SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20051
         (781 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z11692-1|CAA77750.1|  858|Homo sapiens human  elongation factor ...   124   3e-28
X51466-1|CAA35829.1|  858|Homo sapiens elongation factor 2 protein.   124   3e-28
BC126259-1|AAI26260.1|  858|Homo sapiens EEF2 protein protein.        124   3e-28
BC006547-1|AAH06547.1|  583|Homo sapiens EEF2 protein protein.        124   3e-28
AY942181-1|AAX34409.1|  858|Homo sapiens elongation factor 2 pro...   124   3e-28
BC030612-1|AAH30612.1|  777|Homo sapiens G elongation factor, mi...    54   4e-07
BC015712-1|AAH15712.1|  779|Homo sapiens GFM2 protein protein.         54   4e-07
AY453587-1|AAS49035.1|  531|Homo sapiens elongation factor G iso...    54   4e-07
AK025314-1|BAB15109.1|  513|Homo sapiens protein ( Homo sapiens ...    54   4e-07
AF367997-1|AAK53401.1|  779|Homo sapiens elongation factor G2 pr...    54   4e-07
AF111808-1|AAL39010.1|  732|Homo sapiens MSTP027 protein.              54   4e-07
D21163-1|BAA04699.2|  977|Homo sapiens KIAA0031 protein.               52   2e-06
CR456774-1|CAG33055.1|  972|Homo sapiens U5-116KD protein.             52   2e-06
BC002360-1|AAH02360.1|  972|Homo sapiens elongation factor Tu GT...    52   2e-06
AJ505017-1|CAD43720.1|  850|Homo sapiens small nuclear ribonucle...    52   2e-06
BC049210-1|AAH49210.1|  751|Homo sapiens G elongation factor, mi...    49   2e-05
AF367998-1|AAK53402.1|  751|Homo sapiens elongation factor G1 pr...    49   2e-05
AF309777-1|AAK58877.1|  751|Homo sapiens elongation factor G pro...    49   2e-05
AK023282-1|BAB14507.1|  669|Homo sapiens protein ( Homo sapiens ...    47   7e-05
BC036768-1|AAH36768.1|  669|Homo sapiens GUF1 GTPase homolog (S....    45   3e-04
AF264621-1|AAG03013.1|  174|Homo sapiens uncharacterized gastric...    42   0.002
X84694-1|CAA59169.1|  452|Homo sapiens mitochondrial elongation ...    35   0.38 
S75463-1|AAC60647.1|  452|Homo sapiens P43 protein.                    35   0.38 
L38995-1|AAB00499.1|  452|Homo sapiens elongation factor Tu prot...    35   0.38 
BC010041-1|AAH10041.2|  455|Homo sapiens Tu translation elongati...    35   0.38 
BC001633-1|AAH01633.2|  455|Homo sapiens Tu translation elongati...    35   0.38 
X70940-1|CAA50280.1|  463|Homo sapiens elongation factor 1 alpha...    34   0.66 
X16869-1|CAA34756.1|  462|Homo sapiens protein ( Human mRNA for ...    34   0.66 
X03689-1|CAA27325.1|   94|Homo sapiens protein ( Human mRNA frag...    34   0.66 
X03558-1|CAA27245.1|  462|Homo sapiens protein ( Human mRNA for ...    34   0.66 
J04617-1|AAA52343.1|  462|Homo sapiens EEF1A protein.                  34   0.66 
EF362804-1|ABO30531.1|  462|Homo sapiens EF1a protein.                 34   0.66 
BC111051-1|AAI11052.1|  462|Homo sapiens eukaryotic translation ...    34   0.66 
BC110409-1|AAI10410.1|  463|Homo sapiens eukaryotic translation ...    34   0.66 
BC082268-1|AAH82268.1|  462|Homo sapiens eukaryotic translation ...    34   0.66 
BC072385-1|AAH72385.1|  462|Homo sapiens eukaryotic translation ...    34   0.66 
BC071841-1|AAH71841.1|  462|Homo sapiens eukaryotic translation ...    34   0.66 
BC071741-1|AAH71741.1|  462|Homo sapiens eukaryotic translation ...    34   0.66 
BC071619-1|AAH71619.1|  441|Homo sapiens EEF1A1 protein protein.       34   0.66 
BC070500-1|AAH70500.1|   67|Homo sapiens EEF1A1 protein protein.       34   0.66 
BC070131-1|AAH70131.1|  111|Homo sapiens EEF1A1 protein protein.       34   0.66 
BC066893-1|AAH66893.1|  462|Homo sapiens eukaryotic translation ...    34   0.66 
BC057391-1|AAH57391.1|  462|Homo sapiens eukaryotic translation ...    34   0.66 
BC038339-1|AAH38339.1|  462|Homo sapiens eukaryotic translation ...    34   0.66 
BC028674-1|AAH28674.1|  462|Homo sapiens eukaryotic translation ...    34   0.66 
BC021686-1|AAH21686.1|  462|Homo sapiens eukaryotic translation ...    34   0.66 
BC019669-1|AAH19669.1|  462|Homo sapiens EEF1A1 protein protein.       34   0.66 
BC018641-1|AAH18641.1|  462|Homo sapiens eukaryotic translation ...    34   0.66 
BC018150-1|AAH18150.1|  462|Homo sapiens eukaryotic translation ...    34   0.66 
BC014224-1|AAH14224.1|  462|Homo sapiens eukaryotic translation ...    34   0.66 
BC012891-1|AAH12891.1|  462|Homo sapiens eukaryotic translation ...    34   0.66 
BC010735-1|AAH10735.1|  462|Homo sapiens eukaryotic translation ...    34   0.66 
BC009875-1|AAH09875.1|  462|Homo sapiens eukaryotic translation ...    34   0.66 
BC009733-1|AAH09733.1|  462|Homo sapiens eukaryotic translation ...    34   0.66 
BC008587-1|AAH08587.1|  462|Homo sapiens eukaryotic translation ...    34   0.66 
BC000432-1|AAH00432.1|  463|Homo sapiens eukaryotic translation ...    34   0.66 
AY043301-1|AAK95378.1|  462|Homo sapiens elongation factor 1-alp...    34   0.66 
AL603910-10|CAO03613.1|  107|Homo sapiens eukaryotic translation...    34   0.66 
AL603910-9|CAI40951.1|  145|Homo sapiens eukaryotic translation ...    34   0.66 
AL603910-8|CAI14883.1|  462|Homo sapiens eukaryotic translation ...    34   0.66 
AL593851-4|CAH73620.1|  462|Homo sapiens eukaryotic translation ...    34   0.66 
AL121829-9|CAC15522.1|  463|Homo sapiens EEF1A2 protein.               34   0.66 
AK223046-1|BAD96766.1|  462|Homo sapiens eukaryotic translation ...    34   0.66 
AK223030-1|BAD96750.1|  462|Homo sapiens eukaryotic translation ...    34   0.66 
AK222982-1|BAD96702.1|  462|Homo sapiens eukaryotic translation ...    34   0.66 
AK222551-1|BAD96271.1|  462|Homo sapiens eukaryotic translation ...    34   0.66 
AK222523-1|BAD96243.1|  462|Homo sapiens eukaryotic translation ...    34   0.66 
AK222515-1|BAD96235.1|  462|Homo sapiens eukaryotic translation ...    34   0.66 
AF267861-1|AAG44730.1|  427|Homo sapiens EF1a-like protein protein.    34   0.66 
AF163763-1|AAF80488.1|  463|Homo sapiens elongation factor 1 A-2...    34   0.66 
BC071727-1|AAH71727.1|  462|Homo sapiens eukaryotic translation ...    33   1.2  
AL096771-1|CAM28080.1|  637|Homo sapiens collagen type XII alpha...    32   2.0  
BC110605-1|AAI10606.1|  318|Homo sapiens EPN3 protein protein.         30   8.1  
BC077722-1|AAH77722.1|  208|Homo sapiens EPN3 protein protein.         30   8.1  
BC051365-1|AAH51365.1|  208|Homo sapiens EPN3 protein protein.         30   8.1  
BC001038-1|AAH01038.1|  208|Homo sapiens EPN3 protein protein.         30   8.1  
AK000785-1|BAA91378.1|  632|Homo sapiens protein ( Homo sapiens ...    30   8.1  
AF324241-1|AAG45223.1|  632|Homo sapiens epsin 3 protein.              30   8.1  

>Z11692-1|CAA77750.1|  858|Homo sapiens human  elongation factor 2
           protein.
          Length = 858

 Score =  124 bits (300), Expect = 3e-28
 Identities = 61/102 (59%), Positives = 70/102 (68%), Gaps = 2/102 (1%)
 Frame = +2

Query: 461 CVWCVCTN*NSTA-SGYAERIKPILFMNKMDRXXXXXXXXXXXXYQTFQRIVENVNVIIA 637
           CV  VC    +      AERIKP+L MNKMDR            YQTFQRIVENVNVII+
Sbjct: 131 CVSGVCVQTETVLRQAIAERIKPVLMMNKMDRALLELQLEPEELYQTFQRIVENVNVIIS 190

Query: 638 TYND-DGGPMGEVRVDPSKGSVGFGSGLHGWAFTLKQFSEMY 760
           TY + + GPMG + +DP  G+VGFGSGLHGWAFTLKQF+EMY
Sbjct: 191 TYGEGESGPMGNIMIDPVLGTVGFGSGLHGWAFTLKQFAEMY 232



 Score =  124 bits (298), Expect = 5e-28
 Identities = 59/66 (89%), Positives = 62/66 (93%)
 Frame = +1

Query: 58  MVNFTVDEIRGMMDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTR 237
           MVNFTVD+IR +MDKK NIRNMSVIAHVDHGKSTLTDSLV KAGIIA ARAGETRFTDTR
Sbjct: 1   MVNFTVDQIRAIMDKKANIRNMSVIAHVDHGKSTLTDSLVCKAGIIASARAGETRFTDTR 60

Query: 238 KDEQDR 255
           KDEQ+R
Sbjct: 61  KDEQER 66



 Score =  107 bits (258), Expect = 3e-23
 Identities = 58/85 (68%), Positives = 63/85 (74%)
 Frame = +3

Query: 255 CITIKSTAISMFFELEEKDLVFITNPDQREKSEKGFLINLIDSPGHVDFSSEVTAALRVT 434
           CITIKSTAIS+F+EL E DL FI    ++ K   GFLINLIDSPGHVDFSSEVTAALRVT
Sbjct: 67  CITIKSTAISLFYELSENDLNFI----KQSKDGAGFLINLIDSPGHVDFSSEVTAALRVT 122

Query: 435 DGALXXXXXXXXXXXQTETVLRQAM 509
           DGAL           QTETVLRQA+
Sbjct: 123 DGALVVVDCVSGVCVQTETVLRQAI 147


>X51466-1|CAA35829.1|  858|Homo sapiens elongation factor 2 protein.
          Length = 858

 Score =  124 bits (300), Expect = 3e-28
 Identities = 61/102 (59%), Positives = 70/102 (68%), Gaps = 2/102 (1%)
 Frame = +2

Query: 461 CVWCVCTN*NSTA-SGYAERIKPILFMNKMDRXXXXXXXXXXXXYQTFQRIVENVNVIIA 637
           CV  VC    +      AERIKP+L MNKMDR            YQTFQRIVENVNVII+
Sbjct: 131 CVSGVCVQTETVLRQAIAERIKPVLMMNKMDRALLELQLEPEELYQTFQRIVENVNVIIS 190

Query: 638 TYND-DGGPMGEVRVDPSKGSVGFGSGLHGWAFTLKQFSEMY 760
           TY + + GPMG + +DP  G+VGFGSGLHGWAFTLKQF+EMY
Sbjct: 191 TYGEGESGPMGNIMIDPVLGTVGFGSGLHGWAFTLKQFAEMY 232



 Score =  124 bits (298), Expect = 5e-28
 Identities = 59/66 (89%), Positives = 62/66 (93%)
 Frame = +1

Query: 58  MVNFTVDEIRGMMDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTR 237
           MVNFTVD+IR +MDKK NIRNMSVIAHVDHGKSTLTDSLV KAGIIA ARAGETRFTDTR
Sbjct: 1   MVNFTVDQIRAIMDKKANIRNMSVIAHVDHGKSTLTDSLVCKAGIIASARAGETRFTDTR 60

Query: 238 KDEQDR 255
           KDEQ+R
Sbjct: 61  KDEQER 66



 Score =  107 bits (258), Expect = 3e-23
 Identities = 58/85 (68%), Positives = 63/85 (74%)
 Frame = +3

Query: 255 CITIKSTAISMFFELEEKDLVFITNPDQREKSEKGFLINLIDSPGHVDFSSEVTAALRVT 434
           CITIKSTAIS+F+EL E DL FI    ++ K   GFLINLIDSPGHVDFSSEVTAALRVT
Sbjct: 67  CITIKSTAISLFYELSENDLNFI----KQSKDGAGFLINLIDSPGHVDFSSEVTAALRVT 122

Query: 435 DGALXXXXXXXXXXXQTETVLRQAM 509
           DGAL           QTETVLRQA+
Sbjct: 123 DGALVVVDCVSGVCVQTETVLRQAI 147


>BC126259-1|AAI26260.1|  858|Homo sapiens EEF2 protein protein.
          Length = 858

 Score =  124 bits (300), Expect = 3e-28
 Identities = 61/102 (59%), Positives = 70/102 (68%), Gaps = 2/102 (1%)
 Frame = +2

Query: 461 CVWCVCTN*NSTA-SGYAERIKPILFMNKMDRXXXXXXXXXXXXYQTFQRIVENVNVIIA 637
           CV  VC    +      AERIKP+L MNKMDR            YQTFQRIVENVNVII+
Sbjct: 131 CVSGVCVQTETVLRQAIAERIKPVLMMNKMDRALLELQLEPEELYQTFQRIVENVNVIIS 190

Query: 638 TYND-DGGPMGEVRVDPSKGSVGFGSGLHGWAFTLKQFSEMY 760
           TY + + GPMG + +DP  G+VGFGSGLHGWAFTLKQF+EMY
Sbjct: 191 TYGEGESGPMGNIMIDPVLGTVGFGSGLHGWAFTLKQFAEMY 232



 Score =  124 bits (298), Expect = 5e-28
 Identities = 59/66 (89%), Positives = 62/66 (93%)
 Frame = +1

Query: 58  MVNFTVDEIRGMMDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTR 237
           MVNFTVD+IR +MDKK NIRNMSVIAHVDHGKSTLTDSLV KAGIIA ARAGETRFTDTR
Sbjct: 1   MVNFTVDQIRAIMDKKANIRNMSVIAHVDHGKSTLTDSLVCKAGIIASARAGETRFTDTR 60

Query: 238 KDEQDR 255
           KDEQ+R
Sbjct: 61  KDEQER 66



 Score =  107 bits (258), Expect = 3e-23
 Identities = 58/85 (68%), Positives = 63/85 (74%)
 Frame = +3

Query: 255 CITIKSTAISMFFELEEKDLVFITNPDQREKSEKGFLINLIDSPGHVDFSSEVTAALRVT 434
           CITIKSTAIS+F+EL E DL FI    ++ K   GFLINLIDSPGHVDFSSEVTAALRVT
Sbjct: 67  CITIKSTAISLFYELSENDLNFI----KQSKDGAGFLINLIDSPGHVDFSSEVTAALRVT 122

Query: 435 DGALXXXXXXXXXXXQTETVLRQAM 509
           DGAL           QTETVLRQA+
Sbjct: 123 DGALVVVDCVSGVCVQTETVLRQAI 147


>BC006547-1|AAH06547.1|  583|Homo sapiens EEF2 protein protein.
          Length = 583

 Score =  124 bits (300), Expect = 3e-28
 Identities = 61/102 (59%), Positives = 70/102 (68%), Gaps = 2/102 (1%)
 Frame = +2

Query: 461 CVWCVCTN*NSTA-SGYAERIKPILFMNKMDRXXXXXXXXXXXXYQTFQRIVENVNVIIA 637
           CV  VC    +      AERIKP+L MNKMDR            YQTFQRIVENVNVII+
Sbjct: 131 CVSGVCVQTETVLRQAIAERIKPVLMMNKMDRALLELQLEPEELYQTFQRIVENVNVIIS 190

Query: 638 TYND-DGGPMGEVRVDPSKGSVGFGSGLHGWAFTLKQFSEMY 760
           TY + + GPMG + +DP  G+VGFGSGLHGWAFTLKQF+EMY
Sbjct: 191 TYGEGESGPMGNIMIDPVLGTVGFGSGLHGWAFTLKQFAEMY 232



 Score =  124 bits (298), Expect = 5e-28
 Identities = 59/66 (89%), Positives = 62/66 (93%)
 Frame = +1

Query: 58  MVNFTVDEIRGMMDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTR 237
           MVNFTVD+IR +MDKK NIRNMSVIAHVDHGKSTLTDSLV KAGIIA ARAGETRFTDTR
Sbjct: 1   MVNFTVDQIRAIMDKKANIRNMSVIAHVDHGKSTLTDSLVCKAGIIASARAGETRFTDTR 60

Query: 238 KDEQDR 255
           KDEQ+R
Sbjct: 61  KDEQER 66



 Score =  107 bits (258), Expect = 3e-23
 Identities = 58/85 (68%), Positives = 63/85 (74%)
 Frame = +3

Query: 255 CITIKSTAISMFFELEEKDLVFITNPDQREKSEKGFLINLIDSPGHVDFSSEVTAALRVT 434
           CITIKSTAIS+F+EL E DL FI    ++ K   GFLINLIDSPGHVDFSSEVTAALRVT
Sbjct: 67  CITIKSTAISLFYELSENDLNFI----KQSKDGAGFLINLIDSPGHVDFSSEVTAALRVT 122

Query: 435 DGALXXXXXXXXXXXQTETVLRQAM 509
           DGAL           QTETVLRQA+
Sbjct: 123 DGALVVVDCVSGVCVQTETVLRQAI 147


>AY942181-1|AAX34409.1|  858|Homo sapiens elongation factor 2
           protein.
          Length = 858

 Score =  124 bits (300), Expect = 3e-28
 Identities = 61/102 (59%), Positives = 70/102 (68%), Gaps = 2/102 (1%)
 Frame = +2

Query: 461 CVWCVCTN*NSTA-SGYAERIKPILFMNKMDRXXXXXXXXXXXXYQTFQRIVENVNVIIA 637
           CV  VC    +      AERIKP+L MNKMDR            YQTFQRIVENVNVII+
Sbjct: 131 CVSGVCVQTETVLRQAIAERIKPVLMMNKMDRALLELQLEPEELYQTFQRIVENVNVIIS 190

Query: 638 TYND-DGGPMGEVRVDPSKGSVGFGSGLHGWAFTLKQFSEMY 760
           TY + + GPMG + +DP  G+VGFGSGLHGWAFTLKQF+EMY
Sbjct: 191 TYGEGESGPMGNIMIDPVLGTVGFGSGLHGWAFTLKQFAEMY 232



 Score =  124 bits (298), Expect = 5e-28
 Identities = 59/66 (89%), Positives = 62/66 (93%)
 Frame = +1

Query: 58  MVNFTVDEIRGMMDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTR 237
           MVNFTVD+IR +MDKK NIRNMSVIAHVDHGKSTLTDSLV KAGIIA ARAGETRFTDTR
Sbjct: 1   MVNFTVDQIRAIMDKKANIRNMSVIAHVDHGKSTLTDSLVCKAGIIASARAGETRFTDTR 60

Query: 238 KDEQDR 255
           KDEQ+R
Sbjct: 61  KDEQER 66



 Score =  107 bits (258), Expect = 3e-23
 Identities = 58/85 (68%), Positives = 63/85 (74%)
 Frame = +3

Query: 255 CITIKSTAISMFFELEEKDLVFITNPDQREKSEKGFLINLIDSPGHVDFSSEVTAALRVT 434
           CITIKSTAIS+F+EL E DL FI    ++ K   GFLINLIDSPGHVDFSSEVTAALRVT
Sbjct: 67  CITIKSTAISLFYELSENDLNFI----KQSKDGAGFLINLIDSPGHVDFSSEVTAALRVT 122

Query: 435 DGALXXXXXXXXXXXQTETVLRQAM 509
           DGAL           QTETVLRQA+
Sbjct: 123 DGALVVVDCVSGVCVQTETVLRQAI 147


>BC030612-1|AAH30612.1|  777|Homo sapiens G elongation factor,
           mitochondrial 2 protein.
          Length = 777

 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 27/51 (52%), Positives = 32/51 (62%)
 Frame = +3

Query: 354 KGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQA 506
           KG+ +NLID+PGHVDF+ EV   LRV DGA+           QT TV RQA
Sbjct: 133 KGYRVNLIDTPGHVDFTLEVERCLRVLDGAVAVFDASAGVEAQTLTVWRQA 183



 Score = 31.9 bits (69), Expect = 2.7
 Identities = 17/51 (33%), Positives = 30/51 (58%), Gaps = 3/51 (5%)
 Frame = +1

Query: 112 IRNMSVIAHVDHGKSTLTDSLVSKAGI---IAGARAGETRFTDTRKDEQDR 255
           IRN+ ++AH+D GK+T T+ ++  +G    +     G+T  TD    E++R
Sbjct: 70  IRNIGIMAHIDAGKTTTTERILYYSGYTRSLGDVDDGDT-VTDFMAQERER 119


>BC015712-1|AAH15712.1|  779|Homo sapiens GFM2 protein protein.
          Length = 779

 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 27/51 (52%), Positives = 32/51 (62%)
 Frame = +3

Query: 354 KGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQA 506
           KG+ +NLID+PGHVDF+ EV   LRV DGA+           QT TV RQA
Sbjct: 133 KGYRVNLIDTPGHVDFTLEVERCLRVLDGAVAVFDASAGVEAQTLTVWRQA 183



 Score = 31.9 bits (69), Expect = 2.7
 Identities = 17/51 (33%), Positives = 30/51 (58%), Gaps = 3/51 (5%)
 Frame = +1

Query: 112 IRNMSVIAHVDHGKSTLTDSLVSKAGI---IAGARAGETRFTDTRKDEQDR 255
           IRN+ ++AH+D GK+T T+ ++  +G    +     G+T  TD    E++R
Sbjct: 70  IRNIGIMAHIDAGKTTTTERILYYSGYTRSLGDVDDGDT-VTDFMAQERER 119


>AY453587-1|AAS49035.1|  531|Homo sapiens elongation factor G
           isoform protein.
          Length = 531

 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 27/51 (52%), Positives = 32/51 (62%)
 Frame = +3

Query: 354 KGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQA 506
           KG+ +NLID+PGHVDF+ EV   LRV DGA+           QT TV RQA
Sbjct: 133 KGYRVNLIDTPGHVDFTLEVERCLRVLDGAVAVFDASAGVEAQTLTVWRQA 183



 Score = 31.9 bits (69), Expect = 2.7
 Identities = 17/51 (33%), Positives = 30/51 (58%), Gaps = 3/51 (5%)
 Frame = +1

Query: 112 IRNMSVIAHVDHGKSTLTDSLVSKAGI---IAGARAGETRFTDTRKDEQDR 255
           IRN+ ++AH+D GK+T T+ ++  +G    +     G+T  TD    E++R
Sbjct: 70  IRNIGIMAHIDAGKTTTTERILYYSGYTRSLGDVDDGDT-VTDFMAQERER 119


>AK025314-1|BAB15109.1|  513|Homo sapiens protein ( Homo sapiens
           cDNA: FLJ21661 fis, clone COL08837. ).
          Length = 513

 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 27/51 (52%), Positives = 32/51 (62%)
 Frame = +3

Query: 354 KGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQA 506
           KG+ +NLID+PGHVDF+ EV   LRV DGA+           QT TV RQA
Sbjct: 133 KGYRVNLIDTPGHVDFTLEVERCLRVLDGAVAVFDASAGVEAQTLTVWRQA 183



 Score = 31.9 bits (69), Expect = 2.7
 Identities = 17/51 (33%), Positives = 30/51 (58%), Gaps = 3/51 (5%)
 Frame = +1

Query: 112 IRNMSVIAHVDHGKSTLTDSLVSKAGI---IAGARAGETRFTDTRKDEQDR 255
           IRN+ ++AH+D GK+T T+ ++  +G    +     G+T  TD    E++R
Sbjct: 70  IRNIGIMAHIDAGKTTTTERILYYSGYTRSLGDVDDGDT-VTDFMAQERER 119


>AF367997-1|AAK53401.1|  779|Homo sapiens elongation factor G2
           protein.
          Length = 779

 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 27/51 (52%), Positives = 32/51 (62%)
 Frame = +3

Query: 354 KGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQA 506
           KG+ +NLID+PGHVDF+ EV   LRV DGA+           QT TV RQA
Sbjct: 133 KGYRVNLIDTPGHVDFTLEVERCLRVLDGAVAVFDASAGVEAQTLTVWRQA 183



 Score = 31.9 bits (69), Expect = 2.7
 Identities = 17/51 (33%), Positives = 30/51 (58%), Gaps = 3/51 (5%)
 Frame = +1

Query: 112 IRNMSVIAHVDHGKSTLTDSLVSKAGI---IAGARAGETRFTDTRKDEQDR 255
           IRN+ ++AH+D GK+T T+ ++  +G    +     G+T  TD    E++R
Sbjct: 70  IRNIGIMAHIDAGKTTTTERILYYSGYTRSLGDVDDGDT-VTDFMAQERER 119


>AF111808-1|AAL39010.1|  732|Homo sapiens MSTP027 protein.
          Length = 732

 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 27/51 (52%), Positives = 32/51 (62%)
 Frame = +3

Query: 354 KGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQA 506
           KG+ +NLID+PGHVDF+ EV   LRV DGA+           QT TV RQA
Sbjct: 133 KGYRVNLIDTPGHVDFTLEVERCLRVLDGAVAVFDASAGVEAQTLTVWRQA 183



 Score = 31.9 bits (69), Expect = 2.7
 Identities = 17/51 (33%), Positives = 30/51 (58%), Gaps = 3/51 (5%)
 Frame = +1

Query: 112 IRNMSVIAHVDHGKSTLTDSLVSKAGI---IAGARAGETRFTDTRKDEQDR 255
           IRN+ ++AH+D GK+T T+ ++  +G    +     G+T  TD    E++R
Sbjct: 70  IRNIGIMAHIDAGKTTTTERILYYSGYTRSLGDVDDGDT-VTDFMAQERER 119


>D21163-1|BAA04699.2|  977|Homo sapiens KIAA0031 protein.
          Length = 977

 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 25/65 (38%), Positives = 39/65 (60%)
 Frame = +3

Query: 315 VFITNPDQREKSEKGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETV 494
           V +  PD + KS   +L N++D+PGHV+FS EVTA LR++DG +            TE +
Sbjct: 191 VTVVLPDTKGKS---YLFNIMDTPGHVNFSDEVTAGLRISDGVVLFIDAAEGVMLNTERL 247

Query: 495 LRQAM 509
           ++ A+
Sbjct: 248 IKHAV 252



 Score = 41.1 bits (92), Expect = 0.004
 Identities = 25/84 (29%), Positives = 41/84 (48%)
 Frame = +2

Query: 512 ERIKPILFMNKMDRXXXXXXXXXXXXYQTFQRIVENVNVIIATYNDDGGPMGEVRVDPSK 691
           ER+   + +NK+DR            Y   + IV+ VN +I+ Y+ D      + + P  
Sbjct: 254 ERLAVTVCINKIDRLILELKLPPTDAYYKLRHIVDEVNGLISMYSTD----ENLILSPLL 309

Query: 692 GSVGFGSGLHGWAFTLKQFSEMYA 763
           G+V F S  +   FTL  F+++YA
Sbjct: 310 GNVCFSSSQYSICFTLGSFAKIYA 333



 Score = 35.1 bits (77), Expect = 0.29
 Identities = 19/72 (26%), Positives = 34/72 (47%), Gaps = 1/72 (1%)
 Frame = +1

Query: 67  FTVDEIRGMMDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETR-FTDTRKD 243
           + +D +  +MD    IRN+++  H+ HGK+   D L+ +       R  +   +TD    
Sbjct: 119 YEMDFLADLMDNSELIRNVTLCGHLHHGKTCFVDCLIEQTHPEIRKRYDQDLCYTDILFT 178

Query: 244 EQDRASPLNLRP 279
           EQ+R   +   P
Sbjct: 179 EQERGVGIKSTP 190


>CR456774-1|CAG33055.1|  972|Homo sapiens U5-116KD protein.
          Length = 972

 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 25/65 (38%), Positives = 39/65 (60%)
 Frame = +3

Query: 315 VFITNPDQREKSEKGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETV 494
           V +  PD + KS   +L N++D+PGHV+FS EVTA LR++DG +            TE +
Sbjct: 186 VTVVLPDTKGKS---YLFNIMDTPGHVNFSDEVTAGLRISDGVVLFIDAAEGVMLNTERL 242

Query: 495 LRQAM 509
           ++ A+
Sbjct: 243 IKHAV 247



 Score = 41.1 bits (92), Expect = 0.004
 Identities = 25/84 (29%), Positives = 41/84 (48%)
 Frame = +2

Query: 512 ERIKPILFMNKMDRXXXXXXXXXXXXYQTFQRIVENVNVIIATYNDDGGPMGEVRVDPSK 691
           ER+   + +NK+DR            Y   + IV+ VN +I+ Y+ D      + + P  
Sbjct: 249 ERLAVTVCINKIDRLILELKLPPTDAYYKLRHIVDEVNGLISMYSTD----ENLILSPLL 304

Query: 692 GSVGFGSGLHGWAFTLKQFSEMYA 763
           G+V F S  +   FTL  F+++YA
Sbjct: 305 GNVCFSSSQYSICFTLVSFAKIYA 328



 Score = 35.1 bits (77), Expect = 0.29
 Identities = 19/72 (26%), Positives = 34/72 (47%), Gaps = 1/72 (1%)
 Frame = +1

Query: 67  FTVDEIRGMMDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETR-FTDTRKD 243
           + +D +  +MD    IRN+++  H+ HGK+   D L+ +       R  +   +TD    
Sbjct: 114 YEMDFLADLMDNSELIRNVTLCGHLHHGKTCFVDCLIEQTHPEIRKRYDQDLCYTDILFT 173

Query: 244 EQDRASPLNLRP 279
           EQ+R   +   P
Sbjct: 174 EQERGVGIKSTP 185


>BC002360-1|AAH02360.1|  972|Homo sapiens elongation factor Tu GTP
           binding domain containing 2 protein.
          Length = 972

 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 25/65 (38%), Positives = 39/65 (60%)
 Frame = +3

Query: 315 VFITNPDQREKSEKGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETV 494
           V +  PD + KS   +L N++D+PGHV+FS EVTA LR++DG +            TE +
Sbjct: 186 VTVVLPDTKGKS---YLFNIMDTPGHVNFSDEVTAGLRISDGVVLFIDAAEGVMLNTERL 242

Query: 495 LRQAM 509
           ++ A+
Sbjct: 243 IKHAV 247



 Score = 41.1 bits (92), Expect = 0.004
 Identities = 25/84 (29%), Positives = 41/84 (48%)
 Frame = +2

Query: 512 ERIKPILFMNKMDRXXXXXXXXXXXXYQTFQRIVENVNVIIATYNDDGGPMGEVRVDPSK 691
           ER+   + +NK+DR            Y   + IV+ VN +I+ Y+ D      + + P  
Sbjct: 249 ERLAVTVCINKIDRLILELKLPPTDAYYKLRHIVDEVNGLISMYSTD----ENLILSPLL 304

Query: 692 GSVGFGSGLHGWAFTLKQFSEMYA 763
           G+V F S  +   FTL  F+++YA
Sbjct: 305 GNVCFSSSQYSICFTLVSFAKIYA 328



 Score = 35.1 bits (77), Expect = 0.29
 Identities = 19/72 (26%), Positives = 34/72 (47%), Gaps = 1/72 (1%)
 Frame = +1

Query: 67  FTVDEIRGMMDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETR-FTDTRKD 243
           + +D +  +MD    IRN+++  H+ HGK+   D L+ +       R  +   +TD    
Sbjct: 114 YEMDFLADLMDNSELIRNVTLCGHLHHGKTCFVDCLIEQTHPEIRKRYDQDLCYTDILFT 173

Query: 244 EQDRASPLNLRP 279
           EQ+R   +   P
Sbjct: 174 EQERGVGIKSTP 185


>AJ505017-1|CAD43720.1|  850|Homo sapiens small nuclear
           ribonucleoprotein component protein.
          Length = 850

 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 25/65 (38%), Positives = 39/65 (60%)
 Frame = +3

Query: 315 VFITNPDQREKSEKGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETV 494
           V +  PD + KS   +L N++D+PGHV+FS EVTA LR++DG +            TE +
Sbjct: 64  VTVVLPDTKGKS---YLFNIMDTPGHVNFSDEVTAGLRISDGVVLFIDAAEGVMLNTERL 120

Query: 495 LRQAM 509
           ++ A+
Sbjct: 121 IKHAV 125



 Score = 41.1 bits (92), Expect = 0.004
 Identities = 25/84 (29%), Positives = 41/84 (48%)
 Frame = +2

Query: 512 ERIKPILFMNKMDRXXXXXXXXXXXXYQTFQRIVENVNVIIATYNDDGGPMGEVRVDPSK 691
           ER+   + +NK+DR            Y   + IV+ VN +I+ Y+ D      + + P  
Sbjct: 127 ERLAVTVCINKIDRLILELKLPPTDAYYKLRHIVDEVNGLISMYSTD----ENLILSPLL 182

Query: 692 GSVGFGSGLHGWAFTLKQFSEMYA 763
           G+V F S  +   FTL  F+++YA
Sbjct: 183 GNVCFSSSQYSICFTLGSFAKIYA 206



 Score = 31.9 bits (69), Expect = 2.7
 Identities = 18/63 (28%), Positives = 29/63 (46%), Gaps = 1/63 (1%)
 Frame = +1

Query: 94  MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETR-FTDTRKDEQDRASPLN 270
           MD    IRN+++  H+ HGK+   D L+ +       R  +   +TD    EQ+R   + 
Sbjct: 1   MDNSELIRNVTLCGHLHHGKTCFVDCLIEQTHPEIRKRYDQDLCYTDILFTEQERGVGIK 60

Query: 271 LRP 279
             P
Sbjct: 61  STP 63


>BC049210-1|AAH49210.1|  751|Homo sapiens G elongation factor,
           mitochondrial 1 protein.
          Length = 751

 Score = 49.2 bits (112), Expect = 2e-05
 Identities = 25/46 (54%), Positives = 29/46 (63%)
 Frame = +3

Query: 366 INLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQ 503
           IN+ID+PGHVDF+ EV  ALRV DGA+           QT TV RQ
Sbjct: 116 INIIDTPGHVDFTIEVERALRVLDGAVLVLCAVGGVQCQTMTVNRQ 161



 Score = 33.5 bits (73), Expect = 0.87
 Identities = 14/29 (48%), Positives = 21/29 (72%)
 Frame = +1

Query: 112 IRNMSVIAHVDHGKSTLTDSLVSKAGIIA 198
           IRN+ + AH+D GK+TLT+ ++   G IA
Sbjct: 46  IRNIGISAHIDSGKTTLTERVLYYTGRIA 74


>AF367998-1|AAK53402.1|  751|Homo sapiens elongation factor G1
           protein.
          Length = 751

 Score = 49.2 bits (112), Expect = 2e-05
 Identities = 25/46 (54%), Positives = 29/46 (63%)
 Frame = +3

Query: 366 INLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQ 503
           IN+ID+PGHVDF+ EV  ALRV DGA+           QT TV RQ
Sbjct: 116 INIIDTPGHVDFTIEVERALRVLDGAVLVLCAVGGVQCQTMTVNRQ 161



 Score = 33.5 bits (73), Expect = 0.87
 Identities = 14/29 (48%), Positives = 21/29 (72%)
 Frame = +1

Query: 112 IRNMSVIAHVDHGKSTLTDSLVSKAGIIA 198
           IRN+ + AH+D GK+TLT+ ++   G IA
Sbjct: 46  IRNIGISAHIDSGKTTLTERVLYYTGRIA 74


>AF309777-1|AAK58877.1|  751|Homo sapiens elongation factor G
           protein.
          Length = 751

 Score = 49.2 bits (112), Expect = 2e-05
 Identities = 25/46 (54%), Positives = 29/46 (63%)
 Frame = +3

Query: 366 INLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQ 503
           IN+ID+PGHVDF+ EV  ALRV DGA+           QT TV RQ
Sbjct: 116 INIIDTPGHVDFTIEVERALRVLDGAVLVLCAVGGVQCQTMTVNRQ 161



 Score = 33.5 bits (73), Expect = 0.87
 Identities = 14/29 (48%), Positives = 21/29 (72%)
 Frame = +1

Query: 112 IRNMSVIAHVDHGKSTLTDSLVSKAGIIA 198
           IRN+ + AH+D GK+TLT+ ++   G IA
Sbjct: 46  IRNIGISAHIDSGKTTLTERVLYYTGRIA 74


>AK023282-1|BAB14507.1|  669|Homo sapiens protein ( Homo sapiens
           cDNA FLJ13220 fis, clone NT2RP4002047, moderately
           similar to GTP-BINDING PROTEIN LEPA. ).
          Length = 669

 Score = 47.2 bits (107), Expect = 7e-05
 Identities = 20/29 (68%), Positives = 23/29 (79%)
 Frame = +1

Query: 109 NIRNMSVIAHVDHGKSTLTDSLVSKAGII 195
           NIRN S++AHVDHGKSTLTD L+   G I
Sbjct: 67  NIRNFSIVAHVDHGKSTLTDRLLELTGTI 95



 Score = 41.9 bits (94), Expect = 0.002
 Identities = 18/31 (58%), Positives = 23/31 (74%)
 Frame = +3

Query: 354 KGFLINLIDSPGHVDFSSEVTAALRVTDGAL 446
           K +L+NLID+PGHVDFS EV+ +L    G L
Sbjct: 132 KQYLLNLIDTPGHVDFSYEVSRSLSACQGVL 162


>BC036768-1|AAH36768.1|  669|Homo sapiens GUF1 GTPase homolog (S.
           cerevisiae) protein.
          Length = 669

 Score = 45.2 bits (102), Expect = 3e-04
 Identities = 19/29 (65%), Positives = 22/29 (75%)
 Frame = +1

Query: 109 NIRNMSVIAHVDHGKSTLTDSLVSKAGII 195
           NIRN S++AHVDHGKSTL D L+   G I
Sbjct: 67  NIRNFSIVAHVDHGKSTLADRLLELTGTI 95



 Score = 41.9 bits (94), Expect = 0.002
 Identities = 18/31 (58%), Positives = 23/31 (74%)
 Frame = +3

Query: 354 KGFLINLIDSPGHVDFSSEVTAALRVTDGAL 446
           K +L+NLID+PGHVDFS EV+ +L    G L
Sbjct: 132 KQYLLNLIDTPGHVDFSYEVSRSLSACQGVL 162


>AF264621-1|AAG03013.1|  174|Homo sapiens uncharacterized gastric
           protein YA42P protein.
          Length = 174

 Score = 42.3 bits (95), Expect = 0.002
 Identities = 17/31 (54%), Positives = 25/31 (80%)
 Frame = +3

Query: 354 KGFLINLIDSPGHVDFSSEVTAALRVTDGAL 446
           K ++ +LID+PGHVDF+ EV+ +L  T+GAL
Sbjct: 9   KDYIFHLIDTPGHVDFTYEVSRSLAATEGAL 39


>X84694-1|CAA59169.1|  452|Homo sapiens mitochondrial elongation
           factor Tu protein.
          Length = 452

 Score = 34.7 bits (76), Expect = 0.38
 Identities = 17/51 (33%), Positives = 26/51 (50%)
 Frame = +1

Query: 118 NMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQDRASPLN 270
           N+  I HVDHGK+TLT ++        GA+  +    D   +E+ R   +N
Sbjct: 59  NVGTIGHVDHGKTTLTAAITKILAEGGGAKFKKYEEIDNAPEERARGITIN 109


>S75463-1|AAC60647.1|  452|Homo sapiens P43 protein.
          Length = 452

 Score = 34.7 bits (76), Expect = 0.38
 Identities = 17/51 (33%), Positives = 26/51 (50%)
 Frame = +1

Query: 118 NMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQDRASPLN 270
           N+  I HVDHGK+TLT ++        GA+  +    D   +E+ R   +N
Sbjct: 62  NVGTIGHVDHGKTTLTAAITKILAEGGGAKFKKYEEIDNAPEERARGITIN 112


>L38995-1|AAB00499.1|  452|Homo sapiens elongation factor Tu
           protein.
          Length = 452

 Score = 34.7 bits (76), Expect = 0.38
 Identities = 17/51 (33%), Positives = 26/51 (50%)
 Frame = +1

Query: 118 NMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQDRASPLN 270
           N+  I HVDHGK+TLT ++        GA+  +    D   +E+ R   +N
Sbjct: 59  NVGTIGHVDHGKTTLTAAITKILAEGGGAKFKKYEEIDNAPEERARGITIN 109


>BC010041-1|AAH10041.2|  455|Homo sapiens Tu translation elongation
           factor, mitochondrial protein.
          Length = 455

 Score = 34.7 bits (76), Expect = 0.38
 Identities = 17/51 (33%), Positives = 26/51 (50%)
 Frame = +1

Query: 118 NMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQDRASPLN 270
           N+  I HVDHGK+TLT ++        GA+  +    D   +E+ R   +N
Sbjct: 62  NVGTIGHVDHGKTTLTAAITKILAEGGGAKFKKYEEIDNAPEERARGITIN 112


>BC001633-1|AAH01633.2|  455|Homo sapiens Tu translation elongation
           factor, mitochondrial protein.
          Length = 455

 Score = 34.7 bits (76), Expect = 0.38
 Identities = 17/51 (33%), Positives = 26/51 (50%)
 Frame = +1

Query: 118 NMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQDRASPLN 270
           N+  I HVDHGK+TLT ++        GA+  +    D   +E+ R   +N
Sbjct: 62  NVGTIGHVDHGKTTLTAAITKILAEGGGAKFKKYEEIDNAPEERARGITIN 112


>X70940-1|CAA50280.1|  463|Homo sapiens elongation factor 1 alpha-2
           protein.
          Length = 463

 Score = 33.9 bits (74), Expect = 0.66
 Identities = 16/32 (50%), Positives = 20/32 (62%)
 Frame = +1

Query: 94  MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAG 189
           M K++   N+ VI HVD GKST T  L+ K G
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCG 32


>X16869-1|CAA34756.1|  462|Homo sapiens protein ( Human mRNA for
           elongation factor 1-alpha (clone CEF4). ).
          Length = 462

 Score = 33.9 bits (74), Expect = 0.66
 Identities = 16/32 (50%), Positives = 20/32 (62%)
 Frame = +1

Query: 94  MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAG 189
           M K++   N+ VI HVD GKST T  L+ K G
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCG 32


>X03689-1|CAA27325.1|   94|Homo sapiens protein ( Human mRNA
           fragment for elongation factor TU (N-terminus). ).
          Length = 94

 Score = 33.9 bits (74), Expect = 0.66
 Identities = 16/32 (50%), Positives = 20/32 (62%)
 Frame = +1

Query: 94  MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAG 189
           M K++   N+ VI HVD GKST T  L+ K G
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCG 32


>X03558-1|CAA27245.1|  462|Homo sapiens protein ( Human mRNA for
           elongation factor 1 alpha subunit (EF-1 alpha). ).
          Length = 462

 Score = 33.9 bits (74), Expect = 0.66
 Identities = 16/32 (50%), Positives = 20/32 (62%)
 Frame = +1

Query: 94  MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAG 189
           M K++   N+ VI HVD GKST T  L+ K G
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCG 32


>J04617-1|AAA52343.1|  462|Homo sapiens EEF1A protein.
          Length = 462

 Score = 33.9 bits (74), Expect = 0.66
 Identities = 16/32 (50%), Positives = 20/32 (62%)
 Frame = +1

Query: 94  MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAG 189
           M K++   N+ VI HVD GKST T  L+ K G
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCG 32


>EF362804-1|ABO30531.1|  462|Homo sapiens EF1a protein.
          Length = 462

 Score = 33.9 bits (74), Expect = 0.66
 Identities = 16/32 (50%), Positives = 20/32 (62%)
 Frame = +1

Query: 94  MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAG 189
           M K++   N+ VI HVD GKST T  L+ K G
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCG 32


>BC111051-1|AAI11052.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score = 33.9 bits (74), Expect = 0.66
 Identities = 16/32 (50%), Positives = 20/32 (62%)
 Frame = +1

Query: 94  MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAG 189
           M K++   N+ VI HVD GKST T  L+ K G
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCG 32


>BC110409-1|AAI10410.1|  463|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 2 protein.
          Length = 463

 Score = 33.9 bits (74), Expect = 0.66
 Identities = 16/32 (50%), Positives = 20/32 (62%)
 Frame = +1

Query: 94  MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAG 189
           M K++   N+ VI HVD GKST T  L+ K G
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCG 32


>BC082268-1|AAH82268.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score = 33.9 bits (74), Expect = 0.66
 Identities = 16/32 (50%), Positives = 20/32 (62%)
 Frame = +1

Query: 94  MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAG 189
           M K++   N+ VI HVD GKST T  L+ K G
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCG 32


>BC072385-1|AAH72385.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score = 33.9 bits (74), Expect = 0.66
 Identities = 16/32 (50%), Positives = 20/32 (62%)
 Frame = +1

Query: 94  MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAG 189
           M K++   N+ VI HVD GKST T  L+ K G
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCG 32


>BC071841-1|AAH71841.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score = 33.9 bits (74), Expect = 0.66
 Identities = 16/32 (50%), Positives = 20/32 (62%)
 Frame = +1

Query: 94  MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAG 189
           M K++   N+ VI HVD GKST T  L+ K G
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCG 32


>BC071741-1|AAH71741.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score = 33.9 bits (74), Expect = 0.66
 Identities = 16/32 (50%), Positives = 20/32 (62%)
 Frame = +1

Query: 94  MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAG 189
           M K++   N+ VI HVD GKST T  L+ K G
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCG 32


>BC071619-1|AAH71619.1|  441|Homo sapiens EEF1A1 protein protein.
          Length = 441

 Score = 33.9 bits (74), Expect = 0.66
 Identities = 16/32 (50%), Positives = 20/32 (62%)
 Frame = +1

Query: 94  MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAG 189
           M K++   N+ VI HVD GKST T  L+ K G
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCG 32


>BC070500-1|AAH70500.1|   67|Homo sapiens EEF1A1 protein protein.
          Length = 67

 Score = 33.9 bits (74), Expect = 0.66
 Identities = 16/32 (50%), Positives = 20/32 (62%)
 Frame = +1

Query: 94  MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAG 189
           M K++   N+ VI HVD GKST T  L+ K G
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCG 32


>BC070131-1|AAH70131.1|  111|Homo sapiens EEF1A1 protein protein.
          Length = 111

 Score = 33.9 bits (74), Expect = 0.66
 Identities = 16/32 (50%), Positives = 20/32 (62%)
 Frame = +1

Query: 94  MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAG 189
           M K++   N+ VI HVD GKST T  L+ K G
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCG 32


>BC066893-1|AAH66893.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score = 33.9 bits (74), Expect = 0.66
 Identities = 16/32 (50%), Positives = 20/32 (62%)
 Frame = +1

Query: 94  MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAG 189
           M K++   N+ VI HVD GKST T  L+ K G
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCG 32


>BC057391-1|AAH57391.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score = 33.9 bits (74), Expect = 0.66
 Identities = 16/32 (50%), Positives = 20/32 (62%)
 Frame = +1

Query: 94  MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAG 189
           M K++   N+ VI HVD GKST T  L+ K G
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCG 32


>BC038339-1|AAH38339.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score = 33.9 bits (74), Expect = 0.66
 Identities = 16/32 (50%), Positives = 20/32 (62%)
 Frame = +1

Query: 94  MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAG 189
           M K++   N+ VI HVD GKST T  L+ K G
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCG 32


>BC028674-1|AAH28674.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score = 33.9 bits (74), Expect = 0.66
 Identities = 16/32 (50%), Positives = 20/32 (62%)
 Frame = +1

Query: 94  MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAG 189
           M K++   N+ VI HVD GKST T  L+ K G
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCG 32


>BC021686-1|AAH21686.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score = 33.9 bits (74), Expect = 0.66
 Identities = 16/32 (50%), Positives = 20/32 (62%)
 Frame = +1

Query: 94  MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAG 189
           M K++   N+ VI HVD GKST T  L+ K G
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCG 32


>BC019669-1|AAH19669.1|  462|Homo sapiens EEF1A1 protein protein.
          Length = 462

 Score = 33.9 bits (74), Expect = 0.66
 Identities = 16/32 (50%), Positives = 20/32 (62%)
 Frame = +1

Query: 94  MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAG 189
           M K++   N+ VI HVD GKST T  L+ K G
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCG 32


>BC018641-1|AAH18641.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score = 33.9 bits (74), Expect = 0.66
 Identities = 16/32 (50%), Positives = 20/32 (62%)
 Frame = +1

Query: 94  MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAG 189
           M K++   N+ VI HVD GKST T  L+ K G
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCG 32


>BC018150-1|AAH18150.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score = 33.9 bits (74), Expect = 0.66
 Identities = 16/32 (50%), Positives = 20/32 (62%)
 Frame = +1

Query: 94  MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAG 189
           M K++   N+ VI HVD GKST T  L+ K G
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCG 32


>BC014224-1|AAH14224.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score = 33.9 bits (74), Expect = 0.66
 Identities = 16/32 (50%), Positives = 20/32 (62%)
 Frame = +1

Query: 94  MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAG 189
           M K++   N+ VI HVD GKST T  L+ K G
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCG 32


>BC012891-1|AAH12891.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score = 33.9 bits (74), Expect = 0.66
 Identities = 16/32 (50%), Positives = 20/32 (62%)
 Frame = +1

Query: 94  MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAG 189
           M K++   N+ VI HVD GKST T  L+ K G
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCG 32


>BC010735-1|AAH10735.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score = 33.9 bits (74), Expect = 0.66
 Identities = 16/32 (50%), Positives = 20/32 (62%)
 Frame = +1

Query: 94  MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAG 189
           M K++   N+ VI HVD GKST T  L+ K G
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCG 32


>BC009875-1|AAH09875.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score = 33.9 bits (74), Expect = 0.66
 Identities = 16/32 (50%), Positives = 20/32 (62%)
 Frame = +1

Query: 94  MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAG 189
           M K++   N+ VI HVD GKST T  L+ K G
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCG 32


>BC009733-1|AAH09733.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score = 33.9 bits (74), Expect = 0.66
 Identities = 16/32 (50%), Positives = 20/32 (62%)
 Frame = +1

Query: 94  MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAG 189
           M K++   N+ VI HVD GKST T  L+ K G
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCG 32


>BC008587-1|AAH08587.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score = 33.9 bits (74), Expect = 0.66
 Identities = 16/32 (50%), Positives = 20/32 (62%)
 Frame = +1

Query: 94  MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAG 189
           M K++   N+ VI HVD GKST T  L+ K G
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCG 32


>BC000432-1|AAH00432.1|  463|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 2 protein.
          Length = 463

 Score = 33.9 bits (74), Expect = 0.66
 Identities = 16/32 (50%), Positives = 20/32 (62%)
 Frame = +1

Query: 94  MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAG 189
           M K++   N+ VI HVD GKST T  L+ K G
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCG 32


>AY043301-1|AAK95378.1|  462|Homo sapiens elongation factor 1-alpha
           protein.
          Length = 462

 Score = 33.9 bits (74), Expect = 0.66
 Identities = 16/32 (50%), Positives = 20/32 (62%)
 Frame = +1

Query: 94  MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAG 189
           M K++   N+ VI HVD GKST T  L+ K G
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCG 32


>AL603910-10|CAO03613.1|  107|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 107

 Score = 33.9 bits (74), Expect = 0.66
 Identities = 16/32 (50%), Positives = 20/32 (62%)
 Frame = +1

Query: 94  MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAG 189
           M K++   N+ VI HVD GKST T  L+ K G
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCG 32


>AL603910-9|CAI40951.1|  145|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 145

 Score = 33.9 bits (74), Expect = 0.66
 Identities = 16/32 (50%), Positives = 20/32 (62%)
 Frame = +1

Query: 94  MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAG 189
           M K++   N+ VI HVD GKST T  L+ K G
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCG 32


>AL603910-8|CAI14883.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score = 33.9 bits (74), Expect = 0.66
 Identities = 16/32 (50%), Positives = 20/32 (62%)
 Frame = +1

Query: 94  MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAG 189
           M K++   N+ VI HVD GKST T  L+ K G
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCG 32


>AL593851-4|CAH73620.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha-like 3 protein.
          Length = 462

 Score = 33.9 bits (74), Expect = 0.66
 Identities = 16/32 (50%), Positives = 20/32 (62%)
 Frame = +1

Query: 94  MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAG 189
           M K++   N+ VI HVD GKST T  L+ K G
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCG 32


>AL121829-9|CAC15522.1|  463|Homo sapiens EEF1A2 protein.
          Length = 463

 Score = 33.9 bits (74), Expect = 0.66
 Identities = 16/32 (50%), Positives = 20/32 (62%)
 Frame = +1

Query: 94  MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAG 189
           M K++   N+ VI HVD GKST T  L+ K G
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCG 32


>AK223046-1|BAD96766.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 variant protein.
          Length = 462

 Score = 33.9 bits (74), Expect = 0.66
 Identities = 16/32 (50%), Positives = 20/32 (62%)
 Frame = +1

Query: 94  MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAG 189
           M K++   N+ VI HVD GKST T  L+ K G
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCG 32


>AK223030-1|BAD96750.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 variant protein.
          Length = 462

 Score = 33.9 bits (74), Expect = 0.66
 Identities = 16/32 (50%), Positives = 20/32 (62%)
 Frame = +1

Query: 94  MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAG 189
           M K++   N+ VI HVD GKST T  L+ K G
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCG 32


>AK222982-1|BAD96702.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 variant protein.
          Length = 462

 Score = 33.9 bits (74), Expect = 0.66
 Identities = 16/32 (50%), Positives = 20/32 (62%)
 Frame = +1

Query: 94  MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAG 189
           M K++   N+ VI HVD GKST T  L+ K G
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCG 32


>AK222551-1|BAD96271.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 variant protein.
          Length = 462

 Score = 33.9 bits (74), Expect = 0.66
 Identities = 16/32 (50%), Positives = 20/32 (62%)
 Frame = +1

Query: 94  MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAG 189
           M K++   N+ VI HVD GKST T  L+ K G
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCG 32


>AK222523-1|BAD96243.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 variant protein.
          Length = 462

 Score = 33.9 bits (74), Expect = 0.66
 Identities = 16/32 (50%), Positives = 20/32 (62%)
 Frame = +1

Query: 94  MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAG 189
           M K++   N+ VI HVD GKST T  L+ K G
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCG 32


>AK222515-1|BAD96235.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 variant protein.
          Length = 462

 Score = 33.9 bits (74), Expect = 0.66
 Identities = 16/32 (50%), Positives = 20/32 (62%)
 Frame = +1

Query: 94  MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAG 189
           M K++   N+ VI HVD GKST T  L+ K G
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCG 32


>AF267861-1|AAG44730.1|  427|Homo sapiens EF1a-like protein protein.
          Length = 427

 Score = 33.9 bits (74), Expect = 0.66
 Identities = 16/32 (50%), Positives = 20/32 (62%)
 Frame = +1

Query: 94  MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAG 189
           M K++   N+ VI HVD GKST T  L+ K G
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCG 32


>AF163763-1|AAF80488.1|  463|Homo sapiens elongation factor 1 A-2
           protein.
          Length = 463

 Score = 33.9 bits (74), Expect = 0.66
 Identities = 16/32 (50%), Positives = 20/32 (62%)
 Frame = +1

Query: 94  MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAG 189
           M K++   N+ VI HVD GKST T  L+ K G
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCG 32


>BC071727-1|AAH71727.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score = 33.1 bits (72), Expect = 1.2
 Identities = 16/32 (50%), Positives = 20/32 (62%)
 Frame = +1

Query: 94  MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAG 189
           M K++   N+ VI HVD GKST T  L+ K G
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKFG 32


>AL096771-1|CAM28080.1|  637|Homo sapiens collagen type XII alpha 1
           protein.
          Length = 637

 Score = 32.3 bits (70), Expect = 2.0
 Identities = 14/39 (35%), Positives = 21/39 (53%)
 Frame = -2

Query: 714 PDPKPTEPLLGSTRTSPMGPPSSLYVAIMTLTFSTIRWN 598
           PD   ++ L+GS RT P   P +L V   T    T++W+
Sbjct: 470 PDESESDDLIGSERTPPKSGPRNLQVYNATSNSLTVKWD 508


>BC110605-1|AAI10606.1|  318|Homo sapiens EPN3 protein protein.
          Length = 318

 Score = 30.3 bits (65), Expect = 8.1
 Identities = 13/25 (52%), Positives = 16/25 (64%)
 Frame = -2

Query: 681 STRTSPMGPPSSLYVAIMTLTFSTI 607
           +T   P GPPSSL   I  LTF+T+
Sbjct: 27  ATSNDPWGPPSSLMSEIADLTFNTV 51


>BC077722-1|AAH77722.1|  208|Homo sapiens EPN3 protein protein.
          Length = 208

 Score = 30.3 bits (65), Expect = 8.1
 Identities = 13/25 (52%), Positives = 16/25 (64%)
 Frame = -2

Query: 681 STRTSPMGPPSSLYVAIMTLTFSTI 607
           +T   P GPPSSL   I  LTF+T+
Sbjct: 27  ATSNDPWGPPSSLMSEIADLTFNTV 51


>BC051365-1|AAH51365.1|  208|Homo sapiens EPN3 protein protein.
          Length = 208

 Score = 30.3 bits (65), Expect = 8.1
 Identities = 13/25 (52%), Positives = 16/25 (64%)
 Frame = -2

Query: 681 STRTSPMGPPSSLYVAIMTLTFSTI 607
           +T   P GPPSSL   I  LTF+T+
Sbjct: 27  ATSNDPWGPPSSLMSEIADLTFNTV 51


>BC001038-1|AAH01038.1|  208|Homo sapiens EPN3 protein protein.
          Length = 208

 Score = 30.3 bits (65), Expect = 8.1
 Identities = 13/25 (52%), Positives = 16/25 (64%)
 Frame = -2

Query: 681 STRTSPMGPPSSLYVAIMTLTFSTI 607
           +T   P GPPSSL   I  LTF+T+
Sbjct: 27  ATSNDPWGPPSSLMSEIADLTFNTV 51


>AK000785-1|BAA91378.1|  632|Homo sapiens protein ( Homo sapiens
           cDNA FLJ20778 fis, clone COL05704. ).
          Length = 632

 Score = 30.3 bits (65), Expect = 8.1
 Identities = 13/25 (52%), Positives = 16/25 (64%)
 Frame = -2

Query: 681 STRTSPMGPPSSLYVAIMTLTFSTI 607
           +T   P GPPSSL   I  LTF+T+
Sbjct: 27  ATSNDPWGPPSSLMSEIADLTFNTV 51


>AF324241-1|AAG45223.1|  632|Homo sapiens epsin 3 protein.
          Length = 632

 Score = 30.3 bits (65), Expect = 8.1
 Identities = 13/25 (52%), Positives = 16/25 (64%)
 Frame = -2

Query: 681 STRTSPMGPPSSLYVAIMTLTFSTI 607
           +T   P GPPSSL   I  LTF+T+
Sbjct: 27  ATSNDPWGPPSSLMSEIADLTFNTV 51


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 119,683,362
Number of Sequences: 237096
Number of extensions: 2670480
Number of successful extensions: 6820
Number of sequences better than 10.0: 78
Number of HSP's better than 10.0 without gapping: 6171
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6806
length of database: 76,859,062
effective HSP length: 89
effective length of database: 55,757,518
effective search space used: 9478778060
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -