SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20054
         (677 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

X87852-1|CAA61132.1| 1871|Homo sapiens SEX protein protein.           103   4e-22
BX936365-2|CAI43194.1| 1871|Homo sapiens plexin A3 protein.           103   4e-22
X87831-1|CAB57275.1| 1328|Homo sapiens OCT/plexin-A2 protein pro...   100   4e-21
BC132676-1|AAI32677.1| 1909|Homo sapiens PLXNA2 protein protein.      100   4e-21
BC009343-1|AAH09343.2|  810|Homo sapiens PLXNA2 protein protein.      100   4e-21
BC006193-1|AAH06193.2|  451|Homo sapiens PLXNA2 protein protein.      100   4e-21
AL590138-1|CAI39808.1| 1894|Homo sapiens plexin A2 protein.           100   4e-21
AL356275-5|CAI40198.1| 1894|Homo sapiens plexin A2 protein.           100   4e-21
AB007932-1|BAA32308.1| 1963|Homo sapiens KIAA0463 protein protein.    100   4e-21
AB046770-1|BAB13376.3| 1462|Homo sapiens KIAA1550 protein protein.     99   7e-21
AK126101-1|BAC86440.1|  510|Homo sapiens protein ( Homo sapiens ...    99   2e-20
X87832-1|CAB57274.1| 1754|Homo sapiens NOV/plexin-A1 protein pro...    97   4e-20
S76730-1|AAB33781.1|  349|Homo sapiens clone MM1 product protein.      87   5e-17
BX649592-6|CAO03500.1| 1266|Homo sapiens plexin B2 protein.            87   5e-17
BX649592-4|CAO03498.1| 1838|Homo sapiens plexin B2 protein.            87   5e-17
BT006887-1|AAP35533.1|  470|Homo sapiens plexin B2 protein.            87   5e-17
BC004542-1|AAH04542.2|  475|Homo sapiens PLXNB2 protein protein.       87   5e-17
AB075511-1|BAE45757.1|  905|Homo sapiens putative protein produc...    87   5e-17
AB002313-1|BAA21571.1| 1841|Homo sapiens KIAA0315 protein.             87   5e-17
X87904-1|CAB57277.1| 2135|Homo sapiens semaphorin receptor protein.    81   3e-15
BC146793-1|AAI46794.1| 2135|Homo sapiens plexin B1 protein.            81   3e-15
AJ011415-1|CAB56222.1| 1952|Homo sapiens plexin-B1/SEP receptor ...    81   3e-15
AB007867-1|BAA23703.2| 2143|Homo sapiens KIAA0407 protein.             81   3e-15
AF149019-1|AAG01376.1| 1909|Homo sapiens plexin-B3 protein.            76   1e-13
AB033032-1|BAA86520.1| 1912|Homo sapiens KIAA1206 protein protein.     76   1e-13
AK095606-1|BAC04587.1|  344|Homo sapiens protein ( Homo sapiens ...    74   4e-13
BC150280-1|AAI50281.1| 1925|Homo sapiens plexin D1 protein.            73   9e-13
BC011848-1|AAH11848.1|  323|Homo sapiens PLXND1 protein protein.       73   9e-13
BC003526-1|AAH03526.1|  540|Homo sapiens Unknown (protein for IM...    73   9e-13
AY116661-1|AAM49063.1| 1925|Homo sapiens plexin D1 protein.            73   9e-13
AB014520-1|BAA31595.1| 1985|Homo sapiens KIAA0620 protein protein.     73   9e-13
AF030339-1|AAC18823.1| 1568|Homo sapiens VESPR protein.                56   1e-07
AB208934-1|BAD92171.1| 1211|Homo sapiens plexin C1 variant protein.    56   1e-07
BX649592-3|CAO03497.1|  234|Homo sapiens plexin B2 protein.            42   0.003

>X87852-1|CAA61132.1| 1871|Homo sapiens SEX protein protein.
          Length = 1871

 Score =  103 bits (248), Expect = 4e-22
 Identities = 49/84 (58%), Positives = 67/84 (79%), Gaps = 2/84 (2%)
 Frame = +2

Query: 11   FLLFKAIKHQIEKGVVDAITHEARYSLSEEKLLKEQIDYQTVTLHIV--QDEFDEKVQCK 184
            FLL+ AIK Q+EKG +DAIT EARYSLSE+KL+++QIDY+T+TLH V  ++E   +V  K
Sbjct: 1437 FLLYCAIKQQMEKGPIDAITGEARYSLSEDKLIRQQIDYKTLTLHCVCPENEGSAQVPVK 1496

Query: 185  VLDCDSISQVKSKILDALFKNTPF 256
            VL+CDSI+Q K K+LD ++K  P+
Sbjct: 1497 VLNCDSITQAKDKLLDTVYKGIPY 1520



 Score = 72.1 bits (169), Expect = 2e-12
 Identities = 30/64 (46%), Positives = 45/64 (70%)
 Frame = +1

Query: 256  SLRPAVHEVDLEWRHGRGGHVTLQDEDVTTKTLNGWRKLNTLAHYGVKESAIMSLISRQN 435
            S RP   ++DLEWR GR   + LQDEDVTTK    W++LN+LAHY V + ++++L+ +Q 
Sbjct: 1521 SQRPKAEDMDLEWRQGRMTRIILQDEDVTTKIECDWKRLNSLAHYQVTDGSLVALVPKQV 1580

Query: 436  DSFN 447
             ++N
Sbjct: 1581 SAYN 1584


>BX936365-2|CAI43194.1| 1871|Homo sapiens plexin A3 protein.
          Length = 1871

 Score =  103 bits (248), Expect = 4e-22
 Identities = 49/84 (58%), Positives = 67/84 (79%), Gaps = 2/84 (2%)
 Frame = +2

Query: 11   FLLFKAIKHQIEKGVVDAITHEARYSLSEEKLLKEQIDYQTVTLHIV--QDEFDEKVQCK 184
            FLL+ AIK Q+EKG +DAIT EARYSLSE+KL+++QIDY+T+TLH V  ++E   +V  K
Sbjct: 1437 FLLYCAIKQQMEKGPIDAITGEARYSLSEDKLIRQQIDYKTLTLHCVCPENEGSAQVPVK 1496

Query: 185  VLDCDSISQVKSKILDALFKNTPF 256
            VL+CDSI+Q K K+LD ++K  P+
Sbjct: 1497 VLNCDSITQAKDKLLDTVYKGIPY 1520



 Score = 72.1 bits (169), Expect = 2e-12
 Identities = 30/64 (46%), Positives = 45/64 (70%)
 Frame = +1

Query: 256  SLRPAVHEVDLEWRHGRGGHVTLQDEDVTTKTLNGWRKLNTLAHYGVKESAIMSLISRQN 435
            S RP   ++DLEWR GR   + LQDEDVTTK    W++LN+LAHY V + ++++L+ +Q 
Sbjct: 1521 SQRPKAEDMDLEWRQGRMTRIILQDEDVTTKIECDWKRLNSLAHYQVTDGSLVALVPKQV 1580

Query: 436  DSFN 447
             ++N
Sbjct: 1581 SAYN 1584


>X87831-1|CAB57275.1| 1328|Homo sapiens OCT/plexin-A2 protein protein.
          Length = 1328

 Score =  100 bits (240), Expect = 4e-21
 Identities = 47/84 (55%), Positives = 68/84 (80%), Gaps = 2/84 (2%)
 Frame = +2

Query: 11   FLLFKAIKHQIEKGVVDAITHEARYSLSEEKLLKEQIDYQTVTLHIV--QDEFDEKVQCK 184
            F+L+ AIK Q+EKG +DAIT EARYSLSE+KL+++QI+Y+T+ L+ V   +E   ++  K
Sbjct: 1013 FMLYCAIKQQMEKGPIDAITGEARYSLSEDKLIRQQIEYKTLILNCVNPDNENSPEIPVK 1072

Query: 185  VLDCDSISQVKSKILDALFKNTPF 256
            VL+CD+I+QVK KILDA++KN P+
Sbjct: 1073 VLNCDTITQVKEKILDAVYKNVPY 1096



 Score = 77.8 bits (183), Expect = 3e-14
 Identities = 32/66 (48%), Positives = 45/66 (68%)
 Frame = +1

Query: 256  SLRPAVHEVDLEWRHGRGGHVTLQDEDVTTKTLNGWRKLNTLAHYGVKESAIMSLISRQN 435
            S RP   ++DLEWR GR   V LQDED+TTK    W++LNTL HY V + ++++L+ +Q 
Sbjct: 1097 SQRPRAVDMDLEWRQGRIARVVLQDEDITTKIEGDWKRLNTLMHYQVSDRSVVALVPKQT 1156

Query: 436  DSFNTP 453
             S+N P
Sbjct: 1157 SSYNIP 1162


>BC132676-1|AAI32677.1| 1909|Homo sapiens PLXNA2 protein protein.
          Length = 1909

 Score =  100 bits (240), Expect = 4e-21
 Identities = 47/84 (55%), Positives = 68/84 (80%), Gaps = 2/84 (2%)
 Frame = +2

Query: 11   FLLFKAIKHQIEKGVVDAITHEARYSLSEEKLLKEQIDYQTVTLHIV--QDEFDEKVQCK 184
            F+L+ AIK Q+EKG +DAIT EARYSLSE+KL+++QI+Y+T+ L+ V   +E   ++  K
Sbjct: 1474 FMLYCAIKQQMEKGPIDAITGEARYSLSEDKLIRQQIEYKTLILNCVNPDNENSPEIPVK 1533

Query: 185  VLDCDSISQVKSKILDALFKNTPF 256
            VL+CD+I+QVK KILDA++KN P+
Sbjct: 1534 VLNCDTITQVKEKILDAVYKNVPY 1557



 Score = 77.8 bits (183), Expect = 3e-14
 Identities = 32/66 (48%), Positives = 45/66 (68%)
 Frame = +1

Query: 256  SLRPAVHEVDLEWRHGRGGHVTLQDEDVTTKTLNGWRKLNTLAHYGVKESAIMSLISRQN 435
            S RP   ++DLEWR GR   V LQDED+TTK    W++LNTL HY V + ++++L+ +Q 
Sbjct: 1558 SQRPRAVDMDLEWRQGRIARVVLQDEDITTKIEGDWKRLNTLMHYQVSDRSVVALVPKQT 1617

Query: 436  DSFNTP 453
             S+N P
Sbjct: 1618 SSYNIP 1623


>BC009343-1|AAH09343.2|  810|Homo sapiens PLXNA2 protein protein.
          Length = 810

 Score =  100 bits (240), Expect = 4e-21
 Identities = 47/84 (55%), Positives = 68/84 (80%), Gaps = 2/84 (2%)
 Frame = +2

Query: 11  FLLFKAIKHQIEKGVVDAITHEARYSLSEEKLLKEQIDYQTVTLHIV--QDEFDEKVQCK 184
           F+L+ AIK Q+EKG +DAIT EARYSLSE+KL+++QI+Y+T+ L+ V   +E   ++  K
Sbjct: 375 FMLYCAIKQQMEKGPIDAITGEARYSLSEDKLIRQQIEYKTLILNCVNPDNENSPEIPVK 434

Query: 185 VLDCDSISQVKSKILDALFKNTPF 256
           VL+CD+I+QVK KILDA++KN P+
Sbjct: 435 VLNCDTITQVKEKILDAVYKNVPY 458



 Score = 77.8 bits (183), Expect = 3e-14
 Identities = 32/66 (48%), Positives = 45/66 (68%)
 Frame = +1

Query: 256 SLRPAVHEVDLEWRHGRGGHVTLQDEDVTTKTLNGWRKLNTLAHYGVKESAIMSLISRQN 435
           S RP   ++DLEWR GR   V LQDED+TTK    W++LNTL HY V + ++++L+ +Q 
Sbjct: 459 SQRPRAVDMDLEWRQGRIARVVLQDEDITTKIEGDWKRLNTLMHYQVSDRSVVALVPKQT 518

Query: 436 DSFNTP 453
            S+N P
Sbjct: 519 SSYNIP 524


>BC006193-1|AAH06193.2|  451|Homo sapiens PLXNA2 protein protein.
          Length = 451

 Score =  100 bits (240), Expect = 4e-21
 Identities = 47/84 (55%), Positives = 68/84 (80%), Gaps = 2/84 (2%)
 Frame = +2

Query: 11  FLLFKAIKHQIEKGVVDAITHEARYSLSEEKLLKEQIDYQTVTLHIV--QDEFDEKVQCK 184
           F+L+ AIK Q+EKG +DAIT EARYSLSE+KL+++QI+Y+T+ L+ V   +E   ++  K
Sbjct: 16  FMLYCAIKQQMEKGPIDAITGEARYSLSEDKLIRQQIEYKTLILNCVNPDNENSPEIPVK 75

Query: 185 VLDCDSISQVKSKILDALFKNTPF 256
           VL+CD+I+QVK KILDA++KN P+
Sbjct: 76  VLNCDTITQVKEKILDAVYKNVPY 99



 Score = 77.8 bits (183), Expect = 3e-14
 Identities = 32/66 (48%), Positives = 45/66 (68%)
 Frame = +1

Query: 256 SLRPAVHEVDLEWRHGRGGHVTLQDEDVTTKTLNGWRKLNTLAHYGVKESAIMSLISRQN 435
           S RP   ++DLEWR GR   V LQDED+TTK    W++LNTL HY V + ++++L+ +Q 
Sbjct: 100 SQRPRAVDMDLEWRQGRIARVVLQDEDITTKIEGDWKRLNTLMHYQVSDRSVVALVPKQT 159

Query: 436 DSFNTP 453
            S+N P
Sbjct: 160 SSYNIP 165


>AL590138-1|CAI39808.1| 1894|Homo sapiens plexin A2 protein.
          Length = 1894

 Score =  100 bits (240), Expect = 4e-21
 Identities = 47/84 (55%), Positives = 68/84 (80%), Gaps = 2/84 (2%)
 Frame = +2

Query: 11   FLLFKAIKHQIEKGVVDAITHEARYSLSEEKLLKEQIDYQTVTLHIV--QDEFDEKVQCK 184
            F+L+ AIK Q+EKG +DAIT EARYSLSE+KL+++QI+Y+T+ L+ V   +E   ++  K
Sbjct: 1459 FMLYCAIKQQMEKGPIDAITGEARYSLSEDKLIRQQIEYKTLILNCVNPDNENSPEIPVK 1518

Query: 185  VLDCDSISQVKSKILDALFKNTPF 256
            VL+CD+I+QVK KILDA++KN P+
Sbjct: 1519 VLNCDTITQVKEKILDAVYKNVPY 1542



 Score = 77.8 bits (183), Expect = 3e-14
 Identities = 32/66 (48%), Positives = 45/66 (68%)
 Frame = +1

Query: 256  SLRPAVHEVDLEWRHGRGGHVTLQDEDVTTKTLNGWRKLNTLAHYGVKESAIMSLISRQN 435
            S RP   ++DLEWR GR   V LQDED+TTK    W++LNTL HY V + ++++L+ +Q 
Sbjct: 1543 SQRPRAVDMDLEWRQGRIARVVLQDEDITTKIEGDWKRLNTLMHYQVSDRSVVALVPKQT 1602

Query: 436  DSFNTP 453
             S+N P
Sbjct: 1603 SSYNIP 1608


>AL356275-5|CAI40198.1| 1894|Homo sapiens plexin A2 protein.
          Length = 1894

 Score =  100 bits (240), Expect = 4e-21
 Identities = 47/84 (55%), Positives = 68/84 (80%), Gaps = 2/84 (2%)
 Frame = +2

Query: 11   FLLFKAIKHQIEKGVVDAITHEARYSLSEEKLLKEQIDYQTVTLHIV--QDEFDEKVQCK 184
            F+L+ AIK Q+EKG +DAIT EARYSLSE+KL+++QI+Y+T+ L+ V   +E   ++  K
Sbjct: 1459 FMLYCAIKQQMEKGPIDAITGEARYSLSEDKLIRQQIEYKTLILNCVNPDNENSPEIPVK 1518

Query: 185  VLDCDSISQVKSKILDALFKNTPF 256
            VL+CD+I+QVK KILDA++KN P+
Sbjct: 1519 VLNCDTITQVKEKILDAVYKNVPY 1542



 Score = 77.8 bits (183), Expect = 3e-14
 Identities = 32/66 (48%), Positives = 45/66 (68%)
 Frame = +1

Query: 256  SLRPAVHEVDLEWRHGRGGHVTLQDEDVTTKTLNGWRKLNTLAHYGVKESAIMSLISRQN 435
            S RP   ++DLEWR GR   V LQDED+TTK    W++LNTL HY V + ++++L+ +Q 
Sbjct: 1543 SQRPRAVDMDLEWRQGRIARVVLQDEDITTKIEGDWKRLNTLMHYQVSDRSVVALVPKQT 1602

Query: 436  DSFNTP 453
             S+N P
Sbjct: 1603 SSYNIP 1608


>AB007932-1|BAA32308.1| 1963|Homo sapiens KIAA0463 protein protein.
          Length = 1963

 Score =  100 bits (240), Expect = 4e-21
 Identities = 47/84 (55%), Positives = 68/84 (80%), Gaps = 2/84 (2%)
 Frame = +2

Query: 11   FLLFKAIKHQIEKGVVDAITHEARYSLSEEKLLKEQIDYQTVTLHIV--QDEFDEKVQCK 184
            F+L+ AIK Q+EKG +DAIT EARYSLSE+KL+++QI+Y+T+ L+ V   +E   ++  K
Sbjct: 1528 FMLYCAIKQQMEKGPIDAITGEARYSLSEDKLIRQQIEYKTLILNCVNPDNENSPEIPVK 1587

Query: 185  VLDCDSISQVKSKILDALFKNTPF 256
            VL+CD+I+QVK KILDA++KN P+
Sbjct: 1588 VLNCDTITQVKEKILDAVYKNVPY 1611



 Score = 77.8 bits (183), Expect = 3e-14
 Identities = 32/66 (48%), Positives = 45/66 (68%)
 Frame = +1

Query: 256  SLRPAVHEVDLEWRHGRGGHVTLQDEDVTTKTLNGWRKLNTLAHYGVKESAIMSLISRQN 435
            S RP   ++DLEWR GR   V LQDED+TTK    W++LNTL HY V + ++++L+ +Q 
Sbjct: 1612 SQRPRAVDMDLEWRQGRIARVVLQDEDITTKIEGDWKRLNTLMHYQVSDRSVVALVPKQT 1671

Query: 436  DSFNTP 453
             S+N P
Sbjct: 1672 SSYNIP 1677


>AB046770-1|BAB13376.3| 1462|Homo sapiens KIAA1550 protein protein.
          Length = 1462

 Score =   99 bits (238), Expect = 7e-21
 Identities = 49/83 (59%), Positives = 64/83 (77%), Gaps = 2/83 (2%)
 Frame = +2

Query: 11   FLLFKAIKHQIEKGVVDAITHEARYSLSEEKLLKEQIDYQTVTLHIVQDE--FDEKVQCK 184
            F LF AIK Q+EKG +DAIT EARYSLSE+KL+++QIDY+T+ L  V  +     +V  K
Sbjct: 1027 FSLFCAIKQQMEKGPIDAITGEARYSLSEDKLIRQQIDYKTLVLSCVSPDNANSPEVPVK 1086

Query: 185  VLDCDSISQVKSKILDALFKNTP 253
            +L+CD+I+QVK KILDA+FKN P
Sbjct: 1087 ILNCDTITQVKEKILDAIFKNVP 1109



 Score = 79.0 bits (186), Expect = 1e-14
 Identities = 32/64 (50%), Positives = 47/64 (73%)
 Frame = +1

Query: 256  SLRPAVHEVDLEWRHGRGGHVTLQDEDVTTKTLNGWRKLNTLAHYGVKESAIMSLISRQN 435
            S RP   ++DLEWR G G  + LQDED+TTK  N W++LNTLAHY V + ++++L+S+Q 
Sbjct: 1111 SHRPKAADMDLEWRQGSGARMILQDEDITTKIENDWKRLNTLAHYQVPDGSVVALVSKQV 1170

Query: 436  DSFN 447
             ++N
Sbjct: 1171 TAYN 1174


>AK126101-1|BAC86440.1|  510|Homo sapiens protein ( Homo sapiens
           cDNA FLJ44113 fis, clone TESTI4046487, highly  similar
           to Mus musculus plexin A1 (Plxna1). ).
          Length = 510

 Score = 98.7 bits (235), Expect = 2e-20
 Identities = 46/84 (54%), Positives = 65/84 (77%), Gaps = 2/84 (2%)
 Frame = +2

Query: 11  FLLFKAIKHQIEKGVVDAITHEARYSLSEEKLLKEQIDYQTVTLHIVQDEFDE--KVQCK 184
           F+L+ AIK Q+EKG +DAIT EARYSLSE+KL+++QIDY+T+TL+ V  E +   +V  K
Sbjct: 76  FMLYCAIKQQMEKGPIDAITGEARYSLSEDKLIRQQIDYKTLTLNCVNPENENAPEVPVK 135

Query: 185 VLDCDSISQVKSKILDALFKNTPF 256
            LDCD+++Q K K+LDA +K  P+
Sbjct: 136 GLDCDTVTQAKEKLLDAAYKGVPY 159



 Score = 76.6 bits (180), Expect = 8e-14
 Identities = 32/64 (50%), Positives = 45/64 (70%)
 Frame = +1

Query: 256 SLRPAVHEVDLEWRHGRGGHVTLQDEDVTTKTLNGWRKLNTLAHYGVKESAIMSLISRQN 435
           S RP   ++DLEWR GR   + LQDEDVTTK  N W++LNTLAHY V + + ++L+ +Q 
Sbjct: 160 SQRPKAADMDLEWRQGRMARIILQDEDVTTKIDNDWKRLNTLAHYQVTDGSSVALVPKQT 219

Query: 436 DSFN 447
            ++N
Sbjct: 220 SAYN 223


>X87832-1|CAB57274.1| 1754|Homo sapiens NOV/plexin-A1 protein protein.
          Length = 1754

 Score = 97.5 bits (232), Expect = 4e-20
 Identities = 46/84 (54%), Positives = 64/84 (76%), Gaps = 2/84 (2%)
 Frame = +2

Query: 11   FLLFKAIKHQIEKGVVDAITHEARYSLSEEKLLKEQIDYQTVTLHIVQDEFDE--KVQCK 184
            F+L+ AIK Q+EKG +DAIT EARYSLSE+KL++ QIDY+T+TL+ V  E +   +V  K
Sbjct: 1440 FMLYCAIKQQMEKGPIDAITGEARYSLSEDKLIRXQIDYKTLTLNCVNPENENAPEVPVK 1499

Query: 185  VLDCDSISQVKSKILDALFKNTPF 256
             LDCD+++Q K K+LDA +K  P+
Sbjct: 1500 GLDCDTVTQAKEKLLDAAYKGVPY 1523



 Score = 76.6 bits (180), Expect = 8e-14
 Identities = 32/64 (50%), Positives = 45/64 (70%)
 Frame = +1

Query: 256  SLRPAVHEVDLEWRHGRGGHVTLQDEDVTTKTLNGWRKLNTLAHYGVKESAIMSLISRQN 435
            S RP   ++DLEWR GR   + LQDEDVTTK  N W++LNTLAHY V + + ++L+ +Q 
Sbjct: 1524 SQRPKAADMDLEWRQGRMARIILQDEDVTTKIDNDWKRLNTLAHYQVTDGSSVALVPKQT 1583

Query: 436  DSFN 447
             ++N
Sbjct: 1584 SAYN 1587


>S76730-1|AAB33781.1|  349|Homo sapiens clone MM1 product protein.
          Length = 349

 Score = 87.0 bits (206), Expect = 5e-17
 Identities = 40/82 (48%), Positives = 61/82 (74%), Gaps = 1/82 (1%)
 Frame = +2

Query: 11  FLLFKAIKHQIEKGVVDAITHEARYSLSEEKLLKEQIDYQTVTLH-IVQDEFDEKVQCKV 187
           + LFKAIKHQ+EKG VDA+  +A+Y+L++  LL + ++Y  +T+  IVQDE  + +  KV
Sbjct: 54  YKLFKAIKHQVEKGPVDAVQKKAKYTLNDTGLLGDDVEYAPLTVSVIVQDEGVDAIPVKV 113

Query: 188 LDCDSISQVKSKILDALFKNTP 253
           L+CD+ISQVK KI+D +++  P
Sbjct: 114 LNCDTISQVKEKIIDQVYRGQP 135


>BX649592-6|CAO03500.1| 1266|Homo sapiens plexin B2 protein.
          Length = 1266

 Score = 87.0 bits (206), Expect = 5e-17
 Identities = 40/82 (48%), Positives = 61/82 (74%), Gaps = 1/82 (1%)
 Frame = +2

Query: 11   FLLFKAIKHQIEKGVVDAITHEARYSLSEEKLLKEQIDYQTVTLH-IVQDEFDEKVQCKV 187
            + LFKAIKHQ+EKG VDA+  +A+Y+L++  LL + ++Y  +T+  IVQDE  + +  KV
Sbjct: 850  YKLFKAIKHQVEKGPVDAVQKKAKYTLNDTGLLGDDVEYAPLTVSVIVQDEGVDAIPVKV 909

Query: 188  LDCDSISQVKSKILDALFKNTP 253
            L+CD+ISQVK KI+D +++  P
Sbjct: 910  LNCDTISQVKEKIIDQVYRGQP 931



 Score = 43.2 bits (97), Expect = 9e-04
 Identities = 20/52 (38%), Positives = 30/52 (57%)
 Frame = +1

Query: 265  PAVHEVDLEWRHGRGGHVTLQDEDVTTKTLNGWRKLNTLAHYGVKESAIMSL 420
            P    V LEWR G    + L D D+T++    W+++NTL HY V++ A + L
Sbjct: 936  PRPDSVVLEWRPGSTAQI-LSDLDLTSQREGRWKRVNTLMHYNVRDGATLIL 986


>BX649592-4|CAO03498.1| 1838|Homo sapiens plexin B2 protein.
          Length = 1838

 Score = 87.0 bits (206), Expect = 5e-17
 Identities = 40/82 (48%), Positives = 61/82 (74%), Gaps = 1/82 (1%)
 Frame = +2

Query: 11   FLLFKAIKHQIEKGVVDAITHEARYSLSEEKLLKEQIDYQTVTLH-IVQDEFDEKVQCKV 187
            + LFKAIKHQ+EKG VDA+  +A+Y+L++  LL + ++Y  +T+  IVQDE  + +  KV
Sbjct: 1422 YKLFKAIKHQVEKGPVDAVQKKAKYTLNDTGLLGDDVEYAPLTVSVIVQDEGVDAIPVKV 1481

Query: 188  LDCDSISQVKSKILDALFKNTP 253
            L+CD+ISQVK KI+D +++  P
Sbjct: 1482 LNCDTISQVKEKIIDQVYRGQP 1503



 Score = 43.2 bits (97), Expect = 9e-04
 Identities = 20/52 (38%), Positives = 30/52 (57%)
 Frame = +1

Query: 265  PAVHEVDLEWRHGRGGHVTLQDEDVTTKTLNGWRKLNTLAHYGVKESAIMSL 420
            P    V LEWR G    + L D D+T++    W+++NTL HY V++ A + L
Sbjct: 1508 PRPDSVVLEWRPGSTAQI-LSDLDLTSQREGRWKRVNTLMHYNVRDGATLIL 1558


>BT006887-1|AAP35533.1|  470|Homo sapiens plexin B2 protein.
          Length = 470

 Score = 87.0 bits (206), Expect = 5e-17
 Identities = 40/82 (48%), Positives = 61/82 (74%), Gaps = 1/82 (1%)
 Frame = +2

Query: 11  FLLFKAIKHQIEKGVVDAITHEARYSLSEEKLLKEQIDYQTVTLH-IVQDEFDEKVQCKV 187
           + LFKAIKHQ+EKG VDA+  +A+Y+L++  LL + ++Y  +T+  IVQDE  + +  KV
Sbjct: 54  YKLFKAIKHQVEKGPVDAVQKKAKYTLNDTGLLGDDVEYAPLTVSVIVQDEGVDAIPVKV 113

Query: 188 LDCDSISQVKSKILDALFKNTP 253
           L+CD+ISQVK KI+D +++  P
Sbjct: 114 LNCDTISQVKEKIIDQVYRGQP 135



 Score = 43.2 bits (97), Expect = 9e-04
 Identities = 20/52 (38%), Positives = 30/52 (57%)
 Frame = +1

Query: 265 PAVHEVDLEWRHGRGGHVTLQDEDVTTKTLNGWRKLNTLAHYGVKESAIMSL 420
           P    V LEWR G    + L D D+T++    W+++NTL HY V++ A + L
Sbjct: 140 PRPDSVVLEWRPGSTAQI-LSDLDLTSQQEGRWKRVNTLMHYNVRDGATLIL 190


>BC004542-1|AAH04542.2|  475|Homo sapiens PLXNB2 protein protein.
          Length = 475

 Score = 87.0 bits (206), Expect = 5e-17
 Identities = 40/82 (48%), Positives = 61/82 (74%), Gaps = 1/82 (1%)
 Frame = +2

Query: 11  FLLFKAIKHQIEKGVVDAITHEARYSLSEEKLLKEQIDYQTVTLH-IVQDEFDEKVQCKV 187
           + LFKAIKHQ+EKG VDA+  +A+Y+L++  LL + ++Y  +T+  IVQDE  + +  KV
Sbjct: 59  YKLFKAIKHQVEKGPVDAVQKKAKYTLNDTGLLGDDVEYAPLTVSVIVQDEGVDAIPVKV 118

Query: 188 LDCDSISQVKSKILDALFKNTP 253
           L+CD+ISQVK KI+D +++  P
Sbjct: 119 LNCDTISQVKEKIIDQVYRGQP 140



 Score = 43.2 bits (97), Expect = 9e-04
 Identities = 20/52 (38%), Positives = 30/52 (57%)
 Frame = +1

Query: 265 PAVHEVDLEWRHGRGGHVTLQDEDVTTKTLNGWRKLNTLAHYGVKESAIMSL 420
           P    V LEWR G    + L D D+T++    W+++NTL HY V++ A + L
Sbjct: 145 PRPDSVVLEWRPGSTAQI-LSDLDLTSQQEGRWKRVNTLMHYNVRDGATLIL 195


>AB075511-1|BAE45757.1|  905|Homo sapiens putative protein product
           of Nbla00445 protein.
          Length = 905

 Score = 87.0 bits (206), Expect = 5e-17
 Identities = 40/82 (48%), Positives = 61/82 (74%), Gaps = 1/82 (1%)
 Frame = +2

Query: 11  FLLFKAIKHQIEKGVVDAITHEARYSLSEEKLLKEQIDYQTVTLH-IVQDEFDEKVQCKV 187
           + LFKAIKHQ+EKG VDA+  +A+Y+L++  LL + ++Y  +T+  IVQDE  + +  KV
Sbjct: 489 YKLFKAIKHQVEKGPVDAVQKKAKYTLNDTGLLGDDVEYAPLTVSVIVQDEGVDAIPVKV 548

Query: 188 LDCDSISQVKSKILDALFKNTP 253
           L+CD+ISQVK KI+D +++  P
Sbjct: 549 LNCDTISQVKEKIIDQVYRGQP 570



 Score = 43.6 bits (98), Expect = 7e-04
 Identities = 21/52 (40%), Positives = 30/52 (57%)
 Frame = +1

Query: 265 PAVHEVDLEWRHGRGGHVTLQDEDVTTKTLNGWRKLNTLAHYGVKESAIMSL 420
           P    V LEWR G    V L D D+T++    W+++NTL HY V++ A + L
Sbjct: 575 PRPDSVVLEWRPGSTAQV-LSDLDLTSQREGRWKRVNTLMHYNVRDGATLIL 625


>AB002313-1|BAA21571.1| 1841|Homo sapiens KIAA0315 protein.
          Length = 1841

 Score = 87.0 bits (206), Expect = 5e-17
 Identities = 40/82 (48%), Positives = 61/82 (74%), Gaps = 1/82 (1%)
 Frame = +2

Query: 11   FLLFKAIKHQIEKGVVDAITHEARYSLSEEKLLKEQIDYQTVTLH-IVQDEFDEKVQCKV 187
            + LFKAIKHQ+EKG VDA+  +A+Y+L++  LL + ++Y  +T+  IVQDE  + +  KV
Sbjct: 1425 YKLFKAIKHQVEKGPVDAVQKKAKYTLNDTGLLGDDVEYAPLTVSVIVQDEGVDAIPVKV 1484

Query: 188  LDCDSISQVKSKILDALFKNTP 253
            L+CD+ISQVK KI+D +++  P
Sbjct: 1485 LNCDTISQVKEKIIDQVYRGQP 1506



 Score = 43.2 bits (97), Expect = 9e-04
 Identities = 20/52 (38%), Positives = 30/52 (57%)
 Frame = +1

Query: 265  PAVHEVDLEWRHGRGGHVTLQDEDVTTKTLNGWRKLNTLAHYGVKESAIMSL 420
            P    V LEWR G    + L D D+T++    W+++NTL HY V++ A + L
Sbjct: 1511 PRPDSVVLEWRPGSTAQI-LSDLDLTSQREGRWKRVNTLMHYNVRDGATLIL 1561


>X87904-1|CAB57277.1| 2135|Homo sapiens semaphorin receptor protein.
          Length = 2135

 Score = 81.4 bits (192), Expect = 3e-15
 Identities = 37/86 (43%), Positives = 61/86 (70%), Gaps = 5/86 (5%)
 Frame = +2

Query: 11   FLLFKAIKHQIEKGVVDAITHEARYSLSEEKLLKEQIDYQTVTLHIVQDEFD-----EKV 175
            ++LF+ IKHQ++KG VD++T +A+Y+L++ +LL+E ++Y+ +TL+ +          + V
Sbjct: 1708 YMLFRGIKHQVDKGPVDSVTGKAKYTLNDNRLLREDVEYRPLTLNALLAVGPGAGEAQGV 1767

Query: 176  QCKVLDCDSISQVKSKILDALFKNTP 253
              KVLDCD+ISQ K K+LD L+K  P
Sbjct: 1768 PVKVLDCDTISQAKEKMLDQLYKGVP 1793



 Score = 62.5 bits (145), Expect = 1e-09
 Identities = 26/57 (45%), Positives = 38/57 (66%)
 Frame = +1

Query: 253  ISLRPAVHEVDLEWRHGRGGHVTLQDEDVTTKTLNGWRKLNTLAHYGVKESAIMSLI 423
            ++ RP    +D+EWR G  GH+ L DEDVT++    WR+LNTL HY V + A ++L+
Sbjct: 1794 LTQRPDPRTLDVEWRSGVAGHLILSDEDVTSEVQGLWRRLNTLQHYKVPDGATVALV 1850


>BC146793-1|AAI46794.1| 2135|Homo sapiens plexin B1 protein.
          Length = 2135

 Score = 81.4 bits (192), Expect = 3e-15
 Identities = 37/86 (43%), Positives = 61/86 (70%), Gaps = 5/86 (5%)
 Frame = +2

Query: 11   FLLFKAIKHQIEKGVVDAITHEARYSLSEEKLLKEQIDYQTVTLHIVQDEFD-----EKV 175
            ++LF+ IKHQ++KG VD++T +A+Y+L++ +LL+E ++Y+ +TL+ +          + V
Sbjct: 1708 YMLFRGIKHQVDKGPVDSVTGKAKYTLNDNRLLREDVEYRPLTLNALLAVGPGAGEAQGV 1767

Query: 176  QCKVLDCDSISQVKSKILDALFKNTP 253
              KVLDCD+ISQ K K+LD L+K  P
Sbjct: 1768 PVKVLDCDTISQAKEKMLDQLYKGVP 1793



 Score = 62.5 bits (145), Expect = 1e-09
 Identities = 26/57 (45%), Positives = 38/57 (66%)
 Frame = +1

Query: 253  ISLRPAVHEVDLEWRHGRGGHVTLQDEDVTTKTLNGWRKLNTLAHYGVKESAIMSLI 423
            ++ RP    +D+EWR G  GH+ L DEDVT++    WR+LNTL HY V + A ++L+
Sbjct: 1794 LTQRPDPRTLDVEWRSGVAGHLILSDEDVTSEVQGLWRRLNTLQHYKVPDGATVALV 1850


>AJ011415-1|CAB56222.1| 1952|Homo sapiens plexin-B1/SEP receptor
            protein.
          Length = 1952

 Score = 81.4 bits (192), Expect = 3e-15
 Identities = 37/86 (43%), Positives = 61/86 (70%), Gaps = 5/86 (5%)
 Frame = +2

Query: 11   FLLFKAIKHQIEKGVVDAITHEARYSLSEEKLLKEQIDYQTVTLHIVQDEFD-----EKV 175
            ++LF+ IKHQ++KG VD++T +A+Y+L++ +LL+E ++Y+ +TL+ +          + V
Sbjct: 1525 YMLFRGIKHQVDKGPVDSVTGKAKYTLNDNRLLREDVEYRPLTLNALLAVGPGAGEAQGV 1584

Query: 176  QCKVLDCDSISQVKSKILDALFKNTP 253
              KVLDCD+ISQ K K+LD L+K  P
Sbjct: 1585 PVKVLDCDTISQAKEKMLDQLYKGVP 1610



 Score = 62.5 bits (145), Expect = 1e-09
 Identities = 26/57 (45%), Positives = 38/57 (66%)
 Frame = +1

Query: 253  ISLRPAVHEVDLEWRHGRGGHVTLQDEDVTTKTLNGWRKLNTLAHYGVKESAIMSLI 423
            ++ RP    +D+EWR G  GH+ L DEDVT++    WR+LNTL HY V + A ++L+
Sbjct: 1611 LTQRPDPRTLDVEWRSGVAGHLILSDEDVTSEVQGLWRRLNTLQHYKVPDGATVALV 1667


>AB007867-1|BAA23703.2| 2143|Homo sapiens KIAA0407 protein.
          Length = 2143

 Score = 81.4 bits (192), Expect = 3e-15
 Identities = 37/86 (43%), Positives = 61/86 (70%), Gaps = 5/86 (5%)
 Frame = +2

Query: 11   FLLFKAIKHQIEKGVVDAITHEARYSLSEEKLLKEQIDYQTVTLHIVQDEFD-----EKV 175
            ++LF+ IKHQ++KG VD++T +A+Y+L++ +LL+E ++Y+ +TL+ +          + V
Sbjct: 1716 YMLFRGIKHQVDKGPVDSVTGKAKYTLNDNRLLREDVEYRPLTLNALLAVGPGAGEAQGV 1775

Query: 176  QCKVLDCDSISQVKSKILDALFKNTP 253
              KVLDCD+ISQ K K+LD L+K  P
Sbjct: 1776 PVKVLDCDTISQAKEKMLDQLYKGVP 1801



 Score = 62.5 bits (145), Expect = 1e-09
 Identities = 26/57 (45%), Positives = 38/57 (66%)
 Frame = +1

Query: 253  ISLRPAVHEVDLEWRHGRGGHVTLQDEDVTTKTLNGWRKLNTLAHYGVKESAIMSLI 423
            ++ RP    +D+EWR G  GH+ L DEDVT++    WR+LNTL HY V + A ++L+
Sbjct: 1802 LTQRPDPRTLDVEWRSGVAGHLILSDEDVTSEVQGLWRRLNTLQHYKVPDGATVALV 1858


>AF149019-1|AAG01376.1| 1909|Homo sapiens plexin-B3 protein.
          Length = 1909

 Score = 75.8 bits (178), Expect = 1e-13
 Identities = 35/91 (38%), Positives = 64/91 (70%), Gaps = 9/91 (9%)
 Frame = +2

Query: 11   FLLFKAIKHQIEKGVVDAITHEARYSLSEEKLLKEQIDYQTVTLHIV---------QDEF 163
            ++LF+AI++Q++KG VDA+T +A+ +L++ +LL+E +++Q +TL ++             
Sbjct: 1475 YMLFRAIQYQVDKGPVDAVTGKAKRTLNDSRLLREDVEFQPLTLMVLVGPGAGGAAGSSE 1534

Query: 164  DEKVQCKVLDCDSISQVKSKILDALFKNTPF 256
             ++V  +VLD D+I+QVK K+LD ++K TPF
Sbjct: 1535 MQRVPARVLDTDTITQVKEKVLDQVYKGTPF 1565



 Score = 74.9 bits (176), Expect = 2e-13
 Identities = 31/56 (55%), Positives = 41/56 (73%)
 Frame = +1

Query: 256  SLRPAVHEVDLEWRHGRGGHVTLQDEDVTTKTLNGWRKLNTLAHYGVKESAIMSLI 423
            S RP+VH +DLEWR G  GH+TL DED+T+ T N W++LNTL HY V + A + L+
Sbjct: 1566 SQRPSVHALDLEWRSGLAGHLTLSDEDLTSVTQNHWKRLNTLQHYKVPDGATVGLV 1621


>AB033032-1|BAA86520.1| 1912|Homo sapiens KIAA1206 protein protein.
          Length = 1912

 Score = 75.8 bits (178), Expect = 1e-13
 Identities = 35/91 (38%), Positives = 64/91 (70%), Gaps = 9/91 (9%)
 Frame = +2

Query: 11   FLLFKAIKHQIEKGVVDAITHEARYSLSEEKLLKEQIDYQTVTLHIV---------QDEF 163
            ++LF+AI++Q++KG VDA+T +A+ +L++ +LL+E +++Q +TL ++             
Sbjct: 1478 YMLFRAIQYQVDKGPVDAVTGKAKRTLNDSRLLREDVEFQPLTLMVLVGPGAGGAAGSSE 1537

Query: 164  DEKVQCKVLDCDSISQVKSKILDALFKNTPF 256
             ++V  +VLD D+I+QVK K+LD ++K TPF
Sbjct: 1538 MQRVPARVLDTDTITQVKEKVLDQVYKGTPF 1568



 Score = 74.9 bits (176), Expect = 2e-13
 Identities = 31/56 (55%), Positives = 41/56 (73%)
 Frame = +1

Query: 256  SLRPAVHEVDLEWRHGRGGHVTLQDEDVTTKTLNGWRKLNTLAHYGVKESAIMSLI 423
            S RP+VH +DLEWR G  GH+TL DED+T+ T N W++LNTL HY V + A + L+
Sbjct: 1569 SQRPSVHALDLEWRSGLAGHLTLSDEDLTSVTQNHWKRLNTLQHYKVPDGATVGLV 1624


>AK095606-1|BAC04587.1|  344|Homo sapiens protein ( Homo sapiens
           cDNA FLJ38287 fis, clone FCBBF3008362, moderately
           similar to PLEXIN 4 PRECURSOR. ).
          Length = 344

 Score = 74.1 bits (174), Expect = 4e-13
 Identities = 29/56 (51%), Positives = 43/56 (76%)
 Frame = +1

Query: 280 VDLEWRHGRGGHVTLQDEDVTTKTLNGWRKLNTLAHYGVKESAIMSLISRQNDSFN 447
           +DLEWR G G  + LQDED+TTK  N W++LNTLAHY V + ++++L+S+Q  ++N
Sbjct: 1   MDLEWRQGSGARMILQDEDITTKIENDWKRLNTLAHYQVPDGSVVALVSKQVTAYN 56


>BC150280-1|AAI50281.1| 1925|Homo sapiens plexin D1 protein.
          Length = 1925

 Score = 72.9 bits (171), Expect = 9e-13
 Identities = 38/83 (45%), Positives = 56/83 (67%), Gaps = 1/83 (1%)
 Frame = +2

Query: 11   FLLFKAIKHQIEKGVVDAITHEARYSLSEEKLLKEQIDYQTVTLHI-VQDEFDEKVQCKV 187
            FLL  AIK QI KG +DAIT +ARY+L+EE LL+E I+ +   L++  Q    + +  + 
Sbjct: 1515 FLLLCAIKQQINKGSIDAITGKARYTLNEEWLLRENIEAKPRNLNVSFQGCGMDSLSVRA 1574

Query: 188  LDCDSISQVKSKILDALFKNTPF 256
            +D D+++QVK KIL+A  KN P+
Sbjct: 1575 MDTDTLTQVKEKILEAFCKNVPY 1597



 Score = 47.2 bits (107), Expect = 5e-05
 Identities = 30/81 (37%), Positives = 43/81 (53%), Gaps = 2/81 (2%)
 Frame = +1

Query: 205  ITSKIEDTRCSLQKYSISLRPAVHEVDLEWRHGRGGHVTLQDEDVTTKTLNGWRKLNTLA 384
            +  KI +  C    YS    P   +VDLEW         L+D D T+   +G +KLNTLA
Sbjct: 1583 VKEKILEAFCKNVPYS--QWPRAEDVDLEWFASSTQSYILRDLDDTSVVEDGRKKLNTLA 1640

Query: 385  HYGVKESA--IMSLISRQNDS 441
            HY + E A   MSLI +++++
Sbjct: 1641 HYKIPEGASLAMSLIDKKDNT 1661


>BC011848-1|AAH11848.1|  323|Homo sapiens PLXND1 protein protein.
          Length = 323

 Score = 72.9 bits (171), Expect = 9e-13
 Identities = 38/83 (45%), Positives = 56/83 (67%), Gaps = 1/83 (1%)
 Frame = +2

Query: 11  FLLFKAIKHQIEKGVVDAITHEARYSLSEEKLLKEQIDYQTVTLHI-VQDEFDEKVQCKV 187
           FLL  AIK QI KG +DAIT +ARY+L+EE LL+E I+ +   L++  Q    + +  + 
Sbjct: 53  FLLLCAIKQQINKGSIDAITGKARYTLNEEWLLRENIEAKPRNLNVSFQGCGMDSLSVRA 112

Query: 188 LDCDSISQVKSKILDALFKNTPF 256
           +D D+++QVK KIL+A  KN P+
Sbjct: 113 MDTDTLTQVKEKILEAFCKNVPY 135



 Score = 47.2 bits (107), Expect = 5e-05
 Identities = 30/81 (37%), Positives = 43/81 (53%), Gaps = 2/81 (2%)
 Frame = +1

Query: 205 ITSKIEDTRCSLQKYSISLRPAVHEVDLEWRHGRGGHVTLQDEDVTTKTLNGWRKLNTLA 384
           +  KI +  C    YS    P   +VDLEW         L+D D T+   +G +KLNTLA
Sbjct: 121 VKEKILEAFCKNVPYS--QWPRAEDVDLEWFASSTQSYILRDLDDTSVVEDGRKKLNTLA 178

Query: 385 HYGVKESA--IMSLISRQNDS 441
           HY + E A   MSLI +++++
Sbjct: 179 HYKIPEGASLAMSLIDKKDNT 199


>BC003526-1|AAH03526.1|  540|Homo sapiens Unknown (protein for
           IMAGE:3607457) protein.
          Length = 540

 Score = 72.9 bits (171), Expect = 9e-13
 Identities = 38/83 (45%), Positives = 56/83 (67%), Gaps = 1/83 (1%)
 Frame = +2

Query: 11  FLLFKAIKHQIEKGVVDAITHEARYSLSEEKLLKEQIDYQTVTLHI-VQDEFDEKVQCKV 187
           FLL  AIK QI KG +DAIT +ARY+L+EE LL+E I+ +   L++  Q    + +  + 
Sbjct: 130 FLLLCAIKQQINKGSIDAITGKARYTLNEEWLLRENIEAKPRNLNVSFQGCGMDSLSVRA 189

Query: 188 LDCDSISQVKSKILDALFKNTPF 256
           +D D+++QVK KIL+A  KN P+
Sbjct: 190 MDTDTLTQVKEKILEAFCKNVPY 212



 Score = 47.2 bits (107), Expect = 5e-05
 Identities = 30/81 (37%), Positives = 43/81 (53%), Gaps = 2/81 (2%)
 Frame = +1

Query: 205 ITSKIEDTRCSLQKYSISLRPAVHEVDLEWRHGRGGHVTLQDEDVTTKTLNGWRKLNTLA 384
           +  KI +  C    YS    P   +VDLEW         L+D D T+   +G +KLNTLA
Sbjct: 198 VKEKILEAFCKNVPYS--QWPRAEDVDLEWFASSTQSYILRDLDDTSVVEDGRKKLNTLA 255

Query: 385 HYGVKESA--IMSLISRQNDS 441
           HY + E A   MSLI +++++
Sbjct: 256 HYKIPEGASLAMSLIDKKDNT 276


>AY116661-1|AAM49063.1| 1925|Homo sapiens plexin D1 protein.
          Length = 1925

 Score = 72.9 bits (171), Expect = 9e-13
 Identities = 38/83 (45%), Positives = 56/83 (67%), Gaps = 1/83 (1%)
 Frame = +2

Query: 11   FLLFKAIKHQIEKGVVDAITHEARYSLSEEKLLKEQIDYQTVTLHI-VQDEFDEKVQCKV 187
            FLL  AIK QI KG +DAIT +ARY+L+EE LL+E I+ +   L++  Q    + +  + 
Sbjct: 1515 FLLLCAIKQQINKGSIDAITGKARYTLNEEWLLRENIEAKPRNLNVSFQGCGMDSLSVRA 1574

Query: 188  LDCDSISQVKSKILDALFKNTPF 256
            +D D+++QVK KIL+A  KN P+
Sbjct: 1575 MDTDTLTQVKEKILEAFCKNVPY 1597



 Score = 47.2 bits (107), Expect = 5e-05
 Identities = 30/81 (37%), Positives = 43/81 (53%), Gaps = 2/81 (2%)
 Frame = +1

Query: 205  ITSKIEDTRCSLQKYSISLRPAVHEVDLEWRHGRGGHVTLQDEDVTTKTLNGWRKLNTLA 384
            +  KI +  C    YS    P   +VDLEW         L+D D T+   +G +KLNTLA
Sbjct: 1583 VKEKILEAFCKNVPYS--QWPRAEDVDLEWFASSTQSYILRDLDDTSVVEDGRKKLNTLA 1640

Query: 385  HYGVKESA--IMSLISRQNDS 441
            HY + E A   MSLI +++++
Sbjct: 1641 HYKIPEGASLAMSLIDKKDNT 1661


>AB014520-1|BAA31595.1| 1985|Homo sapiens KIAA0620 protein protein.
          Length = 1985

 Score = 72.9 bits (171), Expect = 9e-13
 Identities = 38/83 (45%), Positives = 56/83 (67%), Gaps = 1/83 (1%)
 Frame = +2

Query: 11   FLLFKAIKHQIEKGVVDAITHEARYSLSEEKLLKEQIDYQTVTLHI-VQDEFDEKVQCKV 187
            FLL  AIK QI KG +DAIT +ARY+L+EE LL+E I+ +   L++  Q    + +  + 
Sbjct: 1575 FLLLCAIKQQINKGSIDAITGKARYTLNEEWLLRENIEAKPRNLNVSFQGCGMDSLSVRA 1634

Query: 188  LDCDSISQVKSKILDALFKNTPF 256
            +D D+++QVK KIL+A  KN P+
Sbjct: 1635 MDTDTLTQVKEKILEAFCKNVPY 1657



 Score = 47.2 bits (107), Expect = 5e-05
 Identities = 30/81 (37%), Positives = 43/81 (53%), Gaps = 2/81 (2%)
 Frame = +1

Query: 205  ITSKIEDTRCSLQKYSISLRPAVHEVDLEWRHGRGGHVTLQDEDVTTKTLNGWRKLNTLA 384
            +  KI +  C    YS    P   +VDLEW         L+D D T+   +G +KLNTLA
Sbjct: 1643 VKEKILEAFCKNVPYS--QWPRAEDVDLEWFASSTQSYILRDLDDTSVVEDGRKKLNTLA 1700

Query: 385  HYGVKESA--IMSLISRQNDS 441
            HY + E A   MSLI +++++
Sbjct: 1701 HYKIPEGASLAMSLIDKKDNT 1721


>AF030339-1|AAC18823.1| 1568|Homo sapiens VESPR protein.
          Length = 1568

 Score = 56.0 bits (129), Expect = 1e-07
 Identities = 34/88 (38%), Positives = 50/88 (56%), Gaps = 9/88 (10%)
 Frame = +2

Query: 11   FLLFKAIKHQIEKGVVDAITHEARYSLSEEKLLKEQIDYQTVTLHIVQDEFDEK------ 172
            +LL   +  +I KG VD IT +A Y+L+E+ LL +  ++ TV L++V ++  E       
Sbjct: 1158 YLLVTTLNQKINKGPVDVITCKALYTLNEDWLLWQVPEFSTVALNVVFEKIPENESADVC 1217

Query: 173  --VQCKVLDCDSISQVKSKILDA-LFKN 247
              +   VLDCD+I Q K KI  A L KN
Sbjct: 1218 RNISVNVLDCDTIGQAKEKIFQAFLSKN 1245


>AB208934-1|BAD92171.1| 1211|Homo sapiens plexin C1 variant protein.
          Length = 1211

 Score = 56.0 bits (129), Expect = 1e-07
 Identities = 34/88 (38%), Positives = 50/88 (56%), Gaps = 9/88 (10%)
 Frame = +2

Query: 11   FLLFKAIKHQIEKGVVDAITHEARYSLSEEKLLKEQIDYQTVTLHIVQDEFDEK------ 172
            +LL   +  +I KG VD IT +A Y+L+E+ LL +  ++ TV L++V ++  E       
Sbjct: 801  YLLVTTLNQKINKGPVDVITCKALYTLNEDWLLWQVPEFSTVALNVVFEKIPENESADVC 860

Query: 173  --VQCKVLDCDSISQVKSKILDA-LFKN 247
              +   VLDCD+I Q K KI  A L KN
Sbjct: 861  RNISVNVLDCDTIGQAKEKIFQAFLSKN 888


>BX649592-3|CAO03497.1|  234|Homo sapiens plexin B2 protein.
          Length = 234

 Score = 41.5 bits (93), Expect = 0.003
 Identities = 18/45 (40%), Positives = 28/45 (62%)
 Frame = +1

Query: 286 LEWRHGRGGHVTLQDEDVTTKTLNGWRKLNTLAHYGVKESAIMSL 420
           LEWR G    + L D D+T++    W+++NTL HY V++ A + L
Sbjct: 67  LEWRPGSTAQI-LSDLDLTSQREGRWKRVNTLMHYNVRDGATLIL 110


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 85,530,109
Number of Sequences: 237096
Number of extensions: 1631527
Number of successful extensions: 6861
Number of sequences better than 10.0: 34
Number of HSP's better than 10.0 without gapping: 6673
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6826
length of database: 76,859,062
effective HSP length: 88
effective length of database: 55,994,614
effective search space used: 7671262118
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -