYGIYKQDLPSLDEKPRIV 198

Query: 658 LIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHFG 759
           +  D+G   F VS      G  +V  TA D   G
Sbjct: 199 VFVDMGHSAFQVSACAFNKGKLKVLGTAFDPFLG 232



 Score = 48.4 bits (110), Expect = 3e-05
 Identities = 23/52 (44%), Positives = 33/52 (63%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ 248
           VG+D+G+    + V + G +E IAN+  +R TPS ++F    R IG AAKNQ
Sbjct: 4   VGLDVGSQSCYIAVARAGGIETIANEFSDRCTPSVISFGSKNRTIGVAAKNQ 55


>AB003333-1|BAA34779.1|  814|Homo sapiens HSP105 beta protein.
          Length = 814

 Score = 67.3 bits (157), Expect = 6e-11
 Identities = 35/85 (41%), Positives = 53/85 (62%), Gaps = 1/85 (1%)
 Frame = +2

Query: 263 NNTIFDAKRLIGRKFEDATVQADMKHWPFEVVS-DGGKPKIKVAYKGEDKTFFPEEVSSM 439
           NNT+ + KR  GR F D  +Q + ++  +++V    G   IKV Y GE+  F  E++++M
Sbjct: 61  NNTVSNFKRFHGRAFNDPFIQKEKENLSYDLVPLKNGGVGIKVMYMGEEHLFSVEQITAM 120

Query: 440 VLTKMKETAEAYLGKTVQNAVITFP 514
           +LTK+KETAE  L K V + VI+ P
Sbjct: 121 LLTKLKETAENSLKKPVTDCVISVP 145



 Score = 62.5 bits (145), Expect = 2e-09
 Identities = 34/94 (36%), Positives = 50/94 (53%), Gaps = 5/94 (5%)
 Frame = +1

Query: 493 ECSYHVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGE-----RNV 657
           +C   VP++F D++R++  DA  I GLN LR++N+ TA A+ YG+ K+         R V
Sbjct: 139 DCVISVPSFFTDAERRSVLDAAQIVGLNCLRLMNDMTAVALNYGIYKQDLPSLDEKPRIV 198

Query: 658 LIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHFG 759
           +  D+G   F VS      G  +V  TA D   G
Sbjct: 199 VFVDMGHSAFQVSACAFNKGKLKVLGTAFDPFLG 232



 Score = 48.4 bits (110), Expect = 3e-05
 Identities = 23/52 (44%), Positives = 33/52 (63%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ 248
           VG+D+G+    + V + G +E IAN+  +R TPS ++F    R IG AAKNQ
Sbjct: 4   VGLDVGSQSCYIAVARAGGIETIANEFSDRCTPSVISFGSKNRTIGVAAKNQ 55


>BC108738-1|AAI08739.1|   88|Homo sapiens HSPA14 protein protein.
          Length = 88

 Score = 59.7 bits (138), Expect = 1e-08
 Identities = 23/51 (45%), Positives = 38/51 (74%)
 Frame = +3

Query: 90  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAK 242
           A+G+ LG T +CV V++ G+  ++AND G+R TP+ VA+++ E ++G AAK
Sbjct: 3   AIGVHLGCTSACVAVYKDGRAGVVANDAGDRVTPAVVAYSENEEIVGLAAK 53


>BC065281-1|AAH65281.1|   88|Homo sapiens HSPA14 protein protein.
          Length = 88

 Score = 59.7 bits (138), Expect = 1e-08
 Identities = 23/51 (45%), Positives = 38/51 (74%)
 Frame = +3

Query: 90  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAK 242
           A+G+ LG T +CV V++ G+  ++AND G+R TP+ VA+++ E ++G AAK
Sbjct: 3   AIGVHLGCTSACVAVYKDGRAGVVANDAGDRVTPAVVAYSENEEIVGLAAK 53


>AL137142-3|CAI12429.1|  817|Homo sapiens heat shock 105kDa/110kDa
           protein 1 protein.
          Length = 817

 Score = 59.7 bits (138), Expect = 1e-08
 Identities = 33/89 (37%), Positives = 48/89 (53%), Gaps = 5/89 (5%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGE-----RNVLIFDL 672
           VP++F D++R++  DA  I GLN LR++N+ TA A+ YG+ K+         R V+  D+
Sbjct: 103 VPSFFTDAERRSVLDAAQIVGLNCLRLMNDMTAVALNYGIYKQDLPSLDEKPRIVVFVDM 162

Query: 673 GGGTFDVSILTIEDGIFEVKSTAGDTHFG 759
           G   F VS      G  +V  TA D   G
Sbjct: 163 GHSAFQVSACAFNKGKLKVLGTAFDPFLG 191



 Score = 48.4 bits (110), Expect = 3e-05
 Identities = 23/52 (44%), Positives = 33/52 (63%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ 248
           VG+D+G+    + V + G +E IAN+  +R TPS ++F    R IG AAKNQ
Sbjct: 4   VGLDVGSQSCYIAVARAGGIETIANEFSDRCTPSVISFGSKNRTIGVAAKNQ 55


>U65785-1|AAC50947.1|  999|Homo sapiens 150 kDa oxygen-regulated
           protein ORP150 protein.
          Length = 999

 Score = 57.6 bits (133), Expect = 5e-08
 Identities = 25/71 (35%), Positives = 48/71 (67%), Gaps = 3/71 (4%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKK---GTGERNVLIFDLGG 678
           VP +FN ++R+A   A  ++GL VL++IN+ TA A++YG+ ++    T  +N++ +D+G 
Sbjct: 176 VPVFFNQAERRAVLQAARMAGLKVLQLINDNTATALSYGVFRRKDINTTAQNIMFYDMGS 235

Query: 679 GTFDVSILTIE 711
           G+   +I+T +
Sbjct: 236 GSTVCTIVTYQ 246



 Score = 36.3 bits (80), Expect = 0.12
 Identities = 24/87 (27%), Positives = 43/87 (49%), Gaps = 1/87 (1%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWP-FEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           NP  T+   + L+G++ ++  V      +P  E+  D  +  +      + + F PEEV 
Sbjct: 92  NPKATLRYFQHLLGKQADNPHVALYQARFPEHELTFDPQRQTVHFQISSQLQ-FSPEEVL 150

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
            MVL   +  AE +  + +++AVIT P
Sbjct: 151 GMVLNYSRSLAEDFAEQPIKDAVITVP 177



 Score = 35.9 bits (79), Expect = 0.16
 Identities = 18/58 (31%), Positives = 29/58 (50%), Gaps = 1/58 (1%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHG-KVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           + +DLG+    V + + G  +EI+ N +  R TP  V   + ER  GD+A +     P
Sbjct: 36  MSVDLGSESMKVAIVKPGVPMEIVLNKESRRKTPVIVTLKENERFFGDSAASMAIKNP 93


>DQ372932-1|ABD14370.1|  999|Homo sapiens 150 kDa oxygen-regulated
           protein variant 1 protein.
          Length = 999

 Score = 57.6 bits (133), Expect = 5e-08
 Identities = 25/71 (35%), Positives = 48/71 (67%), Gaps = 3/71 (4%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKK---GTGERNVLIFDLGG 678
           VP +FN ++R+A   A  ++GL VL++IN+ TA A++YG+ ++    T  +N++ +D+G 
Sbjct: 176 VPVFFNQAERRAVLQAARMAGLKVLQLINDNTATALSYGVFRRKDINTTAQNIMFYDMGS 235

Query: 679 GTFDVSILTIE 711
           G+   +I+T +
Sbjct: 236 GSTVCTIVTYQ 246



 Score = 36.3 bits (80), Expect = 0.12
 Identities = 24/87 (27%), Positives = 43/87 (49%), Gaps = 1/87 (1%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWP-FEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           NP  T+   + L+G++ ++  V      +P  E+  D  +  +      + + F PEEV 
Sbjct: 92  NPKATLRYFQHLLGKQADNPHVALYQARFPEHELTFDPQRQTVHFQISSQLQ-FSPEEVL 150

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
            MVL   +  AE +  + +++AVIT P
Sbjct: 151 GMVLNYSRSLAEDFAEQPIKDAVITVP 177



 Score = 35.9 bits (79), Expect = 0.16
 Identities = 18/58 (31%), Positives = 29/58 (50%), Gaps = 1/58 (1%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHG-KVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           + +DLG+    V + + G  +EI+ N +  R TP  V   + ER  GD+A +     P
Sbjct: 36  MSVDLGSESMKVAIVKPGVPMEIVLNKESRRKTPVIVTLKENERFFGDSAASMAIKNP 93


>DQ350134-1|ABC75106.1|  999|Homo sapiens 150 kDa oxygen-regulated
           protein protein.
          Length = 999

 Score = 57.6 bits (133), Expect = 5e-08
 Identities = 25/71 (35%), Positives = 48/71 (67%), Gaps = 3/71 (4%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKK---GTGERNVLIFDLGG 678
           VP +FN ++R+A   A  ++GL VL++IN+ TA A++YG+ ++    T  +N++ +D+G 
Sbjct: 176 VPVFFNQAERRAVLQAARMAGLKVLQLINDNTATALSYGVFRRKDINTTAQNIMFYDMGS 235

Query: 679 GTFDVSILTIE 711
           G+   +I+T +
Sbjct: 236 GSTVCTIVTYQ 246



 Score = 36.3 bits (80), Expect = 0.12
 Identities = 24/87 (27%), Positives = 43/87 (49%), Gaps = 1/87 (1%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWP-FEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           NP  T+   + L+G++ ++  V      +P  E+  D  +  +      + + F PEEV 
Sbjct: 92  NPKATLRYFQHLLGKQADNPHVALYQARFPEHELTFDPQRQTVHFQISSQLQ-FSPEEVL 150

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
            MVL   +  AE +  + +++AVIT P
Sbjct: 151 GMVLNYSRSLAEDFAEQPIKDAVITVP 177



 Score = 35.9 bits (79), Expect = 0.16
 Identities = 18/58 (31%), Positives = 29/58 (50%), Gaps = 1/58 (1%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHG-KVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           + +DLG+    V + + G  +EI+ N +  R TP  V   + ER  GD+A +     P
Sbjct: 36  MSVDLGSESMKVAIVKPGVPMEIVLNKESRRKTPVIVTLKENERFFGDSAASMAIKNP 93


>BC072436-1|AAH72436.1|  678|Homo sapiens HYOU1 protein protein.
          Length = 678

 Score = 57.6 bits (133), Expect = 5e-08
 Identities = 25/71 (35%), Positives = 48/71 (67%), Gaps = 3/71 (4%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKK---GTGERNVLIFDLGG 678
           VP +FN ++R+A   A  ++GL VL++IN+ TA A++YG+ ++    T  +N++ +D+G 
Sbjct: 176 VPVFFNQAERRAVLQAARMAGLKVLQLINDNTATALSYGVFRRKDINTTAQNIMFYDMGS 235

Query: 679 GTFDVSILTIE 711
           G+   +I+T +
Sbjct: 236 GSTVCTIVTYQ 246



 Score = 36.3 bits (80), Expect = 0.12
 Identities = 24/87 (27%), Positives = 43/87 (49%), Gaps = 1/87 (1%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWP-FEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           NP  T+   + L+G++ ++  V      +P  E+  D  +  +      + + F PEEV 
Sbjct: 92  NPKATLRYFQHLLGKQADNPHVALYQARFPEHELTFDPQRQTVHFQISSQLQ-FSPEEVL 150

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
            MVL   +  AE +  + +++AVIT P
Sbjct: 151 GMVLNYSRSLAEDFAEQPIKDAVITVP 177



 Score = 35.9 bits (79), Expect = 0.16
 Identities = 18/58 (31%), Positives = 29/58 (50%), Gaps = 1/58 (1%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHG-KVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           + +DLG+    V + + G  +EI+ N +  R TP  V   + ER  GD+A +     P
Sbjct: 36  MSVDLGSESMKVAIVKPGVPMEIVLNKESRRKTPVIVTLKENERFFGDSAASMAIKNP 93


>BC017726-1|AAH17726.1|  657|Homo sapiens Unknown (protein for
           IMAGE:3898847) protein.
          Length = 657

 Score = 57.6 bits (133), Expect = 5e-08
 Identities = 25/71 (35%), Positives = 48/71 (67%), Gaps = 3/71 (4%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKK---GTGERNVLIFDLGG 678
           VP +FN ++R+A   A  ++GL VL++IN+ TA A++YG+ ++    T  +N++ +D+G 
Sbjct: 176 VPVFFNQAERRAVLQAARMAGLKVLQLINDNTATALSYGVFRRKDINTTAQNIMFYDMGS 235

Query: 679 GTFDVSILTIE 711
           G+   +I+T +
Sbjct: 236 GSTVCTIVTYQ 246



 Score = 36.3 bits (80), Expect = 0.12
 Identities = 24/87 (27%), Positives = 43/87 (49%), Gaps = 1/87 (1%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWP-FEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           NP  T+   + L+G++ ++  V      +P  E+  D  +  +      + + F PEEV 
Sbjct: 92  NPKATLRYFQHLLGKQADNPHVALYQARFPEHELTFDPQRQTVHFQISSQLQ-FSPEEVL 150

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
            MVL   +  AE +  + +++AVIT P
Sbjct: 151 GMVLNYSRSLAEDFAEQPIKDAVITVP 177



 Score = 35.9 bits (79), Expect = 0.16
 Identities = 18/58 (31%), Positives = 29/58 (50%), Gaps = 1/58 (1%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHG-KVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           + +DLG+    V + + G  +EI+ N +  R TP  V   + ER  GD+A +     P
Sbjct: 36  MSVDLGSESMKVAIVKPGVPMEIVLNKESRRKTPVIVTLKENERFFGDSAASMAIKNP 93


>AK222756-1|BAD96476.1|  999|Homo sapiens oxygen regulated protein
           precursor variant protein.
          Length = 999

 Score = 57.6 bits (133), Expect = 5e-08
 Identities = 25/71 (35%), Positives = 48/71 (67%), Gaps = 3/71 (4%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKK---GTGERNVLIFDLGG 678
           VP +FN ++R+A   A  ++GL VL++IN+ TA A++YG+ ++    T  +N++ +D+G 
Sbjct: 176 VPVFFNQAERRAVLQAARMAGLKVLQLINDNTATALSYGVFRRKDINTTAQNIMFYDMGS 235

Query: 679 GTFDVSILTIE 711
           G+   +I+T +
Sbjct: 236 GSTVCTIVTYQ 246



 Score = 35.5 bits (78), Expect = 0.21
 Identities = 18/58 (31%), Positives = 29/58 (50%), Gaps = 1/58 (1%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHG-KVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           + +DLG+    V + + G  +EI+ N +  R TP  V   + ER  GD+A +     P
Sbjct: 36  MSVDLGSESMKVAIVKPGVPMEIVLNKESRRKTPVIVTLEENERFFGDSAASMAIKDP 93



 Score = 34.3 bits (75), Expect = 0.48
 Identities = 23/87 (26%), Positives = 43/87 (49%), Gaps = 1/87 (1%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWP-FEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +P  T+   + L+G++ ++  V      +P  E+  D  +  +      + + F PEEV 
Sbjct: 92  DPKATLRYFQHLLGKQADNPHVALYQARFPEHELTFDPQRQTVHFQISSQLQ-FSPEEVL 150

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
            MVL   +  AE +  + +++AVIT P
Sbjct: 151 GMVLNYSRSLAEDFAEQPIKDAVITVP 177


>BT007375-1|AAP36039.1|  148|Homo sapiens heat shock protein, 110
           kDa protein.
          Length = 148

 Score = 48.0 bits (109), Expect = 4e-05
 Identities = 25/53 (47%), Positives = 33/53 (62%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV 251
           VGIDLG     V V + G +E IAN+  +R TP+ ++F    R IG AAK+QV
Sbjct: 4   VGIDLGFQSCYVAVARAGGIETIANEYSDRCTPACISFGPKNRSIGAAAKSQV 56



 Score = 33.1 bits (72), Expect = 1.1
 Identities = 18/52 (34%), Positives = 27/52 (51%), Gaps = 1/52 (1%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVS-DGGKPKIKVAYKGEDK 409
           N  NT+   KR  GR F D  V+A+  +  +++V    G   IKV Y  E++
Sbjct: 59  NAKNTVQGFKRFHGRAFSDPFVEAEKSNLAYDIVQLPTGLTGIKVTYMEEEQ 110


>BC002526-1|AAH02526.1|  148|Homo sapiens heat shock 70kDa protein 4
           protein.
          Length = 148

 Score = 48.0 bits (109), Expect = 4e-05
 Identities = 25/53 (47%), Positives = 33/53 (62%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV 251
           VGIDLG     V V + G +E IAN+  +R TP+ ++F    R IG AAK+QV
Sbjct: 4   VGIDLGFQSCYVAVARAGGIETIANEYSDRCTPACISFGPKNRSIGAAAKSQV 56



 Score = 33.1 bits (72), Expect = 1.1
 Identities = 18/52 (34%), Positives = 27/52 (51%), Gaps = 1/52 (1%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVS-DGGKPKIKVAYKGEDK 409
           N  NT+   KR  GR F D  V+A+  +  +++V    G   IKV Y  E++
Sbjct: 59  NAKNTVQGFKRFHGRAFSDPFVEAEKSNLAYDIVQLPTGLTGIKVTYMEEEQ 110


>X04676-1|CAA28381.1|   22|Homo sapiens protein ( Human hsp 70 gene
           5' region for 70 kDa heat shock protein. ).
          Length = 22

 Score = 46.8 bits (106), Expect = 8e-05
 Identities = 21/22 (95%), Positives = 21/22 (95%)
 Frame = +3

Query: 75  MAKAPAVGIDLGTTYSCVGVFQ 140
           MAKA AVGIDLGTTYSCVGVFQ
Sbjct: 1   MAKAAAVGIDLGTTYSCVGVFQ 22


>BC004560-1|AAH04560.1|  147|Homo sapiens HYOU1 protein protein.
          Length = 147

 Score = 35.9 bits (79), Expect = 0.16
 Identities = 18/58 (31%), Positives = 29/58 (50%), Gaps = 1/58 (1%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHG-KVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           + +DLG+    V + + G  +EI+ N +  R TP  V   + ER  GD+A +     P
Sbjct: 36  MSVDLGSESMKVAIVKPGVPMEIVLNKESRRKTPVIVTLKENERFFGDSAASMAIKNP 93


>BC103893-1|AAI03894.1|  346|Homo sapiens MAGEC3 protein protein.
          Length = 346

 Score = 32.7 bits (71), Expect = 1.5
 Identities = 18/35 (51%), Positives = 25/35 (71%)
 Frame = -1

Query: 471 ASAVSFIFVSTMELTSSGKKVLSSPLYATLILGLP 367
           +S+  F+F S+  L+SS    LSSPL +TLILG+P
Sbjct: 44  SSSFHFLFPSSSSLSSSSP--LSSPLPSTLILGVP 76


>AB208990-1|BAD92227.1|  415|Homo sapiens apolipoprotein L2 variant
           protein.
          Length = 415

 Score = 32.3 bits (70), Expect = 2.0
 Identities = 20/66 (30%), Positives = 36/66 (54%), Gaps = 2/66 (3%)
 Frame = +1

Query: 553 AGTISGL--NVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTFDVSILTIEDGIFE 726
           A  ++G+  +V+ ++N+  A A A  LD+ GT    V+   +GG T   ++LT+ D  ++
Sbjct: 236 AAAVAGITCSVVELVNKLRARAQARNLDRSGTNVAKVMKEFVGGNT--PNVLTLVDNWYQ 293

Query: 727 VKSTAG 744
           V    G
Sbjct: 294 VTQGIG 299


>BC105604-1|AAI05605.1|  196|Homo sapiens SR140 protein protein.
          Length = 196

 Score = 30.7 bits (66), Expect = 6.0
 Identities = 21/69 (30%), Positives = 37/69 (53%)
 Frame = +1

Query: 139 STGRWRSSPTTRATGPLRLMLRSQTPSVSSEMPPRTRWREPQQHNIRCQTSHRT*VRRCY 318
           ++ + RSS    ++G     + +  PS  S+MP RTR + P++HN R +++     R   
Sbjct: 12  ASSKTRSSDV-HSSGSSDAHMDASGPS-DSDMPSRTRPKSPRKHNYRNESA-----RESL 64

Query: 319 CASRHEALA 345
           C S H+ L+
Sbjct: 65  CDSPHQNLS 73


>BC016323-1|AAH16323.1|  202|Homo sapiens Unknown (protein for
           IMAGE:4092985) protein.
          Length = 202

 Score = 30.7 bits (66), Expect = 6.0
 Identities = 21/69 (30%), Positives = 37/69 (53%)
 Frame = +1

Query: 139 STGRWRSSPTTRATGPLRLMLRSQTPSVSSEMPPRTRWREPQQHNIRCQTSHRT*VRRCY 318
           ++ + RSS    ++G     + +  PS  S+MP RTR + P++HN R +++     R   
Sbjct: 12  ASSKTRSSDV-HSSGSSDAHMDASGPS-DSDMPSRTRPKSPRKHNYRNESA-----RESL 64

Query: 319 CASRHEALA 345
           C S H+ L+
Sbjct: 65  CDSPHQNLS 73


>BC006474-1|AAH06474.1| 1027|Homo sapiens Unknown (protein for
           IMAGE:2820942) protein.
          Length = 1027

 Score = 30.7 bits (66), Expect = 6.0
 Identities = 21/69 (30%), Positives = 37/69 (53%)
 Frame = +1

Query: 139 STGRWRSSPTTRATGPLRLMLRSQTPSVSSEMPPRTRWREPQQHNIRCQTSHRT*VRRCY 318
           ++ + RSS    ++G     + +  PS  S+MP RTR + P++HN R +++     R   
Sbjct: 11  ASSKTRSSDV-HSSGSSDAHMDASGPS-DSDMPSRTRPKSPRKHNYRNESA-----RESL 63

Query: 319 CASRHEALA 345
           C S H+ L+
Sbjct: 64  CDSPHQNLS 72


>AY152730-1|AAN75525.1|  665|Homo sapiens Rap1-interacting adaptor
           molecule protein.
          Length = 665

 Score = 30.7 bits (66), Expect = 6.0
 Identities = 15/46 (32%), Positives = 23/46 (50%)
 Frame = -2

Query: 758 PKWVSPAVDFTSKIPSSMVRMDTSKVPPPRSKISTFRSPVPFLSRP 621
           P ++ P  DF    P S   +  S++PPP    +   +PVP  +RP
Sbjct: 573 PDFMEPPPDFVPPPPPSYAGIAGSELPPPPPPPAPAPAPVPDSARP 618


>AB002330-1|BAA20790.1| 1028|Homo sapiens KIAA0332 protein.
          Length = 1028

 Score = 30.7 bits (66), Expect = 6.0
 Identities = 21/69 (30%), Positives = 37/69 (53%)
 Frame = +1

Query: 139 STGRWRSSPTTRATGPLRLMLRSQTPSVSSEMPPRTRWREPQQHNIRCQTSHRT*VRRCY 318
           ++ + RSS    ++G     + +  PS  S+MP RTR + P++HN R +++     R   
Sbjct: 11  ASSKTRSSDV-HSSGSSDAHMDASGPS-DSDMPSRTRPKSPRKHNYRNESA-----RESL 63

Query: 319 CASRHEALA 345
           C S H+ L+
Sbjct: 64  CDSPHQNLS 72


>BC035625-1|AAH35625.1|  499|Homo sapiens EGR2 protein protein.
          Length = 499

 Score = 30.3 bits (65), Expect = 7.9
 Identities = 11/21 (52%), Positives = 15/21 (71%)
 Frame = -2

Query: 698 MDTSKVPPPRSKISTFRSPVP 636
           +DT +VPPP + +ST R P P
Sbjct: 253 LDTLRVPPPLTPLSTIRKPFP 273


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 122,750,762
Number of Sequences: 237096
Number of extensions: 2870144
Number of successful extensions: 8835
Number of sequences better than 10.0: 122
Number of HSP's better than 10.0 without gapping: 7926
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 8717
length of database: 76,859,062
effective HSP length: 88
effective length of database: 55,994,614
effective search space used: 9183116696
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -