SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20052
         (684 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CR456934-1|CAG33215.1|  125|Homo sapiens PDCD5 protein.                71   5e-12
BT006694-1|AAP35340.1|  125|Homo sapiens programmed cell death 5...    71   5e-12
BC015519-1|AAH15519.1|  125|Homo sapiens programmed cell death 5...    71   5e-12
AF014955-1|AAD11579.1|  125|Homo sapiens TFAR19 protein.               71   5e-12
AB209040-1|BAD92277.1|   90|Homo sapiens programmed cell death 5...    30   8.8  

>CR456934-1|CAG33215.1|  125|Homo sapiens PDCD5 protein.
          Length = 125

 Score = 70.5 bits (165), Expect = 5e-12
 Identities = 35/76 (46%), Positives = 55/76 (72%)
 Frame = +3

Query: 255 QDARARLNTIKLGRPEKAAMIENMICRMAQMGQIQCKITEPDLIQILESFNQQMPKSQST 434
           Q ARARL+ + L +PEK   +EN + +MA+ GQ+  K++E  LI+IL+  +QQ  K+ +T
Sbjct: 50  QSARARLSNLALVKPEKTKAVENYLIQMARYGQLSEKVSEQGLIEILKKVSQQTKKT-TT 108

Query: 435 VKFDRRRAALDSDDED 482
           VKF+RR+  +DSD++D
Sbjct: 109 VKFNRRK-VMDSDEDD 123


>BT006694-1|AAP35340.1|  125|Homo sapiens programmed cell death 5
           protein.
          Length = 125

 Score = 70.5 bits (165), Expect = 5e-12
 Identities = 35/76 (46%), Positives = 55/76 (72%)
 Frame = +3

Query: 255 QDARARLNTIKLGRPEKAAMIENMICRMAQMGQIQCKITEPDLIQILESFNQQMPKSQST 434
           Q ARARL+ + L +PEK   +EN + +MA+ GQ+  K++E  LI+IL+  +QQ  K+ +T
Sbjct: 50  QSARARLSNLALVKPEKTKAVENYLIQMARYGQLSEKVSEQGLIEILKKVSQQTEKT-TT 108

Query: 435 VKFDRRRAALDSDDED 482
           VKF+RR+  +DSD++D
Sbjct: 109 VKFNRRK-VMDSDEDD 123


>BC015519-1|AAH15519.1|  125|Homo sapiens programmed cell death 5
           protein.
          Length = 125

 Score = 70.5 bits (165), Expect = 5e-12
 Identities = 35/76 (46%), Positives = 55/76 (72%)
 Frame = +3

Query: 255 QDARARLNTIKLGRPEKAAMIENMICRMAQMGQIQCKITEPDLIQILESFNQQMPKSQST 434
           Q ARARL+ + L +PEK   +EN + +MA+ GQ+  K++E  LI+IL+  +QQ  K+ +T
Sbjct: 50  QSARARLSNLALVKPEKTKAVENYLIQMARYGQLSEKVSEQGLIEILKKVSQQTEKT-TT 108

Query: 435 VKFDRRRAALDSDDED 482
           VKF+RR+  +DSD++D
Sbjct: 109 VKFNRRK-VMDSDEDD 123


>AF014955-1|AAD11579.1|  125|Homo sapiens TFAR19 protein.
          Length = 125

 Score = 70.5 bits (165), Expect = 5e-12
 Identities = 35/76 (46%), Positives = 55/76 (72%)
 Frame = +3

Query: 255 QDARARLNTIKLGRPEKAAMIENMICRMAQMGQIQCKITEPDLIQILESFNQQMPKSQST 434
           Q ARARL+ + L +PEK   +EN + +MA+ GQ+  K++E  LI+IL+  +QQ  K+ +T
Sbjct: 50  QSARARLSNLALVKPEKTKAVENYLIQMARYGQLSEKVSEQGLIEILKKVSQQTEKT-TT 108

Query: 435 VKFDRRRAALDSDDED 482
           VKF+RR+  +DSD++D
Sbjct: 109 VKFNRRK-VMDSDEDD 123


>AB209040-1|BAD92277.1|   90|Homo sapiens programmed cell death 5
           variant protein.
          Length = 90

 Score = 29.9 bits (64), Expect = 8.8
 Identities = 12/40 (30%), Positives = 25/40 (62%)
 Frame = +3

Query: 273 LNTIKLGRPEKAAMIENMICRMAQMGQIQCKITEPDLIQI 392
           ++ + L +PEK   +EN + +MA+ GQ+  K++   L ++
Sbjct: 17  VSNLALVKPEKTKAVENYLIQMARYGQLSEKVSLDSLEEL 56


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 82,481,178
Number of Sequences: 237096
Number of extensions: 1471657
Number of successful extensions: 2010
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 1971
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2010
length of database: 76,859,062
effective HSP length: 88
effective length of database: 55,994,614
effective search space used: 7783251346
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -