SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20050
         (647 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

X16869-1|CAA34756.1|  462|Homo sapiens protein ( Human mRNA for ...   174   3e-43
X03558-1|CAA27245.1|  462|Homo sapiens protein ( Human mRNA for ...   174   3e-43
J04617-1|AAA52343.1|  462|Homo sapiens EEF1A protein.                 174   3e-43
EF362804-1|ABO30531.1|  462|Homo sapiens EF1a protein.                174   3e-43
BC111051-1|AAI11052.1|  462|Homo sapiens eukaryotic translation ...   174   3e-43
BC082268-1|AAH82268.1|  462|Homo sapiens eukaryotic translation ...   174   3e-43
BC072385-1|AAH72385.1|  462|Homo sapiens eukaryotic translation ...   174   3e-43
BC071841-1|AAH71841.1|  462|Homo sapiens eukaryotic translation ...   174   3e-43
BC071741-1|AAH71741.1|  462|Homo sapiens eukaryotic translation ...   174   3e-43
BC071727-1|AAH71727.1|  462|Homo sapiens eukaryotic translation ...   174   3e-43
BC066893-1|AAH66893.1|  462|Homo sapiens eukaryotic translation ...   174   3e-43
BC057391-1|AAH57391.1|  462|Homo sapiens eukaryotic translation ...   174   3e-43
BC038339-1|AAH38339.1|  462|Homo sapiens eukaryotic translation ...   174   3e-43
BC028674-1|AAH28674.1|  462|Homo sapiens eukaryotic translation ...   174   3e-43
BC021686-1|AAH21686.1|  462|Homo sapiens eukaryotic translation ...   174   3e-43
BC019669-1|AAH19669.1|  462|Homo sapiens EEF1A1 protein protein.      174   3e-43
BC018641-1|AAH18641.1|  462|Homo sapiens eukaryotic translation ...   174   3e-43
BC018150-1|AAH18150.1|  462|Homo sapiens eukaryotic translation ...   174   3e-43
BC014224-1|AAH14224.1|  462|Homo sapiens eukaryotic translation ...   174   3e-43
BC012891-1|AAH12891.1|  462|Homo sapiens eukaryotic translation ...   174   3e-43
BC010735-1|AAH10735.1|  462|Homo sapiens eukaryotic translation ...   174   3e-43
BC009875-1|AAH09875.1|  462|Homo sapiens eukaryotic translation ...   174   3e-43
BC009733-1|AAH09733.1|  462|Homo sapiens eukaryotic translation ...   174   3e-43
BC008587-1|AAH08587.1|  462|Homo sapiens eukaryotic translation ...   174   3e-43
AY043301-1|AAK95378.1|  462|Homo sapiens elongation factor 1-alp...   174   3e-43
AL603910-8|CAI14883.1|  462|Homo sapiens eukaryotic translation ...   174   3e-43
AL593851-4|CAH73620.1|  462|Homo sapiens eukaryotic translation ...   174   3e-43
AK223046-1|BAD96766.1|  462|Homo sapiens eukaryotic translation ...   174   3e-43
AK223030-1|BAD96750.1|  462|Homo sapiens eukaryotic translation ...   174   3e-43
AK222982-1|BAD96702.1|  462|Homo sapiens eukaryotic translation ...   174   3e-43
AK222551-1|BAD96271.1|  462|Homo sapiens eukaryotic translation ...   174   3e-43
AK222523-1|BAD96243.1|  462|Homo sapiens eukaryotic translation ...   174   3e-43
AK222515-1|BAD96235.1|  462|Homo sapiens eukaryotic translation ...   174   3e-43
AF267861-1|AAG44730.1|  427|Homo sapiens EF1a-like protein protein.   174   3e-43
AF397403-1|AAK93966.1|  398|Homo sapiens translation elongation ...   173   5e-43
AF174496-1|AAF36537.1|  426|Homo sapiens glucocorticoid receptor...   173   6e-43
X70940-1|CAA50280.1|  463|Homo sapiens elongation factor 1 alpha...   172   8e-43
L10340-1|AAA91835.1|  435|Homo sapiens elongation factor-1 alpha...   172   8e-43
BC110409-1|AAI10410.1|  463|Homo sapiens eukaryotic translation ...   172   8e-43
BC000432-1|AAH00432.1|  463|Homo sapiens eukaryotic translation ...   172   8e-43
AL121829-9|CAC15522.1|  463|Homo sapiens EEF1A2 protein.              172   8e-43
AF163763-1|AAF80488.1|  463|Homo sapiens elongation factor 1 A-2...   172   8e-43
AK223042-1|BAD96762.1|  433|Homo sapiens eukaryotic translation ...   172   1e-42
L41498-1|AAC09386.1|  398|Homo sapiens longation factor 1-alpha ...   171   1e-42
L41490-1|AAC09385.1|  398|Homo sapiens eukaryotic translation el...   171   1e-42
AY062434-1|AAL38981.1|  398|Homo sapiens elongation factor 1-alp...   171   1e-42
AB209064-1|BAD92301.1|  340|Homo sapiens eukaryotic translation ...   171   1e-42
AL603910-9|CAI40951.1|  145|Homo sapiens eukaryotic translation ...   161   1e-39
BC071619-1|AAH71619.1|  441|Homo sapiens EEF1A1 protein protein.      155   1e-37
X03689-1|CAA27325.1|   94|Homo sapiens protein ( Human mRNA frag...   141   2e-33
BC070131-1|AAH70131.1|  111|Homo sapiens EEF1A1 protein protein.      141   2e-33
AL603910-10|CAO03613.1|  107|Homo sapiens eukaryotic translation...   141   2e-33
U87791-1|AAD00645.1|  684|Homo sapiens eRFS protein.                  113   7e-25
BC040849-1|AAH40849.1|  684|Homo sapiens HBS1-like (S. cerevisia...   113   7e-25
BC001465-1|AAH01465.1|  684|Homo sapiens HBS1-like (S. cerevisia...   113   7e-25
AL445190-5|CAI95161.1|  684|Homo sapiens HBS1-like (S. cerevisia...   113   7e-25
AL353596-2|CAI17912.1|  684|Homo sapiens HBS1-like (S. cerevisia...   113   7e-25
AJ459826-1|CAD30873.1|  684|Homo sapiens HBS1-like protein protein.   113   7e-25
AB028961-1|BAA82990.1|  496|Homo sapiens KIAA1038 protein protein.    113   7e-25
AK222519-1|BAD96239.1|  366|Homo sapiens eukaryotic translation ...   111   2e-24
BC070500-1|AAH70500.1|   67|Homo sapiens EEF1A1 protein protein.      108   2e-23
X17644-1|CAA35635.1|  499|Homo sapiens protein ( Human GST1-Hs m...   105   2e-22
U95742-2|AAB67250.1|  499|Homo sapiens G1 to S phase transition ...   105   2e-22
BT006722-1|AAP35368.1|  498|Homo sapiens G1 to S phase transitio...   105   2e-22
BC009503-1|AAH09503.2|  633|Homo sapiens GSPT1 protein protein.       105   2e-22
BC036077-1|AAH36077.1|  628|Homo sapiens G1 to S phase transitio...   103   4e-22
AL929101-2|CAH71524.1|  628|Homo sapiens G1 to S phase transitio...   103   4e-22
AK023155-1|BAB14435.1|  504|Homo sapiens protein ( Homo sapiens ...   103   4e-22
AJ251548-1|CAB91089.1|  628|Homo sapiens polypeptide chain relea...   103   4e-22
AK001303-1|BAA91612.1|  628|Homo sapiens protein ( Homo sapiens ...   103   5e-22
AF328730-1|AAN09722.1|  361|Homo sapiens CTCL tumor antigen HD-C...   101   3e-21
AF322220-1|AAN51932.1|  361|Homo sapiens cervical cancer suppres...   101   3e-21
AL445190-4|CAI95162.1|  453|Homo sapiens HBS1-like (S. cerevisia...    82   1e-15
AL353596-1|CAI17913.1|  453|Homo sapiens HBS1-like (S. cerevisia...    82   1e-15
M29548-1|AAA52367.1|  327|Homo sapiens EEF1A protein.                  79   2e-14
BC094687-1|AAH94687.1|  308|Homo sapiens EEF1A1 protein protein.       79   2e-14
X84694-1|CAA59169.1|  452|Homo sapiens mitochondrial elongation ...    69   2e-11
S75463-1|AAC60647.1|  452|Homo sapiens P43 protein.                    69   2e-11
L38995-1|AAB00499.1|  452|Homo sapiens elongation factor Tu prot...    69   2e-11
BC010041-1|AAH10041.2|  455|Homo sapiens Tu translation elongati...    69   2e-11
BC001633-1|AAH01633.2|  455|Homo sapiens Tu translation elongati...    69   2e-11
BC063511-1|AAH63511.1|  290|Homo sapiens EEF1A1 protein protein.       52   1e-06
BC014377-1|AAH14377.1|  287|Homo sapiens Unknown (protein for IM...    47   7e-05
BC030612-1|AAH30612.1|  777|Homo sapiens G elongation factor, mi...    39   0.013
BC015712-1|AAH15712.1|  779|Homo sapiens GFM2 protein protein.         39   0.013
AY453587-1|AAS49035.1|  531|Homo sapiens elongation factor G iso...    39   0.013
AK025314-1|BAB15109.1|  513|Homo sapiens protein ( Homo sapiens ...    39   0.013
AF367997-1|AAK53401.1|  779|Homo sapiens elongation factor G2 pr...    39   0.013
AF111808-1|AAL39010.1|  732|Homo sapiens MSTP027 protein.              39   0.013
BC036768-1|AAH36768.1|  669|Homo sapiens GUF1 GTPase homolog (S....    33   0.66 
AK023282-1|BAB14507.1|  669|Homo sapiens protein ( Homo sapiens ...    33   0.66 
BC049210-1|AAH49210.1|  751|Homo sapiens G elongation factor, mi...    33   0.88 
AF367998-1|AAK53402.1|  751|Homo sapiens elongation factor G1 pr...    33   0.88 
AF309777-1|AAK58877.1|  751|Homo sapiens elongation factor G pro...    33   0.88 
Z11692-1|CAA77750.1|  858|Homo sapiens human  elongation factor ...    33   1.2  
X51466-1|CAA35829.1|  858|Homo sapiens elongation factor 2 protein.    33   1.2  
L19161-1|AAA19696.1|  472|Homo sapiens translation initiation fa...    33   1.2  
DQ120619-1|ABB92405.1|  471|Homo sapiens eFI-2-gamma protein.          33   1.2  
BC126259-1|AAI26260.1|  858|Homo sapiens EEF2 protein protein.         33   1.2  
BC087847-1|AAH87847.1|  465|Homo sapiens Unknown (protein for IM...    33   1.2  
BC019906-1|AAH19906.1|  472|Homo sapiens eukaryotic translation ...    33   1.2  
BC006547-1|AAH06547.1|  583|Homo sapiens EEF2 protein protein.         33   1.2  
AY942181-1|AAX34409.1|  858|Homo sapiens elongation factor 2 pro...    33   1.2  
AK222577-1|BAD96297.1|  472|Homo sapiens eukaryotic translation ...    33   1.2  
AJ006932-1|CAA07331.1|  248|Homo sapiens eIF-2gA protein.              33   1.2  
L34600-1|AAA67038.1|  727|Homo sapiens initiation factor 2 protein.    31   2.7  
BC064977-1|AAH64977.1|  465|Homo sapiens MTIF2 protein protein.        31   2.7  
BC039848-1|AAH39848.1|  500|Homo sapiens Similar to mitochondria...    31   2.7  
AF495546-1|AAM70196.1|  727|Homo sapiens translation initiation ...    31   2.7  
AF494407-1|AAM14617.1|  727|Homo sapiens mitochondrial translati...    31   2.7  
BC007933-1|AAH07933.1|  569|Homo sapiens EEFSEC protein protein.       31   3.5  
AF268872-1|AAG13375.1|  526|Homo sapiens MJ0495-like protein Sel...    31   3.5  

>X16869-1|CAA34756.1|  462|Homo sapiens protein ( Human mRNA for
           elongation factor 1-alpha (clone CEF4). ).
          Length = 462

 Score =  174 bits (423), Expect = 3e-43
 Identities = 87/119 (73%), Positives = 96/119 (80%)
 Frame = +1

Query: 160 QTYHREVREGGPGNG*RILQICLGIGQTKG*AERGITIDIALWKFETSKYYVTIIDAPGH 339
           + + +E  E G G+     +    + + K   ERGITIDI+LWKFETSKYYVTIIDAPGH
Sbjct: 40  EKFEKEAAEMGKGS----FKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGH 95

Query: 340 RDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGETK 516
           RDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQTREHALLA+TLGVKQLIVG  K
Sbjct: 96  RDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNK 154



 Score =  141 bits (342), Expect = 2e-33
 Identities = 65/66 (98%), Positives = 65/66 (98%)
 Frame = +2

Query: 56  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 235
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 236 DKLKAE 253
           DKLKAE
Sbjct: 61  DKLKAE 66



 Score = 78.6 bits (185), Expect = 2e-14
 Identities = 34/42 (80%), Positives = 38/42 (90%)
 Frame = +2

Query: 521 STEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           STEPPYS+ R+EEI KEVS+YIKKIGYNP  VAFVPISGW+G
Sbjct: 157 STEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNG 198


>X03558-1|CAA27245.1|  462|Homo sapiens protein ( Human mRNA for
           elongation factor 1 alpha subunit (EF-1 alpha). ).
          Length = 462

 Score =  174 bits (423), Expect = 3e-43
 Identities = 87/119 (73%), Positives = 96/119 (80%)
 Frame = +1

Query: 160 QTYHREVREGGPGNG*RILQICLGIGQTKG*AERGITIDIALWKFETSKYYVTIIDAPGH 339
           + + +E  E G G+     +    + + K   ERGITIDI+LWKFETSKYYVTIIDAPGH
Sbjct: 40  EKFEKEAAEMGKGS----FKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGH 95

Query: 340 RDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGETK 516
           RDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQTREHALLA+TLGVKQLIVG  K
Sbjct: 96  RDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNK 154



 Score =  141 bits (342), Expect = 2e-33
 Identities = 65/66 (98%), Positives = 65/66 (98%)
 Frame = +2

Query: 56  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 235
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 236 DKLKAE 253
           DKLKAE
Sbjct: 61  DKLKAE 66



 Score = 78.6 bits (185), Expect = 2e-14
 Identities = 34/42 (80%), Positives = 38/42 (90%)
 Frame = +2

Query: 521 STEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           STEPPYS+ R+EEI KEVS+YIKKIGYNP  VAFVPISGW+G
Sbjct: 157 STEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNG 198


>J04617-1|AAA52343.1|  462|Homo sapiens EEF1A protein.
          Length = 462

 Score =  174 bits (423), Expect = 3e-43
 Identities = 87/119 (73%), Positives = 96/119 (80%)
 Frame = +1

Query: 160 QTYHREVREGGPGNG*RILQICLGIGQTKG*AERGITIDIALWKFETSKYYVTIIDAPGH 339
           + + +E  E G G+     +    + + K   ERGITIDI+LWKFETSKYYVTIIDAPGH
Sbjct: 40  EKFEKEAAEMGKGS----FKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGH 95

Query: 340 RDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGETK 516
           RDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQTREHALLA+TLGVKQLIVG  K
Sbjct: 96  RDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNK 154



 Score =  141 bits (342), Expect = 2e-33
 Identities = 65/66 (98%), Positives = 65/66 (98%)
 Frame = +2

Query: 56  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 235
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 236 DKLKAE 253
           DKLKAE
Sbjct: 61  DKLKAE 66



 Score = 78.6 bits (185), Expect = 2e-14
 Identities = 34/42 (80%), Positives = 38/42 (90%)
 Frame = +2

Query: 521 STEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           STEPPYS+ R+EEI KEVS+YIKKIGYNP  VAFVPISGW+G
Sbjct: 157 STEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNG 198


>EF362804-1|ABO30531.1|  462|Homo sapiens EF1a protein.
          Length = 462

 Score =  174 bits (423), Expect = 3e-43
 Identities = 87/119 (73%), Positives = 96/119 (80%)
 Frame = +1

Query: 160 QTYHREVREGGPGNG*RILQICLGIGQTKG*AERGITIDIALWKFETSKYYVTIIDAPGH 339
           + + +E  E G G+     +    + + K   ERGITIDI+LWKFETSKYYVTIIDAPGH
Sbjct: 40  EKFEKEAAEMGKGS----FKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGH 95

Query: 340 RDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGETK 516
           RDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQTREHALLA+TLGVKQLIVG  K
Sbjct: 96  RDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNK 154



 Score =  141 bits (342), Expect = 2e-33
 Identities = 65/66 (98%), Positives = 65/66 (98%)
 Frame = +2

Query: 56  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 235
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 236 DKLKAE 253
           DKLKAE
Sbjct: 61  DKLKAE 66



 Score = 78.6 bits (185), Expect = 2e-14
 Identities = 34/42 (80%), Positives = 38/42 (90%)
 Frame = +2

Query: 521 STEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           STEPPYS+ R+EEI KEVS+YIKKIGYNP  VAFVPISGW+G
Sbjct: 157 STEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNG 198


>BC111051-1|AAI11052.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score =  174 bits (423), Expect = 3e-43
 Identities = 87/119 (73%), Positives = 96/119 (80%)
 Frame = +1

Query: 160 QTYHREVREGGPGNG*RILQICLGIGQTKG*AERGITIDIALWKFETSKYYVTIIDAPGH 339
           + + +E  E G G+     +    + + K   ERGITIDI+LWKFETSKYYVTIIDAPGH
Sbjct: 40  EKFEKEAAEMGKGS----FKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGH 95

Query: 340 RDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGETK 516
           RDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQTREHALLA+TLGVKQLIVG  K
Sbjct: 96  RDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNK 154



 Score =  141 bits (342), Expect = 2e-33
 Identities = 65/66 (98%), Positives = 65/66 (98%)
 Frame = +2

Query: 56  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 235
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 236 DKLKAE 253
           DKLKAE
Sbjct: 61  DKLKAE 66



 Score = 78.6 bits (185), Expect = 2e-14
 Identities = 34/42 (80%), Positives = 38/42 (90%)
 Frame = +2

Query: 521 STEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           STEPPYS+ R+EEI KEVS+YIKKIGYNP  VAFVPISGW+G
Sbjct: 157 STEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNG 198


>BC082268-1|AAH82268.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score =  174 bits (423), Expect = 3e-43
 Identities = 87/119 (73%), Positives = 96/119 (80%)
 Frame = +1

Query: 160 QTYHREVREGGPGNG*RILQICLGIGQTKG*AERGITIDIALWKFETSKYYVTIIDAPGH 339
           + + +E  E G G+     +    + + K   ERGITIDI+LWKFETSKYYVTIIDAPGH
Sbjct: 40  EKFEKEAAEMGKGS----FKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGH 95

Query: 340 RDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGETK 516
           RDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQTREHALLA+TLGVKQLIVG  K
Sbjct: 96  RDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNK 154



 Score =  141 bits (342), Expect = 2e-33
 Identities = 65/66 (98%), Positives = 65/66 (98%)
 Frame = +2

Query: 56  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 235
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 236 DKLKAE 253
           DKLKAE
Sbjct: 61  DKLKAE 66



 Score = 78.6 bits (185), Expect = 2e-14
 Identities = 34/42 (80%), Positives = 38/42 (90%)
 Frame = +2

Query: 521 STEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           STEPPYS+ R+EEI KEVS+YIKKIGYNP  VAFVPISGW+G
Sbjct: 157 STEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNG 198


>BC072385-1|AAH72385.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score =  174 bits (423), Expect = 3e-43
 Identities = 87/119 (73%), Positives = 96/119 (80%)
 Frame = +1

Query: 160 QTYHREVREGGPGNG*RILQICLGIGQTKG*AERGITIDIALWKFETSKYYVTIIDAPGH 339
           + + +E  E G G+     +    + + K   ERGITIDI+LWKFETSKYYVTIIDAPGH
Sbjct: 40  EKFEKEAAEMGKGS----FKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGH 95

Query: 340 RDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGETK 516
           RDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQTREHALLA+TLGVKQLIVG  K
Sbjct: 96  RDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNK 154



 Score =  141 bits (342), Expect = 2e-33
 Identities = 65/66 (98%), Positives = 65/66 (98%)
 Frame = +2

Query: 56  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 235
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 236 DKLKAE 253
           DKLKAE
Sbjct: 61  DKLKAE 66



 Score = 78.6 bits (185), Expect = 2e-14
 Identities = 34/42 (80%), Positives = 38/42 (90%)
 Frame = +2

Query: 521 STEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           STEPPYS+ R+EEI KEVS+YIKKIGYNP  VAFVPISGW+G
Sbjct: 157 STEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNG 198


>BC071841-1|AAH71841.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score =  174 bits (423), Expect = 3e-43
 Identities = 87/119 (73%), Positives = 96/119 (80%)
 Frame = +1

Query: 160 QTYHREVREGGPGNG*RILQICLGIGQTKG*AERGITIDIALWKFETSKYYVTIIDAPGH 339
           + + +E  E G G+     +    + + K   ERGITIDI+LWKFETSKYYVTIIDAPGH
Sbjct: 40  EKFEKEAAEMGKGS----FKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGH 95

Query: 340 RDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGETK 516
           RDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQTREHALLA+TLGVKQLIVG  K
Sbjct: 96  RDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNK 154



 Score =  141 bits (342), Expect = 2e-33
 Identities = 65/66 (98%), Positives = 65/66 (98%)
 Frame = +2

Query: 56  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 235
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 236 DKLKAE 253
           DKLKAE
Sbjct: 61  DKLKAE 66



 Score = 78.6 bits (185), Expect = 2e-14
 Identities = 34/42 (80%), Positives = 38/42 (90%)
 Frame = +2

Query: 521 STEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           STEPPYS+ R+EEI KEVS+YIKKIGYNP  VAFVPISGW+G
Sbjct: 157 STEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNG 198


>BC071741-1|AAH71741.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score =  174 bits (423), Expect = 3e-43
 Identities = 87/119 (73%), Positives = 96/119 (80%)
 Frame = +1

Query: 160 QTYHREVREGGPGNG*RILQICLGIGQTKG*AERGITIDIALWKFETSKYYVTIIDAPGH 339
           + + +E  E G G+     +    + + K   ERGITIDI+LWKFETSKYYVTIIDAPGH
Sbjct: 40  EKFEKEAAEMGKGS----FKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGH 95

Query: 340 RDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGETK 516
           RDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQTREHALLA+TLGVKQLIVG  K
Sbjct: 96  RDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNK 154



 Score =  141 bits (342), Expect = 2e-33
 Identities = 65/66 (98%), Positives = 65/66 (98%)
 Frame = +2

Query: 56  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 235
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 236 DKLKAE 253
           DKLKAE
Sbjct: 61  DKLKAE 66



 Score = 78.6 bits (185), Expect = 2e-14
 Identities = 34/42 (80%), Positives = 38/42 (90%)
 Frame = +2

Query: 521 STEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           STEPPYS+ R+EEI KEVS+YIKKIGYNP  VAFVPISGW+G
Sbjct: 157 STEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNG 198


>BC071727-1|AAH71727.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score =  174 bits (423), Expect = 3e-43
 Identities = 87/119 (73%), Positives = 96/119 (80%)
 Frame = +1

Query: 160 QTYHREVREGGPGNG*RILQICLGIGQTKG*AERGITIDIALWKFETSKYYVTIIDAPGH 339
           + + +E  E G G+     +    + + K   ERGITIDI+LWKFETSKYYVTIIDAPGH
Sbjct: 40  EKFEKEAAEMGKGS----FKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGH 95

Query: 340 RDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGETK 516
           RDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQTREHALLA+TLGVKQLIVG  K
Sbjct: 96  RDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNK 154



 Score =  137 bits (331), Expect = 4e-32
 Identities = 64/66 (96%), Positives = 64/66 (96%)
 Frame = +2

Query: 56  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 235
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYK GGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKFGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 236 DKLKAE 253
           DKLKAE
Sbjct: 61  DKLKAE 66



 Score = 78.6 bits (185), Expect = 2e-14
 Identities = 34/42 (80%), Positives = 38/42 (90%)
 Frame = +2

Query: 521 STEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           STEPPYS+ R+EEI KEVS+YIKKIGYNP  VAFVPISGW+G
Sbjct: 157 STEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNG 198


>BC066893-1|AAH66893.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score =  174 bits (423), Expect = 3e-43
 Identities = 87/119 (73%), Positives = 96/119 (80%)
 Frame = +1

Query: 160 QTYHREVREGGPGNG*RILQICLGIGQTKG*AERGITIDIALWKFETSKYYVTIIDAPGH 339
           + + +E  E G G+     +    + + K   ERGITIDI+LWKFETSKYYVTIIDAPGH
Sbjct: 40  EKFEKEAAEMGKGS----FKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGH 95

Query: 340 RDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGETK 516
           RDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQTREHALLA+TLGVKQLIVG  K
Sbjct: 96  RDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNK 154



 Score =  141 bits (342), Expect = 2e-33
 Identities = 65/66 (98%), Positives = 65/66 (98%)
 Frame = +2

Query: 56  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 235
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 236 DKLKAE 253
           DKLKAE
Sbjct: 61  DKLKAE 66



 Score = 78.6 bits (185), Expect = 2e-14
 Identities = 34/42 (80%), Positives = 38/42 (90%)
 Frame = +2

Query: 521 STEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           STEPPYS+ R+EEI KEVS+YIKKIGYNP  VAFVPISGW+G
Sbjct: 157 STEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNG 198


>BC057391-1|AAH57391.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score =  174 bits (423), Expect = 3e-43
 Identities = 87/119 (73%), Positives = 96/119 (80%)
 Frame = +1

Query: 160 QTYHREVREGGPGNG*RILQICLGIGQTKG*AERGITIDIALWKFETSKYYVTIIDAPGH 339
           + + +E  E G G+     +    + + K   ERGITIDI+LWKFETSKYYVTIIDAPGH
Sbjct: 40  EKFEKEAAEMGKGS----FKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGH 95

Query: 340 RDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGETK 516
           RDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQTREHALLA+TLGVKQLIVG  K
Sbjct: 96  RDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNK 154



 Score =  141 bits (342), Expect = 2e-33
 Identities = 65/66 (98%), Positives = 65/66 (98%)
 Frame = +2

Query: 56  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 235
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 236 DKLKAE 253
           DKLKAE
Sbjct: 61  DKLKAE 66



 Score = 78.6 bits (185), Expect = 2e-14
 Identities = 34/42 (80%), Positives = 38/42 (90%)
 Frame = +2

Query: 521 STEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           STEPPYS+ R+EEI KEVS+YIKKIGYNP  VAFVPISGW+G
Sbjct: 157 STEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNG 198


>BC038339-1|AAH38339.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score =  174 bits (423), Expect = 3e-43
 Identities = 87/119 (73%), Positives = 96/119 (80%)
 Frame = +1

Query: 160 QTYHREVREGGPGNG*RILQICLGIGQTKG*AERGITIDIALWKFETSKYYVTIIDAPGH 339
           + + +E  E G G+     +    + + K   ERGITIDI+LWKFETSKYYVTIIDAPGH
Sbjct: 40  EKFEKEAAEMGKGS----FKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGH 95

Query: 340 RDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGETK 516
           RDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQTREHALLA+TLGVKQLIVG  K
Sbjct: 96  RDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNK 154



 Score =  141 bits (342), Expect = 2e-33
 Identities = 65/66 (98%), Positives = 65/66 (98%)
 Frame = +2

Query: 56  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 235
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 236 DKLKAE 253
           DKLKAE
Sbjct: 61  DKLKAE 66



 Score = 78.6 bits (185), Expect = 2e-14
 Identities = 34/42 (80%), Positives = 38/42 (90%)
 Frame = +2

Query: 521 STEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           STEPPYS+ R+EEI KEVS+YIKKIGYNP  VAFVPISGW+G
Sbjct: 157 STEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNG 198


>BC028674-1|AAH28674.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score =  174 bits (423), Expect = 3e-43
 Identities = 87/119 (73%), Positives = 96/119 (80%)
 Frame = +1

Query: 160 QTYHREVREGGPGNG*RILQICLGIGQTKG*AERGITIDIALWKFETSKYYVTIIDAPGH 339
           + + +E  E G G+     +    + + K   ERGITIDI+LWKFETSKYYVTIIDAPGH
Sbjct: 40  EKFEKEAAEMGKGS----FKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGH 95

Query: 340 RDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGETK 516
           RDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQTREHALLA+TLGVKQLIVG  K
Sbjct: 96  RDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNK 154



 Score =  141 bits (342), Expect = 2e-33
 Identities = 65/66 (98%), Positives = 65/66 (98%)
 Frame = +2

Query: 56  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 235
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 236 DKLKAE 253
           DKLKAE
Sbjct: 61  DKLKAE 66



 Score = 78.6 bits (185), Expect = 2e-14
 Identities = 34/42 (80%), Positives = 38/42 (90%)
 Frame = +2

Query: 521 STEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           STEPPYS+ R+EEI KEVS+YIKKIGYNP  VAFVPISGW+G
Sbjct: 157 STEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNG 198


>BC021686-1|AAH21686.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score =  174 bits (423), Expect = 3e-43
 Identities = 87/119 (73%), Positives = 96/119 (80%)
 Frame = +1

Query: 160 QTYHREVREGGPGNG*RILQICLGIGQTKG*AERGITIDIALWKFETSKYYVTIIDAPGH 339
           + + +E  E G G+     +    + + K   ERGITIDI+LWKFETSKYYVTIIDAPGH
Sbjct: 40  EKFEKEAAEMGKGS----FKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGH 95

Query: 340 RDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGETK 516
           RDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQTREHALLA+TLGVKQLIVG  K
Sbjct: 96  RDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNK 154



 Score =  141 bits (342), Expect = 2e-33
 Identities = 65/66 (98%), Positives = 65/66 (98%)
 Frame = +2

Query: 56  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 235
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 236 DKLKAE 253
           DKLKAE
Sbjct: 61  DKLKAE 66



 Score = 78.6 bits (185), Expect = 2e-14
 Identities = 34/42 (80%), Positives = 38/42 (90%)
 Frame = +2

Query: 521 STEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           STEPPYS+ R+EEI KEVS+YIKKIGYNP  VAFVPISGW+G
Sbjct: 157 STEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNG 198


>BC019669-1|AAH19669.1|  462|Homo sapiens EEF1A1 protein protein.
          Length = 462

 Score =  174 bits (423), Expect = 3e-43
 Identities = 87/119 (73%), Positives = 96/119 (80%)
 Frame = +1

Query: 160 QTYHREVREGGPGNG*RILQICLGIGQTKG*AERGITIDIALWKFETSKYYVTIIDAPGH 339
           + + +E  E G G+     +    + + K   ERGITIDI+LWKFETSKYYVTIIDAPGH
Sbjct: 40  EKFEKEAAEMGKGS----FKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGH 95

Query: 340 RDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGETK 516
           RDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQTREHALLA+TLGVKQLIVG  K
Sbjct: 96  RDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNK 154



 Score =  141 bits (342), Expect = 2e-33
 Identities = 65/66 (98%), Positives = 65/66 (98%)
 Frame = +2

Query: 56  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 235
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 236 DKLKAE 253
           DKLKAE
Sbjct: 61  DKLKAE 66



 Score = 78.6 bits (185), Expect = 2e-14
 Identities = 34/42 (80%), Positives = 38/42 (90%)
 Frame = +2

Query: 521 STEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           STEPPYS+ R+EEI KEVS+YIKKIGYNP  VAFVPISGW+G
Sbjct: 157 STEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNG 198


>BC018641-1|AAH18641.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score =  174 bits (423), Expect = 3e-43
 Identities = 87/119 (73%), Positives = 96/119 (80%)
 Frame = +1

Query: 160 QTYHREVREGGPGNG*RILQICLGIGQTKG*AERGITIDIALWKFETSKYYVTIIDAPGH 339
           + + +E  E G G+     +    + + K   ERGITIDI+LWKFETSKYYVTIIDAPGH
Sbjct: 40  EKFEKEAAEMGKGS----FKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGH 95

Query: 340 RDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGETK 516
           RDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQTREHALLA+TLGVKQLIVG  K
Sbjct: 96  RDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNK 154



 Score =  141 bits (342), Expect = 2e-33
 Identities = 65/66 (98%), Positives = 65/66 (98%)
 Frame = +2

Query: 56  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 235
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 236 DKLKAE 253
           DKLKAE
Sbjct: 61  DKLKAE 66



 Score = 78.6 bits (185), Expect = 2e-14
 Identities = 34/42 (80%), Positives = 38/42 (90%)
 Frame = +2

Query: 521 STEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           STEPPYS+ R+EEI KEVS+YIKKIGYNP  VAFVPISGW+G
Sbjct: 157 STEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNG 198


>BC018150-1|AAH18150.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score =  174 bits (423), Expect = 3e-43
 Identities = 87/119 (73%), Positives = 96/119 (80%)
 Frame = +1

Query: 160 QTYHREVREGGPGNG*RILQICLGIGQTKG*AERGITIDIALWKFETSKYYVTIIDAPGH 339
           + + +E  E G G+     +    + + K   ERGITIDI+LWKFETSKYYVTIIDAPGH
Sbjct: 40  EKFEKEAAEMGKGS----FKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGH 95

Query: 340 RDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGETK 516
           RDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQTREHALLA+TLGVKQLIVG  K
Sbjct: 96  RDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNK 154



 Score =  141 bits (342), Expect = 2e-33
 Identities = 65/66 (98%), Positives = 65/66 (98%)
 Frame = +2

Query: 56  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 235
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 236 DKLKAE 253
           DKLKAE
Sbjct: 61  DKLKAE 66



 Score = 78.6 bits (185), Expect = 2e-14
 Identities = 34/42 (80%), Positives = 38/42 (90%)
 Frame = +2

Query: 521 STEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           STEPPYS+ R+EEI KEVS+YIKKIGYNP  VAFVPISGW+G
Sbjct: 157 STEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNG 198


>BC014224-1|AAH14224.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score =  174 bits (423), Expect = 3e-43
 Identities = 87/119 (73%), Positives = 96/119 (80%)
 Frame = +1

Query: 160 QTYHREVREGGPGNG*RILQICLGIGQTKG*AERGITIDIALWKFETSKYYVTIIDAPGH 339
           + + +E  E G G+     +    + + K   ERGITIDI+LWKFETSKYYVTIIDAPGH
Sbjct: 40  EKFEKEAAEMGKGS----FKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGH 95

Query: 340 RDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGETK 516
           RDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQTREHALLA+TLGVKQLIVG  K
Sbjct: 96  RDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNK 154



 Score =  141 bits (342), Expect = 2e-33
 Identities = 65/66 (98%), Positives = 65/66 (98%)
 Frame = +2

Query: 56  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 235
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 236 DKLKAE 253
           DKLKAE
Sbjct: 61  DKLKAE 66



 Score = 78.6 bits (185), Expect = 2e-14
 Identities = 34/42 (80%), Positives = 38/42 (90%)
 Frame = +2

Query: 521 STEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           STEPPYS+ R+EEI KEVS+YIKKIGYNP  VAFVPISGW+G
Sbjct: 157 STEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNG 198


>BC012891-1|AAH12891.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score =  174 bits (423), Expect = 3e-43
 Identities = 87/119 (73%), Positives = 96/119 (80%)
 Frame = +1

Query: 160 QTYHREVREGGPGNG*RILQICLGIGQTKG*AERGITIDIALWKFETSKYYVTIIDAPGH 339
           + + +E  E G G+     +    + + K   ERGITIDI+LWKFETSKYYVTIIDAPGH
Sbjct: 40  EKFEKEAAEMGKGS----FKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGH 95

Query: 340 RDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGETK 516
           RDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQTREHALLA+TLGVKQLIVG  K
Sbjct: 96  RDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNK 154



 Score =  141 bits (342), Expect = 2e-33
 Identities = 65/66 (98%), Positives = 65/66 (98%)
 Frame = +2

Query: 56  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 235
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 236 DKLKAE 253
           DKLKAE
Sbjct: 61  DKLKAE 66



 Score = 78.6 bits (185), Expect = 2e-14
 Identities = 34/42 (80%), Positives = 38/42 (90%)
 Frame = +2

Query: 521 STEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           STEPPYS+ R+EEI KEVS+YIKKIGYNP  VAFVPISGW+G
Sbjct: 157 STEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNG 198


>BC010735-1|AAH10735.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score =  174 bits (423), Expect = 3e-43
 Identities = 87/119 (73%), Positives = 96/119 (80%)
 Frame = +1

Query: 160 QTYHREVREGGPGNG*RILQICLGIGQTKG*AERGITIDIALWKFETSKYYVTIIDAPGH 339
           + + +E  E G G+     +    + + K   ERGITIDI+LWKFETSKYYVTIIDAPGH
Sbjct: 40  EKFEKEAAEMGKGS----FKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGH 95

Query: 340 RDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGETK 516
           RDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQTREHALLA+TLGVKQLIVG  K
Sbjct: 96  RDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNK 154



 Score =  141 bits (342), Expect = 2e-33
 Identities = 65/66 (98%), Positives = 65/66 (98%)
 Frame = +2

Query: 56  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 235
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 236 DKLKAE 253
           DKLKAE
Sbjct: 61  DKLKAE 66



 Score = 78.6 bits (185), Expect = 2e-14
 Identities = 34/42 (80%), Positives = 38/42 (90%)
 Frame = +2

Query: 521 STEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           STEPPYS+ R+EEI KEVS+YIKKIGYNP  VAFVPISGW+G
Sbjct: 157 STEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNG 198


>BC009875-1|AAH09875.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score =  174 bits (423), Expect = 3e-43
 Identities = 87/119 (73%), Positives = 96/119 (80%)
 Frame = +1

Query: 160 QTYHREVREGGPGNG*RILQICLGIGQTKG*AERGITIDIALWKFETSKYYVTIIDAPGH 339
           + + +E  E G G+     +    + + K   ERGITIDI+LWKFETSKYYVTIIDAPGH
Sbjct: 40  EKFEKEAAEMGKGS----FKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGH 95

Query: 340 RDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGETK 516
           RDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQTREHALLA+TLGVKQLIVG  K
Sbjct: 96  RDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNK 154



 Score =  141 bits (342), Expect = 2e-33
 Identities = 65/66 (98%), Positives = 65/66 (98%)
 Frame = +2

Query: 56  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 235
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 236 DKLKAE 253
           DKLKAE
Sbjct: 61  DKLKAE 66



 Score = 78.6 bits (185), Expect = 2e-14
 Identities = 34/42 (80%), Positives = 38/42 (90%)
 Frame = +2

Query: 521 STEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           STEPPYS+ R+EEI KEVS+YIKKIGYNP  VAFVPISGW+G
Sbjct: 157 STEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNG 198


>BC009733-1|AAH09733.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score =  174 bits (423), Expect = 3e-43
 Identities = 87/119 (73%), Positives = 96/119 (80%)
 Frame = +1

Query: 160 QTYHREVREGGPGNG*RILQICLGIGQTKG*AERGITIDIALWKFETSKYYVTIIDAPGH 339
           + + +E  E G G+     +    + + K   ERGITIDI+LWKFETSKYYVTIIDAPGH
Sbjct: 40  EKFEKEAAEMGKGS----FKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGH 95

Query: 340 RDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGETK 516
           RDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQTREHALLA+TLGVKQLIVG  K
Sbjct: 96  RDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNK 154



 Score =  141 bits (342), Expect = 2e-33
 Identities = 65/66 (98%), Positives = 65/66 (98%)
 Frame = +2

Query: 56  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 235
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 236 DKLKAE 253
           DKLKAE
Sbjct: 61  DKLKAE 66



 Score = 78.6 bits (185), Expect = 2e-14
 Identities = 34/42 (80%), Positives = 38/42 (90%)
 Frame = +2

Query: 521 STEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           STEPPYS+ R+EEI KEVS+YIKKIGYNP  VAFVPISGW+G
Sbjct: 157 STEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNG 198


>BC008587-1|AAH08587.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score =  174 bits (423), Expect = 3e-43
 Identities = 87/119 (73%), Positives = 96/119 (80%)
 Frame = +1

Query: 160 QTYHREVREGGPGNG*RILQICLGIGQTKG*AERGITIDIALWKFETSKYYVTIIDAPGH 339
           + + +E  E G G+     +    + + K   ERGITIDI+LWKFETSKYYVTIIDAPGH
Sbjct: 40  EKFEKEAAEMGKGS----FKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGH 95

Query: 340 RDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGETK 516
           RDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQTREHALLA+TLGVKQLIVG  K
Sbjct: 96  RDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNK 154



 Score =  141 bits (342), Expect = 2e-33
 Identities = 65/66 (98%), Positives = 65/66 (98%)
 Frame = +2

Query: 56  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 235
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 236 DKLKAE 253
           DKLKAE
Sbjct: 61  DKLKAE 66



 Score = 78.6 bits (185), Expect = 2e-14
 Identities = 34/42 (80%), Positives = 38/42 (90%)
 Frame = +2

Query: 521 STEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           STEPPYS+ R+EEI KEVS+YIKKIGYNP  VAFVPISGW+G
Sbjct: 157 STEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNG 198


>AY043301-1|AAK95378.1|  462|Homo sapiens elongation factor 1-alpha
           protein.
          Length = 462

 Score =  174 bits (423), Expect = 3e-43
 Identities = 87/119 (73%), Positives = 96/119 (80%)
 Frame = +1

Query: 160 QTYHREVREGGPGNG*RILQICLGIGQTKG*AERGITIDIALWKFETSKYYVTIIDAPGH 339
           + + +E  E G G+     +    + + K   ERGITIDI+LWKFETSKYYVTIIDAPGH
Sbjct: 40  EKFEKEAAEMGKGS----FKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGH 95

Query: 340 RDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGETK 516
           RDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQTREHALLA+TLGVKQLIVG  K
Sbjct: 96  RDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNK 154



 Score =  141 bits (342), Expect = 2e-33
 Identities = 65/66 (98%), Positives = 65/66 (98%)
 Frame = +2

Query: 56  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 235
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 236 DKLKAE 253
           DKLKAE
Sbjct: 61  DKLKAE 66



 Score = 78.6 bits (185), Expect = 2e-14
 Identities = 34/42 (80%), Positives = 38/42 (90%)
 Frame = +2

Query: 521 STEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           STEPPYS+ R+EEI KEVS+YIKKIGYNP  VAFVPISGW+G
Sbjct: 157 STEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNG 198


>AL603910-8|CAI14883.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score =  174 bits (423), Expect = 3e-43
 Identities = 87/119 (73%), Positives = 96/119 (80%)
 Frame = +1

Query: 160 QTYHREVREGGPGNG*RILQICLGIGQTKG*AERGITIDIALWKFETSKYYVTIIDAPGH 339
           + + +E  E G G+     +    + + K   ERGITIDI+LWKFETSKYYVTIIDAPGH
Sbjct: 40  EKFEKEAAEMGKGS----FKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGH 95

Query: 340 RDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGETK 516
           RDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQTREHALLA+TLGVKQLIVG  K
Sbjct: 96  RDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNK 154



 Score =  141 bits (342), Expect = 2e-33
 Identities = 65/66 (98%), Positives = 65/66 (98%)
 Frame = +2

Query: 56  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 235
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 236 DKLKAE 253
           DKLKAE
Sbjct: 61  DKLKAE 66



 Score = 78.6 bits (185), Expect = 2e-14
 Identities = 34/42 (80%), Positives = 38/42 (90%)
 Frame = +2

Query: 521 STEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           STEPPYS+ R+EEI KEVS+YIKKIGYNP  VAFVPISGW+G
Sbjct: 157 STEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNG 198


>AL593851-4|CAH73620.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha-like 3 protein.
          Length = 462

 Score =  174 bits (423), Expect = 3e-43
 Identities = 87/119 (73%), Positives = 96/119 (80%)
 Frame = +1

Query: 160 QTYHREVREGGPGNG*RILQICLGIGQTKG*AERGITIDIALWKFETSKYYVTIIDAPGH 339
           + + +E  E G G+     +    + + K   ERGITIDI+LWKFETSKYYVTIIDAPGH
Sbjct: 40  EKFEKEAAEMGKGS----FKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGH 95

Query: 340 RDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGETK 516
           RDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQTREHALLA+TLGVKQLIVG  K
Sbjct: 96  RDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNK 154



 Score =  141 bits (342), Expect = 2e-33
 Identities = 65/66 (98%), Positives = 65/66 (98%)
 Frame = +2

Query: 56  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 235
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 236 DKLKAE 253
           DKLKAE
Sbjct: 61  DKLKAE 66



 Score = 78.6 bits (185), Expect = 2e-14
 Identities = 34/42 (80%), Positives = 38/42 (90%)
 Frame = +2

Query: 521 STEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           STEPPYS+ R+EEI KEVS+YIKKIGYNP  VAFVPISGW+G
Sbjct: 157 STEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNG 198


>AK223046-1|BAD96766.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 variant protein.
          Length = 462

 Score =  174 bits (423), Expect = 3e-43
 Identities = 87/119 (73%), Positives = 96/119 (80%)
 Frame = +1

Query: 160 QTYHREVREGGPGNG*RILQICLGIGQTKG*AERGITIDIALWKFETSKYYVTIIDAPGH 339
           + + +E  E G G+     +    + + K   ERGITIDI+LWKFETSKYYVTIIDAPGH
Sbjct: 40  EKFEKEAAEMGKGS----FKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGH 95

Query: 340 RDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGETK 516
           RDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQTREHALLA+TLGVKQLIVG  K
Sbjct: 96  RDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNK 154



 Score =  141 bits (342), Expect = 2e-33
 Identities = 65/66 (98%), Positives = 65/66 (98%)
 Frame = +2

Query: 56  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 235
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 236 DKLKAE 253
           DKLKAE
Sbjct: 61  DKLKAE 66



 Score = 79.0 bits (186), Expect = 1e-14
 Identities = 34/42 (80%), Positives = 38/42 (90%)
 Frame = +2

Query: 521 STEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           STEPPYS+ R+EEI KEVS+YIKKIGYNP  VAFVPISGW+G
Sbjct: 157 STEPPYSQKRYEEIAKEVSTYIKKIGYNPDTVAFVPISGWNG 198


>AK223030-1|BAD96750.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 variant protein.
          Length = 462

 Score =  174 bits (423), Expect = 3e-43
 Identities = 87/119 (73%), Positives = 96/119 (80%)
 Frame = +1

Query: 160 QTYHREVREGGPGNG*RILQICLGIGQTKG*AERGITIDIALWKFETSKYYVTIIDAPGH 339
           + + +E  E G G+     +    + + K   ERGITIDI+LWKFETSKYYVTIIDAPGH
Sbjct: 40  EKFEKEAAEMGKGS----FKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGH 95

Query: 340 RDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGETK 516
           RDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQTREHALLA+TLGVKQLIVG  K
Sbjct: 96  RDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNK 154



 Score =  141 bits (342), Expect = 2e-33
 Identities = 65/66 (98%), Positives = 65/66 (98%)
 Frame = +2

Query: 56  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 235
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 236 DKLKAE 253
           DKLKAE
Sbjct: 61  DKLKAE 66



 Score = 78.6 bits (185), Expect = 2e-14
 Identities = 34/42 (80%), Positives = 38/42 (90%)
 Frame = +2

Query: 521 STEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           STEPPYS+ R+EEI KEVS+YIKKIGYNP  VAFVPISGW+G
Sbjct: 157 STEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNG 198


>AK222982-1|BAD96702.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 variant protein.
          Length = 462

 Score =  174 bits (423), Expect = 3e-43
 Identities = 87/119 (73%), Positives = 96/119 (80%)
 Frame = +1

Query: 160 QTYHREVREGGPGNG*RILQICLGIGQTKG*AERGITIDIALWKFETSKYYVTIIDAPGH 339
           + + +E  E G G+     +    + + K   ERGITIDI+LWKFETSKYYVTIIDAPGH
Sbjct: 40  EKFEKEAAEMGKGS----FKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGH 95

Query: 340 RDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGETK 516
           RDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQTREHALLA+TLGVKQLIVG  K
Sbjct: 96  RDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNK 154



 Score =  141 bits (342), Expect = 2e-33
 Identities = 65/66 (98%), Positives = 65/66 (98%)
 Frame = +2

Query: 56  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 235
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 236 DKLKAE 253
           DKLKAE
Sbjct: 61  DKLKAE 66



 Score = 78.6 bits (185), Expect = 2e-14
 Identities = 34/42 (80%), Positives = 38/42 (90%)
 Frame = +2

Query: 521 STEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           STEPPYS+ R+EEI KEVS+YIKKIGYNP  VAFVPISGW+G
Sbjct: 157 STEPPYSQKRYEEIVKEVSAYIKKIGYNPDTVAFVPISGWNG 198


>AK222551-1|BAD96271.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 variant protein.
          Length = 462

 Score =  174 bits (423), Expect = 3e-43
 Identities = 87/119 (73%), Positives = 96/119 (80%)
 Frame = +1

Query: 160 QTYHREVREGGPGNG*RILQICLGIGQTKG*AERGITIDIALWKFETSKYYVTIIDAPGH 339
           + + +E  E G G+     +    + + K   ERGITIDI+LWKFETSKYYVTIIDAPGH
Sbjct: 40  EKFEKEAAEMGKGS----FKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGH 95

Query: 340 RDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGETK 516
           RDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQTREHALLA+TLGVKQLIVG  K
Sbjct: 96  RDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNK 154



 Score =  141 bits (342), Expect = 2e-33
 Identities = 65/66 (98%), Positives = 65/66 (98%)
 Frame = +2

Query: 56  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 235
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 236 DKLKAE 253
           DKLKAE
Sbjct: 61  DKLKAE 66



 Score = 78.6 bits (185), Expect = 2e-14
 Identities = 34/42 (80%), Positives = 38/42 (90%)
 Frame = +2

Query: 521 STEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           STEPPYS+ R+EEI KEVS+YIKKIGYNP  VAFVPISGW+G
Sbjct: 157 STEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNG 198


>AK222523-1|BAD96243.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 variant protein.
          Length = 462

 Score =  174 bits (423), Expect = 3e-43
 Identities = 87/119 (73%), Positives = 96/119 (80%)
 Frame = +1

Query: 160 QTYHREVREGGPGNG*RILQICLGIGQTKG*AERGITIDIALWKFETSKYYVTIIDAPGH 339
           + + +E  E G G+     +    + + K   ERGITIDI+LWKFETSKYYVTIIDAPGH
Sbjct: 40  EKFEKEAAEMGKGS----FKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGH 95

Query: 340 RDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGETK 516
           RDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQTREHALLA+TLGVKQLIVG  K
Sbjct: 96  RDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNK 154



 Score =  141 bits (342), Expect = 2e-33
 Identities = 65/66 (98%), Positives = 65/66 (98%)
 Frame = +2

Query: 56  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 235
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 236 DKLKAE 253
           DKLKAE
Sbjct: 61  DKLKAE 66



 Score = 78.6 bits (185), Expect = 2e-14
 Identities = 34/42 (80%), Positives = 38/42 (90%)
 Frame = +2

Query: 521 STEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           STEPPYS+ R+EEI KEVS+YIKKIGYNP  VAFVPISGW+G
Sbjct: 157 STEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNG 198


>AK222515-1|BAD96235.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 variant protein.
          Length = 462

 Score =  174 bits (423), Expect = 3e-43
 Identities = 87/119 (73%), Positives = 96/119 (80%)
 Frame = +1

Query: 160 QTYHREVREGGPGNG*RILQICLGIGQTKG*AERGITIDIALWKFETSKYYVTIIDAPGH 339
           + + +E  E G G+     +    + + K   ERGITIDI+LWKFETSKYYVTIIDAPGH
Sbjct: 40  EKFEKEAAEMGKGS----FKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGH 95

Query: 340 RDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGETK 516
           RDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQTREHALLA+TLGVKQLIVG  K
Sbjct: 96  RDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNK 154



 Score =  141 bits (342), Expect = 2e-33
 Identities = 65/66 (98%), Positives = 65/66 (98%)
 Frame = +2

Query: 56  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 235
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 236 DKLKAE 253
           DKLKAE
Sbjct: 61  DKLKAE 66



 Score = 78.6 bits (185), Expect = 2e-14
 Identities = 34/42 (80%), Positives = 38/42 (90%)
 Frame = +2

Query: 521 STEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           STEPPYS+ R+EEI KEVS+YIKKIGYNP  VAFVPISGW+G
Sbjct: 157 STEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNG 198


>AF267861-1|AAG44730.1|  427|Homo sapiens EF1a-like protein protein.
          Length = 427

 Score =  174 bits (423), Expect = 3e-43
 Identities = 87/119 (73%), Positives = 96/119 (80%)
 Frame = +1

Query: 160 QTYHREVREGGPGNG*RILQICLGIGQTKG*AERGITIDIALWKFETSKYYVTIIDAPGH 339
           + + +E  E G G+     +    + + K   ERGITIDI+LWKFETSKYYVTIIDAPGH
Sbjct: 40  EKFEKEAAEMGKGS----FKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGH 95

Query: 340 RDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGETK 516
           RDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQTREHALLA+TLGVKQLIVG  K
Sbjct: 96  RDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNK 154



 Score =  141 bits (342), Expect = 2e-33
 Identities = 65/66 (98%), Positives = 65/66 (98%)
 Frame = +2

Query: 56  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 235
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 236 DKLKAE 253
           DKLKAE
Sbjct: 61  DKLKAE 66



 Score = 78.6 bits (185), Expect = 2e-14
 Identities = 34/42 (80%), Positives = 38/42 (90%)
 Frame = +2

Query: 521 STEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           STEPPYS+ R+EEI KEVS+YIKKIGYNP  VAFVPISGW+G
Sbjct: 157 STEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNG 198


>AF397403-1|AAK93966.1|  398|Homo sapiens translation elongation
           factor 1 alpha 1-like 14 protein.
          Length = 398

 Score =  173 bits (421), Expect = 5e-43
 Identities = 82/88 (93%), Positives = 85/88 (96%)
 Frame = +1

Query: 253 AERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAG 432
           +ERGITIDI+LWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAG
Sbjct: 3   SERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAG 62

Query: 433 ISKNGQTREHALLAFTLGVKQLIVGETK 516
           ISKNGQTREHALLA+TLGVKQLIVG  K
Sbjct: 63  ISKNGQTREHALLAYTLGVKQLIVGVNK 90



 Score = 78.6 bits (185), Expect = 2e-14
 Identities = 34/42 (80%), Positives = 38/42 (90%)
 Frame = +2

Query: 521 STEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           STEPPYS+ R+EEI KEVS+YIKKIGYNP  VAFVPISGW+G
Sbjct: 93  STEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNG 134


>AF174496-1|AAF36537.1|  426|Homo sapiens glucocorticoid receptor
           AF-1 specific elongation factor protein.
          Length = 426

 Score =  173 bits (420), Expect = 6e-43
 Identities = 82/87 (94%), Positives = 84/87 (96%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 435
           ERGITIDI+LWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGI
Sbjct: 32  ERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGI 91

Query: 436 SKNGQTREHALLAFTLGVKQLIVGETK 516
           SKNGQTREHALLA+TLGVKQLIVG  K
Sbjct: 92  SKNGQTREHALLAYTLGVKQLIVGVNK 118



 Score = 92.3 bits (219), Expect = 1e-18
 Identities = 62/160 (38%), Positives = 84/160 (52%), Gaps = 3/160 (1%)
 Frame = +2

Query: 176 KFEKEAQEMGKGSFKYAWVLD--KLKAELSV-VSQSILLSGSSKLASTMLPSLMLLDTEI 346
           KFEKEA EMGKGSFKYAWV D  K + E  + +  S+    +SK   T++ +    D   
Sbjct: 5   KFEKEAAEMGKGSFKYAWVWDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIK 64

Query: 347 SSRT*SQEPLRLIALCSS*LPVPVNSKLVSLRTVKXXXXXXXXXXXXXXXXXXEKQNGST 526
           +  T + +    + + ++   V      +S                         ++ ST
Sbjct: 65  NMITGTSQADCAVLIVAA--GVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKSHST 122

Query: 527 EPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           EPPYS+ R+EEI KEV +YIKKIGYNP  VAFVPISGW+G
Sbjct: 123 EPPYSQKRYEEIVKEVRTYIKKIGYNPDTVAFVPISGWNG 162


>X70940-1|CAA50280.1|  463|Homo sapiens elongation factor 1 alpha-2
           protein.
          Length = 463

 Score =  172 bits (419), Expect = 8e-43
 Identities = 85/119 (71%), Positives = 96/119 (80%)
 Frame = +1

Query: 160 QTYHREVREGGPGNG*RILQICLGIGQTKG*AERGITIDIALWKFETSKYYVTIIDAPGH 339
           + + +E  E G G+     +    + + K   ERGITIDI+LWKFET+KYY+TIIDAPGH
Sbjct: 40  EKFEKEAAEMGKGS----FKYAWVLDKLKAERERGITIDISLWKFETTKYYITIIDAPGH 95

Query: 340 RDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGETK 516
           RDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQTREHALLA+TLGVKQLIVG  K
Sbjct: 96  RDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNK 154



 Score =  141 bits (342), Expect = 2e-33
 Identities = 65/66 (98%), Positives = 65/66 (98%)
 Frame = +2

Query: 56  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 235
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 236 DKLKAE 253
           DKLKAE
Sbjct: 61  DKLKAE 66



 Score = 78.6 bits (185), Expect = 2e-14
 Identities = 34/42 (80%), Positives = 37/42 (88%)
 Frame = +2

Query: 521 STEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           STEP YSE R++EI KEVS+YIKKIGYNPA V FVPISGWHG
Sbjct: 157 STEPAYSEKRYDEIVKEVSAYIKKIGYNPATVPFVPISGWHG 198


>L10340-1|AAA91835.1|  435|Homo sapiens elongation factor-1 alpha
           protein.
          Length = 435

 Score =  172 bits (419), Expect = 8e-43
 Identities = 85/119 (71%), Positives = 96/119 (80%)
 Frame = +1

Query: 160 QTYHREVREGGPGNG*RILQICLGIGQTKG*AERGITIDIALWKFETSKYYVTIIDAPGH 339
           + + +E  E G G+     +    + + K   ERGITIDI+LWKFET+KYY+TIIDAPGH
Sbjct: 12  EKFEKEAAEMGKGS----FKYAWVLDKLKAERERGITIDISLWKFETTKYYITIIDAPGH 67

Query: 340 RDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGETK 516
           RDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQTREHALLA+TLGVKQLIVG  K
Sbjct: 68  RDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNK 126



 Score = 83.4 bits (197), Expect = 6e-16
 Identities = 37/38 (97%), Positives = 37/38 (97%)
 Frame = +2

Query: 140 YKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAE 253
           YKCGGIDKRTIEKFEKEA EMGKGSFKYAWVLDKLKAE
Sbjct: 1   YKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAE 38



 Score = 78.6 bits (185), Expect = 2e-14
 Identities = 34/42 (80%), Positives = 37/42 (88%)
 Frame = +2

Query: 521 STEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           STEP YSE R++EI KEVS+YIKKIGYNPA V FVPISGWHG
Sbjct: 129 STEPAYSEKRYDEIVKEVSAYIKKIGYNPATVPFVPISGWHG 170


>BC110409-1|AAI10410.1|  463|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 2 protein.
          Length = 463

 Score =  172 bits (419), Expect = 8e-43
 Identities = 85/119 (71%), Positives = 96/119 (80%)
 Frame = +1

Query: 160 QTYHREVREGGPGNG*RILQICLGIGQTKG*AERGITIDIALWKFETSKYYVTIIDAPGH 339
           + + +E  E G G+     +    + + K   ERGITIDI+LWKFET+KYY+TIIDAPGH
Sbjct: 40  EKFEKEAAEMGKGS----FKYAWVLDKLKAERERGITIDISLWKFETTKYYITIIDAPGH 95

Query: 340 RDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGETK 516
           RDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQTREHALLA+TLGVKQLIVG  K
Sbjct: 96  RDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNK 154



 Score =  141 bits (342), Expect = 2e-33
 Identities = 65/66 (98%), Positives = 65/66 (98%)
 Frame = +2

Query: 56  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 235
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 236 DKLKAE 253
           DKLKAE
Sbjct: 61  DKLKAE 66



 Score = 78.6 bits (185), Expect = 2e-14
 Identities = 34/42 (80%), Positives = 37/42 (88%)
 Frame = +2

Query: 521 STEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           STEP YSE R++EI KEVS+YIKKIGYNPA V FVPISGWHG
Sbjct: 157 STEPAYSEKRYDEIVKEVSAYIKKIGYNPATVPFVPISGWHG 198


>BC000432-1|AAH00432.1|  463|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 2 protein.
          Length = 463

 Score =  172 bits (419), Expect = 8e-43
 Identities = 85/119 (71%), Positives = 96/119 (80%)
 Frame = +1

Query: 160 QTYHREVREGGPGNG*RILQICLGIGQTKG*AERGITIDIALWKFETSKYYVTIIDAPGH 339
           + + +E  E G G+     +    + + K   ERGITIDI+LWKFET+KYY+TIIDAPGH
Sbjct: 40  EKFEKEAAEMGKGS----FKYAWVLDKLKAERERGITIDISLWKFETTKYYITIIDAPGH 95

Query: 340 RDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGETK 516
           RDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQTREHALLA+TLGVKQLIVG  K
Sbjct: 96  RDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNK 154



 Score =  141 bits (342), Expect = 2e-33
 Identities = 65/66 (98%), Positives = 65/66 (98%)
 Frame = +2

Query: 56  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 235
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 236 DKLKAE 253
           DKLKAE
Sbjct: 61  DKLKAE 66



 Score = 78.6 bits (185), Expect = 2e-14
 Identities = 34/42 (80%), Positives = 37/42 (88%)
 Frame = +2

Query: 521 STEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           STEP YSE R++EI KEVS+YIKKIGYNPA V FVPISGWHG
Sbjct: 157 STEPAYSEKRYDEIVKEVSAYIKKIGYNPATVPFVPISGWHG 198


>AL121829-9|CAC15522.1|  463|Homo sapiens EEF1A2 protein.
          Length = 463

 Score =  172 bits (419), Expect = 8e-43
 Identities = 85/119 (71%), Positives = 96/119 (80%)
 Frame = +1

Query: 160 QTYHREVREGGPGNG*RILQICLGIGQTKG*AERGITIDIALWKFETSKYYVTIIDAPGH 339
           + + +E  E G G+     +    + + K   ERGITIDI+LWKFET+KYY+TIIDAPGH
Sbjct: 40  EKFEKEAAEMGKGS----FKYAWVLDKLKAERERGITIDISLWKFETTKYYITIIDAPGH 95

Query: 340 RDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGETK 516
           RDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQTREHALLA+TLGVKQLIVG  K
Sbjct: 96  RDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNK 154



 Score =  141 bits (342), Expect = 2e-33
 Identities = 65/66 (98%), Positives = 65/66 (98%)
 Frame = +2

Query: 56  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 235
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 236 DKLKAE 253
           DKLKAE
Sbjct: 61  DKLKAE 66



 Score = 78.6 bits (185), Expect = 2e-14
 Identities = 34/42 (80%), Positives = 37/42 (88%)
 Frame = +2

Query: 521 STEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           STEP YSE R++EI KEVS+YIKKIGYNPA V FVPISGWHG
Sbjct: 157 STEPAYSEKRYDEIVKEVSAYIKKIGYNPATVPFVPISGWHG 198


>AF163763-1|AAF80488.1|  463|Homo sapiens elongation factor 1 A-2
           protein.
          Length = 463

 Score =  172 bits (419), Expect = 8e-43
 Identities = 85/119 (71%), Positives = 96/119 (80%)
 Frame = +1

Query: 160 QTYHREVREGGPGNG*RILQICLGIGQTKG*AERGITIDIALWKFETSKYYVTIIDAPGH 339
           + + +E  E G G+     +    + + K   ERGITIDI+LWKFET+KYY+TIIDAPGH
Sbjct: 40  EKFEKEAAEMGKGS----FKYAWVLDKLKAERERGITIDISLWKFETTKYYITIIDAPGH 95

Query: 340 RDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGETK 516
           RDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQTREHALLA+TLGVKQLIVG  K
Sbjct: 96  RDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNK 154



 Score =  141 bits (342), Expect = 2e-33
 Identities = 65/66 (98%), Positives = 65/66 (98%)
 Frame = +2

Query: 56  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 235
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 236 DKLKAE 253
           DKLKAE
Sbjct: 61  DKLKAE 66



 Score = 78.6 bits (185), Expect = 2e-14
 Identities = 34/42 (80%), Positives = 37/42 (88%)
 Frame = +2

Query: 521 STEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           STEP YSE R++EI KEVS+YIKKIGYNPA V FVPISGWHG
Sbjct: 157 STEPAYSEKRYDEIVKEVSAYIKKIGYNPATVPFVPISGWHG 198


>AK223042-1|BAD96762.1|  433|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 variant protein.
          Length = 433

 Score =  172 bits (418), Expect = 1e-42
 Identities = 86/119 (72%), Positives = 95/119 (79%)
 Frame = +1

Query: 160 QTYHREVREGGPGNG*RILQICLGIGQTKG*AERGITIDIALWKFETSKYYVTIIDAPGH 339
           + + +E  E G G+     +    + + K   ERGITIDI+LWKFETSKYYVT IDAPGH
Sbjct: 11  EKFEKEAAEMGKGS----FKYAWVLDKLKAERERGITIDISLWKFETSKYYVTTIDAPGH 66

Query: 340 RDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGETK 516
           RDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQTREHALLA+TLGVKQLIVG  K
Sbjct: 67  RDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNK 125



 Score = 80.6 bits (190), Expect = 4e-15
 Identities = 36/37 (97%), Positives = 36/37 (97%)
 Frame = +2

Query: 143 KCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAE 253
           KCGGIDKRTIEKFEKEA EMGKGSFKYAWVLDKLKAE
Sbjct: 1   KCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAE 37



 Score = 78.6 bits (185), Expect = 2e-14
 Identities = 34/42 (80%), Positives = 38/42 (90%)
 Frame = +2

Query: 521 STEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           STEPPYS+ R+EEI KEVS+YIKKIGYNP  VAFVPISGW+G
Sbjct: 128 STEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNG 169


>L41498-1|AAC09386.1|  398|Homo sapiens longation factor 1-alpha 1
           protein.
          Length = 398

 Score =  171 bits (417), Expect = 1e-42
 Identities = 81/88 (92%), Positives = 85/88 (96%)
 Frame = +1

Query: 253 AERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAG 432
           +ERGITIDI+LWKFETSKYYVTIIDAPGHRDFI+NMITGTSQADCAVLIVAAG GEFEAG
Sbjct: 3   SERGITIDISLWKFETSKYYVTIIDAPGHRDFIQNMITGTSQADCAVLIVAAGVGEFEAG 62

Query: 433 ISKNGQTREHALLAFTLGVKQLIVGETK 516
           ISKNGQTREHALLA+TLGVKQLIVG  K
Sbjct: 63  ISKNGQTREHALLAYTLGVKQLIVGVNK 90



 Score = 78.6 bits (185), Expect = 2e-14
 Identities = 34/42 (80%), Positives = 38/42 (90%)
 Frame = +2

Query: 521 STEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           STEPPYS+ R+EEI KEVS+YIKKIGYNP  VAFVPISGW+G
Sbjct: 93  STEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNG 134


>L41490-1|AAC09385.1|  398|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1-like 14 protein.
          Length = 398

 Score =  171 bits (417), Expect = 1e-42
 Identities = 81/88 (92%), Positives = 85/88 (96%)
 Frame = +1

Query: 253 AERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAG 432
           +ERGITIDI+LWKFETSKYYVTIIDAPGHRDFI+NMITGTSQADCAVLIVAAG GEFEAG
Sbjct: 3   SERGITIDISLWKFETSKYYVTIIDAPGHRDFIQNMITGTSQADCAVLIVAAGVGEFEAG 62

Query: 433 ISKNGQTREHALLAFTLGVKQLIVGETK 516
           ISKNGQTREHALLA+TLGVKQLIVG  K
Sbjct: 63  ISKNGQTREHALLAYTLGVKQLIVGVNK 90



 Score = 78.6 bits (185), Expect = 2e-14
 Identities = 34/42 (80%), Positives = 38/42 (90%)
 Frame = +2

Query: 521 STEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           STEPPYS+ R+EEI KEVS+YIKKIGYNP  VAFVPISGW+G
Sbjct: 93  STEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNG 134


>AY062434-1|AAL38981.1|  398|Homo sapiens elongation factor 1-alpha
           1 protein.
          Length = 398

 Score =  171 bits (417), Expect = 1e-42
 Identities = 81/88 (92%), Positives = 85/88 (96%)
 Frame = +1

Query: 253 AERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAG 432
           +ERGITIDI+LWKFETSKYYVTIIDAPGHRDFI+NMITGTSQADCAVLIVAAG GEFEAG
Sbjct: 3   SERGITIDISLWKFETSKYYVTIIDAPGHRDFIQNMITGTSQADCAVLIVAAGVGEFEAG 62

Query: 433 ISKNGQTREHALLAFTLGVKQLIVGETK 516
           ISKNGQTREHALLA+TLGVKQLIVG  K
Sbjct: 63  ISKNGQTREHALLAYTLGVKQLIVGVNK 90



 Score = 78.6 bits (185), Expect = 2e-14
 Identities = 34/42 (80%), Positives = 38/42 (90%)
 Frame = +2

Query: 521 STEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           STEPPYS+ R+EEI KEVS+YIKKIGYNP  VAFVPISGW+G
Sbjct: 93  STEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNG 134


>AB209064-1|BAD92301.1|  340|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 2 variant protein.
          Length = 340

 Score =  171 bits (417), Expect = 1e-42
 Identities = 81/95 (85%), Positives = 87/95 (91%)
 Frame = +1

Query: 232 IGQTKG*AERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG 411
           + + K   ERGITIDI+LWKFET+KYY+TIIDAPGHRDFIKNMITGTSQADCAVLIVAAG
Sbjct: 36  LDKLKAERERGITIDISLWKFETTKYYITIIDAPGHRDFIKNMITGTSQADCAVLIVAAG 95

Query: 412 TGEFEAGISKNGQTREHALLAFTLGVKQLIVGETK 516
            GEFEAGISKNGQTREHALLA+TLGVKQLIVG  K
Sbjct: 96  VGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNK 130



 Score = 78.6 bits (185), Expect = 2e-14
 Identities = 34/42 (80%), Positives = 37/42 (88%)
 Frame = +2

Query: 521 STEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           STEP YSE R++EI KEVS+YIKKIGYNPA V FVPISGWHG
Sbjct: 133 STEPAYSEKRYDEIVKEVSAYIKKIGYNPATVPFVPISGWHG 174



 Score = 43.6 bits (98), Expect = 6e-04
 Identities = 18/19 (94%), Positives = 19/19 (100%)
 Frame = +2

Query: 197 EMGKGSFKYAWVLDKLKAE 253
           +MGKGSFKYAWVLDKLKAE
Sbjct: 24  QMGKGSFKYAWVLDKLKAE 42


>AL603910-9|CAI40951.1|  145|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 145

 Score =  161 bits (392), Expect = 1e-39
 Identities = 80/110 (72%), Positives = 89/110 (80%)
 Frame = +1

Query: 160 QTYHREVREGGPGNG*RILQICLGIGQTKG*AERGITIDIALWKFETSKYYVTIIDAPGH 339
           + + +E  E G G+     +    + + K   ERGITIDI+LWKFETSKYYVTIIDAPGH
Sbjct: 40  EKFEKEAAEMGKGS----FKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGH 95

Query: 340 RDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGV 489
           RDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQTREHALLA+TLGV
Sbjct: 96  RDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGV 145



 Score =  141 bits (342), Expect = 2e-33
 Identities = 65/66 (98%), Positives = 65/66 (98%)
 Frame = +2

Query: 56  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 235
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 236 DKLKAE 253
           DKLKAE
Sbjct: 61  DKLKAE 66


>BC071619-1|AAH71619.1|  441|Homo sapiens EEF1A1 protein protein.
          Length = 441

 Score =  155 bits (376), Expect = 1e-37
 Identities = 79/121 (65%), Positives = 91/121 (75%)
 Frame = +1

Query: 160 QTYHREVREGGPGNG*RILQICLGIGQTKG*AERGITIDIALWKFETSKYYVTIIDAPGH 339
           + + +E  E G G+     +    + + K   ERGITIDI+LWKFETSKYYVTIIDAPGH
Sbjct: 40  EKFEKEAAEMGKGS----FKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGH 95

Query: 340 RDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGETKW 519
           RDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQTREHALLA++    + IV E   
Sbjct: 96  RDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYSQKRYEEIVKEVST 155

Query: 520 F 522
           +
Sbjct: 156 Y 156



 Score =  141 bits (342), Expect = 2e-33
 Identities = 65/66 (98%), Positives = 65/66 (98%)
 Frame = +2

Query: 56  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 235
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 236 DKLKAE 253
           DKLKAE
Sbjct: 61  DKLKAE 66



 Score = 67.3 bits (157), Expect = 4e-11
 Identities = 29/37 (78%), Positives = 33/37 (89%)
 Frame = +2

Query: 536 YSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           YS+ R+EEI KEVS+YIKKIGYNP  VAFVPISGW+G
Sbjct: 141 YSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNG 177


>X03689-1|CAA27325.1|   94|Homo sapiens protein ( Human mRNA
           fragment for elongation factor TU (N-terminus). ).
          Length = 94

 Score =  141 bits (342), Expect = 2e-33
 Identities = 65/66 (98%), Positives = 65/66 (98%)
 Frame = +2

Query: 56  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 235
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 236 DKLKAE 253
           DKLKAE
Sbjct: 61  DKLKAE 66



 Score = 60.1 bits (139), Expect = 7e-09
 Identities = 30/59 (50%), Positives = 39/59 (66%)
 Frame = +1

Query: 160 QTYHREVREGGPGNG*RILQICLGIGQTKG*AERGITIDIALWKFETSKYYVTIIDAPG 336
           + + +E  E G G+     +    + + K   ERGITIDI+LWKFET+KYYVTIIDAPG
Sbjct: 40  EKFEKEAAEMGKGS----FKYAWVLDKLKAERERGITIDISLWKFETAKYYVTIIDAPG 94


>BC070131-1|AAH70131.1|  111|Homo sapiens EEF1A1 protein protein.
          Length = 111

 Score =  141 bits (342), Expect = 2e-33
 Identities = 65/66 (98%), Positives = 65/66 (98%)
 Frame = +2

Query: 56  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 235
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 236 DKLKAE 253
           DKLKAE
Sbjct: 61  DKLKAE 66



 Score = 39.9 bits (89), Expect = 0.008
 Identities = 21/51 (41%), Positives = 30/51 (58%)
 Frame = +1

Query: 160 QTYHREVREGGPGNG*RILQICLGIGQTKG*AERGITIDIALWKFETSKYY 312
           + + +E  E G G+     +    + + K   ERGITIDI+LWKFETSK +
Sbjct: 40  EKFEKEAAEMGKGS----FKYAWVLDKLKAERERGITIDISLWKFETSKQW 86


>AL603910-10|CAO03613.1|  107|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 107

 Score =  141 bits (342), Expect = 2e-33
 Identities = 65/66 (98%), Positives = 65/66 (98%)
 Frame = +2

Query: 56  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 235
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 236 DKLKAE 253
           DKLKAE
Sbjct: 61  DKLKAE 66



 Score = 89.0 bits (211), Expect = 1e-17
 Identities = 44/72 (61%), Positives = 52/72 (72%)
 Frame = +1

Query: 160 QTYHREVREGGPGNG*RILQICLGIGQTKG*AERGITIDIALWKFETSKYYVTIIDAPGH 339
           + + +E  E G G+     +    + + K   ERGITIDI+LWKFETSKYYVTIIDAPGH
Sbjct: 40  EKFEKEAAEMGKGS----FKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGH 95

Query: 340 RDFIKNMITGTS 375
           RDFIKNMITGTS
Sbjct: 96  RDFIKNMITGTS 107


>U87791-1|AAD00645.1|  684|Homo sapiens eRFS protein.
          Length = 684

 Score =  113 bits (271), Expect = 7e-25
 Identities = 52/87 (59%), Positives = 64/87 (73%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 435
           ERG+T+D+ + KFET+   +T++DAPGH+DFI NMITG +QAD AVL+V A  GEFEAG 
Sbjct: 321 ERGVTMDVGMTKFETTTKVITLMDAPGHKDFIPNMITGAAQADVAVLVVDASRGEFEAGF 380

Query: 436 SKNGQTREHALLAFTLGVKQLIVGETK 516
              GQTREH LL  +LGV QL V   K
Sbjct: 381 ETGGQTREHGLLVRSLGVTQLAVAVNK 407



 Score = 82.2 bits (194), Expect = 1e-15
 Identities = 35/62 (56%), Positives = 48/62 (77%)
 Frame = +2

Query: 68  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 247
           K  +N+VVIGHVD+GKST  GH++Y  G I+KRT+ K+E+E+++ GK SF YAWVLD+  
Sbjct: 258 KQLLNLVVIGHVDAGKSTLMGHMLYLLGNINKRTMHKYEQESKKAGKASFAYAWVLDETG 317

Query: 248 AE 253
            E
Sbjct: 318 EE 319



 Score = 33.1 bits (72), Expect = 0.88
 Identities = 12/37 (32%), Positives = 23/37 (62%)
 Frame = +2

Query: 536 YSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           + + RF+EI  ++  ++K+ G+  + V F+P SG  G
Sbjct: 413 WQQERFQEITGKLGHFLKQAGFKESDVGFIPTSGLSG 449


>BC040849-1|AAH40849.1|  684|Homo sapiens HBS1-like (S. cerevisiae)
           protein.
          Length = 684

 Score =  113 bits (271), Expect = 7e-25
 Identities = 52/87 (59%), Positives = 64/87 (73%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 435
           ERG+T+D+ + KFET+   +T++DAPGH+DFI NMITG +QAD AVL+V A  GEFEAG 
Sbjct: 321 ERGVTMDVGMTKFETTTKVITLMDAPGHKDFIPNMITGAAQADVAVLVVDASRGEFEAGF 380

Query: 436 SKNGQTREHALLAFTLGVKQLIVGETK 516
              GQTREH LL  +LGV QL V   K
Sbjct: 381 ETGGQTREHGLLVRSLGVTQLAVAVNK 407



 Score = 82.2 bits (194), Expect = 1e-15
 Identities = 35/62 (56%), Positives = 48/62 (77%)
 Frame = +2

Query: 68  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 247
           K  +N+VVIGHVD+GKST  GH++Y  G I+KRT+ K+E+E+++ GK SF YAWVLD+  
Sbjct: 258 KQLLNLVVIGHVDAGKSTLMGHMLYLLGNINKRTMHKYEQESKKAGKASFAYAWVLDETG 317

Query: 248 AE 253
            E
Sbjct: 318 EE 319



 Score = 33.1 bits (72), Expect = 0.88
 Identities = 12/37 (32%), Positives = 23/37 (62%)
 Frame = +2

Query: 536 YSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           + + RF+EI  ++  ++K+ G+  + V F+P SG  G
Sbjct: 413 WQQERFQEITGKLGHFLKQAGFKESDVGFIPTSGLSG 449


>BC001465-1|AAH01465.1|  684|Homo sapiens HBS1-like (S. cerevisiae)
           protein.
          Length = 684

 Score =  113 bits (271), Expect = 7e-25
 Identities = 52/87 (59%), Positives = 64/87 (73%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 435
           ERG+T+D+ + KFET+   +T++DAPGH+DFI NMITG +QAD AVL+V A  GEFEAG 
Sbjct: 321 ERGVTMDVGMTKFETTTKVITLMDAPGHKDFIPNMITGAAQADVAVLVVDASRGEFEAGF 380

Query: 436 SKNGQTREHALLAFTLGVKQLIVGETK 516
              GQTREH LL  +LGV QL V   K
Sbjct: 381 ETGGQTREHGLLVRSLGVTQLAVAVNK 407



 Score = 82.2 bits (194), Expect = 1e-15
 Identities = 35/62 (56%), Positives = 48/62 (77%)
 Frame = +2

Query: 68  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 247
           K  +N+VVIGHVD+GKST  GH++Y  G I+KRT+ K+E+E+++ GK SF YAWVLD+  
Sbjct: 258 KQLLNLVVIGHVDAGKSTLMGHMLYLLGNINKRTMHKYEQESKKAGKASFAYAWVLDETG 317

Query: 248 AE 253
            E
Sbjct: 318 EE 319



 Score = 33.1 bits (72), Expect = 0.88
 Identities = 12/37 (32%), Positives = 23/37 (62%)
 Frame = +2

Query: 536 YSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           + + RF+EI  ++  ++K+ G+  + V F+P SG  G
Sbjct: 413 WQQERFQEITGKLGHFLKQAGFKESDVGFIPTSGLSG 449


>AL445190-5|CAI95161.1|  684|Homo sapiens HBS1-like (S. cerevisiae)
           protein.
          Length = 684

 Score =  113 bits (271), Expect = 7e-25
 Identities = 52/87 (59%), Positives = 64/87 (73%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 435
           ERG+T+D+ + KFET+   +T++DAPGH+DFI NMITG +QAD AVL+V A  GEFEAG 
Sbjct: 321 ERGVTMDVGMTKFETTTKVITLMDAPGHKDFIPNMITGAAQADVAVLVVDASRGEFEAGF 380

Query: 436 SKNGQTREHALLAFTLGVKQLIVGETK 516
              GQTREH LL  +LGV QL V   K
Sbjct: 381 ETGGQTREHGLLVRSLGVTQLAVAVNK 407



 Score = 82.2 bits (194), Expect = 1e-15
 Identities = 35/62 (56%), Positives = 48/62 (77%)
 Frame = +2

Query: 68  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 247
           K  +N+VVIGHVD+GKST  GH++Y  G I+KRT+ K+E+E+++ GK SF YAWVLD+  
Sbjct: 258 KQLLNLVVIGHVDAGKSTLMGHMLYLLGNINKRTMHKYEQESKKAGKASFAYAWVLDETG 317

Query: 248 AE 253
            E
Sbjct: 318 EE 319



 Score = 33.1 bits (72), Expect = 0.88
 Identities = 12/37 (32%), Positives = 23/37 (62%)
 Frame = +2

Query: 536 YSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           + + RF+EI  ++  ++K+ G+  + V F+P SG  G
Sbjct: 413 WQQERFQEITGKLGHFLKQAGFKESDVGFIPTSGLSG 449


>AL353596-2|CAI17912.1|  684|Homo sapiens HBS1-like (S. cerevisiae)
           protein.
          Length = 684

 Score =  113 bits (271), Expect = 7e-25
 Identities = 52/87 (59%), Positives = 64/87 (73%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 435
           ERG+T+D+ + KFET+   +T++DAPGH+DFI NMITG +QAD AVL+V A  GEFEAG 
Sbjct: 321 ERGVTMDVGMTKFETTTKVITLMDAPGHKDFIPNMITGAAQADVAVLVVDASRGEFEAGF 380

Query: 436 SKNGQTREHALLAFTLGVKQLIVGETK 516
              GQTREH LL  +LGV QL V   K
Sbjct: 381 ETGGQTREHGLLVRSLGVTQLAVAVNK 407



 Score = 82.2 bits (194), Expect = 1e-15
 Identities = 35/62 (56%), Positives = 48/62 (77%)
 Frame = +2

Query: 68  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 247
           K  +N+VVIGHVD+GKST  GH++Y  G I+KRT+ K+E+E+++ GK SF YAWVLD+  
Sbjct: 258 KQLLNLVVIGHVDAGKSTLMGHMLYLLGNINKRTMHKYEQESKKAGKASFAYAWVLDETG 317

Query: 248 AE 253
            E
Sbjct: 318 EE 319



 Score = 33.1 bits (72), Expect = 0.88
 Identities = 12/37 (32%), Positives = 23/37 (62%)
 Frame = +2

Query: 536 YSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           + + RF+EI  ++  ++K+ G+  + V F+P SG  G
Sbjct: 413 WQQERFQEITGKLGHFLKQAGFKESDVGFIPTSGLSG 449


>AJ459826-1|CAD30873.1|  684|Homo sapiens HBS1-like protein protein.
          Length = 684

 Score =  113 bits (271), Expect = 7e-25
 Identities = 52/87 (59%), Positives = 64/87 (73%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 435
           ERG+T+D+ + KFET+   +T++DAPGH+DFI NMITG +QAD AVL+V A  GEFEAG 
Sbjct: 321 ERGVTMDVGMTKFETTTKVITLMDAPGHKDFIPNMITGAAQADVAVLVVDASRGEFEAGF 380

Query: 436 SKNGQTREHALLAFTLGVKQLIVGETK 516
              GQTREH LL  +LGV QL V   K
Sbjct: 381 ETGGQTREHGLLVRSLGVTQLAVAVNK 407



 Score = 82.2 bits (194), Expect = 1e-15
 Identities = 35/62 (56%), Positives = 48/62 (77%)
 Frame = +2

Query: 68  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 247
           K  +N+VVIGHVD+GKST  GH++Y  G I+KRT+ K+E+E+++ GK SF YAWVLD+  
Sbjct: 258 KQLLNLVVIGHVDAGKSTLMGHMLYLLGNINKRTMHKYEQESKKAGKASFAYAWVLDETG 317

Query: 248 AE 253
            E
Sbjct: 318 EE 319



 Score = 33.1 bits (72), Expect = 0.88
 Identities = 12/37 (32%), Positives = 23/37 (62%)
 Frame = +2

Query: 536 YSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           + + RF+EI  ++  ++K+ G+  + V F+P SG  G
Sbjct: 413 WQQERFQEITGKLGHFLKQAGFKESDVGFIPTSGLSG 449


>AB028961-1|BAA82990.1|  496|Homo sapiens KIAA1038 protein protein.
          Length = 496

 Score =  113 bits (271), Expect = 7e-25
 Identities = 52/87 (59%), Positives = 64/87 (73%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 435
           ERG+T+D+ + KFET+   +T++DAPGH+DFI NMITG +QAD AVL+V A  GEFEAG 
Sbjct: 133 ERGVTMDVGMTKFETTTKVITLMDAPGHKDFIPNMITGAAQADVAVLVVDASRGEFEAGF 192

Query: 436 SKNGQTREHALLAFTLGVKQLIVGETK 516
              GQTREH LL  +LGV QL V   K
Sbjct: 193 ETGGQTREHGLLVRSLGVTQLAVAVNK 219



 Score = 82.2 bits (194), Expect = 1e-15
 Identities = 35/62 (56%), Positives = 48/62 (77%)
 Frame = +2

Query: 68  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 247
           K  +N+VVIGHVD+GKST  GH++Y  G I+KRT+ K+E+E+++ GK SF YAWVLD+  
Sbjct: 70  KQLLNLVVIGHVDAGKSTLMGHMLYLLGNINKRTMHKYEQESKKAGKASFAYAWVLDETG 129

Query: 248 AE 253
            E
Sbjct: 130 EE 131



 Score = 33.1 bits (72), Expect = 0.88
 Identities = 12/37 (32%), Positives = 23/37 (62%)
 Frame = +2

Query: 536 YSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           + + RF+EI  ++  ++K+ G+  + V F+P SG  G
Sbjct: 225 WQQERFQEITGKLGHFLKQAGFKESDVGFIPTSGLSG 261


>AK222519-1|BAD96239.1|  366|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 variant protein.
          Length = 366

 Score =  111 bits (268), Expect = 2e-24
 Identities = 54/58 (93%), Positives = 55/58 (94%)
 Frame = +1

Query: 343 DFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGETK 516
           DFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQTREHALLA+TLGVKQLIVG  K
Sbjct: 1   DFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNK 58



 Score = 78.6 bits (185), Expect = 2e-14
 Identities = 34/42 (80%), Positives = 38/42 (90%)
 Frame = +2

Query: 521 STEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           STEPPYS+ R+EEI KEVS+YIKKIGYNP  VAFVPISGW+G
Sbjct: 61  STEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNG 102


>BC070500-1|AAH70500.1|   67|Homo sapiens EEF1A1 protein protein.
          Length = 67

 Score =  108 bits (259), Expect = 2e-23
 Identities = 49/51 (96%), Positives = 50/51 (98%)
 Frame = +2

Query: 56  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGK 208
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMG+
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGR 51


>X17644-1|CAA35635.1|  499|Homo sapiens protein ( Human GST1-Hs mRNA
           for GTP-binding protein. ).
          Length = 499

 Score =  105 bits (251), Expect = 2e-22
 Identities = 48/83 (57%), Positives = 61/83 (73%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 435
           ++G T+++    FET K + TI+DAPGH+ F+ NMI G SQAD AVL+++A  GEFE G 
Sbjct: 135 DKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGASQADLAVLVISARKGEFETGF 194

Query: 436 SKNGQTREHALLAFTLGVKQLIV 504
            K GQTREHA+LA T GVK LIV
Sbjct: 195 EKGGQTREHAMLAKTAGVKHLIV 217



 Score = 74.1 bits (174), Expect = 4e-13
 Identities = 31/68 (45%), Positives = 47/68 (69%)
 Frame = +2

Query: 50  PKMGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAW 229
           P    +K H+N+V IGHVD+GKST  G ++Y  G +DKRT+EK+E+EA+E  + ++  +W
Sbjct: 66  PPGAPKKEHVNVVFIGHVDAGKSTIGGQIMYLTGMVDKRTLEKYEREAKEKNRETWYLSW 125

Query: 230 VLDKLKAE 253
            LD  + E
Sbjct: 126 ALDTNQEE 133



 Score = 36.3 bits (80), Expect = 0.094
 Identities = 15/38 (39%), Positives = 26/38 (68%), Gaps = 1/38 (2%)
 Frame = +2

Query: 536 YSEPRFEEIKKEVSSYIKKIGYNPAA-VAFVPISGWHG 646
           +S  R+EE K+++  ++KK+G+NP   + F+P SG  G
Sbjct: 229 WSNERYEECKEKLVPFLKKVGFNPKKDIHFMPCSGLTG 266


>U95742-2|AAB67250.1|  499|Homo sapiens G1 to S phase transition
           protein protein.
          Length = 499

 Score =  105 bits (251), Expect = 2e-22
 Identities = 48/83 (57%), Positives = 61/83 (73%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 435
           ++G T+++    FET K + TI+DAPGH+ F+ NMI G SQAD AVL+++A  GEFE G 
Sbjct: 135 DKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGASQADLAVLVISARKGEFETGF 194

Query: 436 SKNGQTREHALLAFTLGVKQLIV 504
            K GQTREHA+LA T GVK LIV
Sbjct: 195 EKGGQTREHAMLAKTAGVKHLIV 217



 Score = 74.1 bits (174), Expect = 4e-13
 Identities = 31/68 (45%), Positives = 47/68 (69%)
 Frame = +2

Query: 50  PKMGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAW 229
           P    +K H+N+V IGHVD+GKST  G ++Y  G +DKRT+EK+E+EA+E  + ++  +W
Sbjct: 66  PPGAPKKEHVNVVFIGHVDAGKSTIGGQIMYLTGMVDKRTLEKYEREAKEKNRETWYLSW 125

Query: 230 VLDKLKAE 253
            LD  + E
Sbjct: 126 ALDTNQEE 133



 Score = 36.3 bits (80), Expect = 0.094
 Identities = 15/38 (39%), Positives = 26/38 (68%), Gaps = 1/38 (2%)
 Frame = +2

Query: 536 YSEPRFEEIKKEVSSYIKKIGYNPAA-VAFVPISGWHG 646
           +S  R+EE K+++  ++KK+G+NP   + F+P SG  G
Sbjct: 229 WSNERYEECKEKLVPFLKKVGFNPKKDIHFMPCSGLTG 266


>BT006722-1|AAP35368.1|  498|Homo sapiens G1 to S phase transition 1
           protein.
          Length = 498

 Score =  105 bits (251), Expect = 2e-22
 Identities = 48/83 (57%), Positives = 61/83 (73%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 435
           ++G T+++    FET K + TI+DAPGH+ F+ NMI G SQAD AVL+++A  GEFE G 
Sbjct: 134 DKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGASQADLAVLVISARKGEFETGF 193

Query: 436 SKNGQTREHALLAFTLGVKQLIV 504
            K GQTREHA+LA T GVK LIV
Sbjct: 194 EKGGQTREHAMLAKTAGVKHLIV 216



 Score = 74.1 bits (174), Expect = 4e-13
 Identities = 31/68 (45%), Positives = 47/68 (69%)
 Frame = +2

Query: 50  PKMGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAW 229
           P    +K H+N+V IGHVD+GKST  G ++Y  G +DKRT+EK+E+EA+E  + ++  +W
Sbjct: 65  PPGAPKKEHVNVVFIGHVDAGKSTIGGQIMYLTGMVDKRTLEKYEREAKEKNRETWYLSW 124

Query: 230 VLDKLKAE 253
            LD  + E
Sbjct: 125 ALDTNQEE 132



 Score = 36.3 bits (80), Expect = 0.094
 Identities = 15/38 (39%), Positives = 26/38 (68%), Gaps = 1/38 (2%)
 Frame = +2

Query: 536 YSEPRFEEIKKEVSSYIKKIGYNPAA-VAFVPISGWHG 646
           +S  R+EE K+++  ++KK+G+NP   + F+P SG  G
Sbjct: 228 WSNERYEECKEKLVPFLKKVGFNPKKDIHFMPCSGLTG 265


>BC009503-1|AAH09503.2|  633|Homo sapiens GSPT1 protein protein.
          Length = 633

 Score =  105 bits (251), Expect = 2e-22
 Identities = 48/83 (57%), Positives = 61/83 (73%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 435
           ++G T+++    FET K + TI+DAPGH+ F+ NMI G SQAD AVL+++A  GEFE G 
Sbjct: 269 DKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGASQADLAVLVISARKGEFETGF 328

Query: 436 SKNGQTREHALLAFTLGVKQLIV 504
            K GQTREHA+LA T GVK LIV
Sbjct: 329 EKGGQTREHAMLAKTAGVKHLIV 351



 Score = 74.1 bits (174), Expect = 4e-13
 Identities = 31/68 (45%), Positives = 47/68 (69%)
 Frame = +2

Query: 50  PKMGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAW 229
           P    +K H+N+V IGHVD+GKST  G ++Y  G +DKRT+EK+E+EA+E  + ++  +W
Sbjct: 200 PPGAPKKEHVNVVFIGHVDAGKSTIGGQIMYLTGMVDKRTLEKYEREAKEKNRETWYLSW 259

Query: 230 VLDKLKAE 253
            LD  + E
Sbjct: 260 ALDTNQEE 267



 Score = 36.3 bits (80), Expect = 0.094
 Identities = 15/38 (39%), Positives = 26/38 (68%), Gaps = 1/38 (2%)
 Frame = +2

Query: 536 YSEPRFEEIKKEVSSYIKKIGYNPAA-VAFVPISGWHG 646
           +S  R+EE K+++  ++KK+G+NP   + F+P SG  G
Sbjct: 363 WSNERYEECKEKLVPFLKKVGFNPKKDIHFMPCSGLTG 400


>BC036077-1|AAH36077.1|  628|Homo sapiens G1 to S phase transition 2
           protein.
          Length = 628

 Score =  103 bits (248), Expect = 4e-22
 Identities = 47/83 (56%), Positives = 61/83 (73%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 435
           ++G T+++    FET + + TI+DAPGH+ F+ NMI G SQAD AVL+++A  GEFE G 
Sbjct: 264 DKGKTVEVGRAYFETERKHFTILDAPGHKSFVPNMIGGASQADLAVLVISARKGEFETGF 323

Query: 436 SKNGQTREHALLAFTLGVKQLIV 504
            K GQTREHA+LA T GVK LIV
Sbjct: 324 EKGGQTREHAMLAKTAGVKHLIV 346



 Score = 72.9 bits (171), Expect = 9e-13
 Identities = 30/68 (44%), Positives = 47/68 (69%)
 Frame = +2

Query: 50  PKMGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAW 229
           P    +K H+N+V IGHVD+GKST  G +++  G +DKRT+EK+E+EA+E  + ++  +W
Sbjct: 195 PSGAPKKEHVNVVFIGHVDAGKSTIGGQIMFLTGMVDKRTLEKYEREAKEKNRETWYLSW 254

Query: 230 VLDKLKAE 253
            LD  + E
Sbjct: 255 ALDTNQEE 262



 Score = 33.1 bits (72), Expect = 0.88
 Identities = 14/38 (36%), Positives = 26/38 (68%), Gaps = 1/38 (2%)
 Frame = +2

Query: 536 YSEPRFEEIKKEVSSYIKKIGYNPAA-VAFVPISGWHG 646
           +S  R+EE K+++  ++KK+G++P   + F+P SG  G
Sbjct: 358 WSIERYEECKEKLVPFLKKVGFSPKKDIHFMPCSGLTG 395


>AL929101-2|CAH71524.1|  628|Homo sapiens G1 to S phase transition 2
           protein.
          Length = 628

 Score =  103 bits (248), Expect = 4e-22
 Identities = 47/83 (56%), Positives = 61/83 (73%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 435
           ++G T+++    FET + + TI+DAPGH+ F+ NMI G SQAD AVL+++A  GEFE G 
Sbjct: 264 DKGKTVEVGRAYFETERKHFTILDAPGHKSFVPNMIGGASQADLAVLVISARKGEFETGF 323

Query: 436 SKNGQTREHALLAFTLGVKQLIV 504
            K GQTREHA+LA T GVK LIV
Sbjct: 324 EKGGQTREHAMLAKTAGVKHLIV 346



 Score = 72.9 bits (171), Expect = 9e-13
 Identities = 30/68 (44%), Positives = 47/68 (69%)
 Frame = +2

Query: 50  PKMGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAW 229
           P    +K H+N+V IGHVD+GKST  G +++  G +DKRT+EK+E+EA+E  + ++  +W
Sbjct: 195 PSGAPKKEHVNVVFIGHVDAGKSTIGGQIMFLTGMVDKRTLEKYEREAKEKNRETWYLSW 254

Query: 230 VLDKLKAE 253
            LD  + E
Sbjct: 255 ALDTNQEE 262



 Score = 33.1 bits (72), Expect = 0.88
 Identities = 14/38 (36%), Positives = 26/38 (68%), Gaps = 1/38 (2%)
 Frame = +2

Query: 536 YSEPRFEEIKKEVSSYIKKIGYNPAA-VAFVPISGWHG 646
           +S  R+EE K+++  ++KK+G++P   + F+P SG  G
Sbjct: 358 WSIERYEECKEKLVPFLKKVGFSPKKDIHFMPCSGLTG 395


>AK023155-1|BAB14435.1|  504|Homo sapiens protein ( Homo sapiens
           cDNA FLJ13093 fis, clone NT2RP3002151, highly similar to
           G1 TO S PHASE TRANSITION PROTEIN 1 HOMOLOG. ).
          Length = 504

 Score =  103 bits (248), Expect = 4e-22
 Identities = 47/83 (56%), Positives = 61/83 (73%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 435
           ++G T+++    FET + + TI+DAPGH+ F+ NMI G SQAD AVL+++A  GEFE G 
Sbjct: 161 DKGKTVEVGRAYFETERKHFTILDAPGHKSFVPNMIGGASQADLAVLVISARKGEFETGF 220

Query: 436 SKNGQTREHALLAFTLGVKQLIV 504
            K GQTREHA+LA T GVK LIV
Sbjct: 221 EKGGQTREHAMLAKTAGVKHLIV 243



 Score = 72.9 bits (171), Expect = 9e-13
 Identities = 30/68 (44%), Positives = 47/68 (69%)
 Frame = +2

Query: 50  PKMGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAW 229
           P    +K H+N+V IGHVD+GKST  G +++  G +DKRT+EK+E+EA+E  + ++  +W
Sbjct: 92  PSGAPKKEHVNVVFIGHVDAGKSTIGGQIMFLTGMVDKRTLEKYEREAKEKNRETWYLSW 151

Query: 230 VLDKLKAE 253
            LD  + E
Sbjct: 152 ALDTNQEE 159



 Score = 33.1 bits (72), Expect = 0.88
 Identities = 14/38 (36%), Positives = 26/38 (68%), Gaps = 1/38 (2%)
 Frame = +2

Query: 536 YSEPRFEEIKKEVSSYIKKIGYNPAA-VAFVPISGWHG 646
           +S  R+EE K+++  ++KK+G++P   + F+P SG  G
Sbjct: 255 WSIERYEECKEKLVPFLKKVGFSPKKDIHFMPCSGLTG 292


>AJ251548-1|CAB91089.1|  628|Homo sapiens polypeptide chain release
           factor 3b protein.
          Length = 628

 Score =  103 bits (248), Expect = 4e-22
 Identities = 47/83 (56%), Positives = 61/83 (73%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 435
           ++G T+++    FET + + TI+DAPGH+ F+ NMI G SQAD AVL+++A  GEFE G 
Sbjct: 264 DKGKTVEVGRAYFETERKHFTILDAPGHKSFVPNMIGGASQADLAVLVISARKGEFETGF 323

Query: 436 SKNGQTREHALLAFTLGVKQLIV 504
            K GQTREHA+LA T GVK LIV
Sbjct: 324 EKGGQTREHAMLAKTAGVKHLIV 346



 Score = 72.9 bits (171), Expect = 9e-13
 Identities = 30/68 (44%), Positives = 47/68 (69%)
 Frame = +2

Query: 50  PKMGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAW 229
           P    +K H+N+V IGHVD+GKST  G +++  G +DKRT+EK+E+EA+E  + ++  +W
Sbjct: 195 PSGAPKKEHVNVVFIGHVDAGKSTIGGQIMFLTGMVDKRTLEKYEREAKEKNRETWYLSW 254

Query: 230 VLDKLKAE 253
            LD  + E
Sbjct: 255 ALDTNQEE 262



 Score = 33.1 bits (72), Expect = 0.88
 Identities = 14/38 (36%), Positives = 26/38 (68%), Gaps = 1/38 (2%)
 Frame = +2

Query: 536 YSEPRFEEIKKEVSSYIKKIGYNPAA-VAFVPISGWHG 646
           +S  R+EE K+++  ++KK+G++P   + F+P SG  G
Sbjct: 358 WSIERYEECKEKLVPFLKKVGFSPKKDIHFMPCSGLTG 395


>AK001303-1|BAA91612.1|  628|Homo sapiens protein ( Homo sapiens
           cDNA FLJ10441 fis, clone NT2RP1000733, highly similar to
           Human mRNA for GSPT1-TK protein. ).
          Length = 628

 Score =  103 bits (247), Expect = 5e-22
 Identities = 47/83 (56%), Positives = 61/83 (73%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 435
           ++G T+++    FET + + TI+DAPGH+ F+ NMI G SQAD AVL+++A  GEFE G 
Sbjct: 264 DKGKTVEVGRAYFETERKHFTILDAPGHKGFVPNMIGGASQADLAVLVISARKGEFETGF 323

Query: 436 SKNGQTREHALLAFTLGVKQLIV 504
            K GQTREHA+LA T GVK LIV
Sbjct: 324 EKGGQTREHAMLAKTAGVKHLIV 346



 Score = 72.9 bits (171), Expect = 9e-13
 Identities = 30/68 (44%), Positives = 47/68 (69%)
 Frame = +2

Query: 50  PKMGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAW 229
           P    +K H+N+V IGHVD+GKST  G +++  G +DKRT+EK+E+EA+E  + ++  +W
Sbjct: 195 PSGAPKKEHVNVVFIGHVDAGKSTIGGQIMFLTGMVDKRTLEKYEREAKEKNRETWYLSW 254

Query: 230 VLDKLKAE 253
            LD  + E
Sbjct: 255 ALDTNQEE 262



 Score = 33.1 bits (72), Expect = 0.88
 Identities = 14/38 (36%), Positives = 26/38 (68%), Gaps = 1/38 (2%)
 Frame = +2

Query: 536 YSEPRFEEIKKEVSSYIKKIGYNPAA-VAFVPISGWHG 646
           +S  R+EE K+++  ++KK+G++P   + F+P SG  G
Sbjct: 358 WSIERYEECKEKLVPFLKKVGFSPKKDIHFMPCSGLTG 395


>AF328730-1|AAN09722.1|  361|Homo sapiens CTCL tumor antigen
           HD-CL-08 protein.
          Length = 361

 Score =  101 bits (241), Expect = 3e-21
 Identities = 49/53 (92%), Positives = 50/53 (94%)
 Frame = +1

Query: 358 MITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGETK 516
           MITGTSQADCAVLIVAAG GEFEAGISKNGQTREHALLA+TLGVKQLIVG  K
Sbjct: 1   MITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNK 53



 Score = 78.6 bits (185), Expect = 2e-14
 Identities = 34/42 (80%), Positives = 38/42 (90%)
 Frame = +2

Query: 521 STEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           STEPPYS+ R+EEI KEVS+YIKKIGYNP  VAFVPISGW+G
Sbjct: 56  STEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNG 97


>AF322220-1|AAN51932.1|  361|Homo sapiens cervical cancer suppressor
           3 protein.
          Length = 361

 Score =  101 bits (241), Expect = 3e-21
 Identities = 49/53 (92%), Positives = 50/53 (94%)
 Frame = +1

Query: 358 MITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGETK 516
           MITGTSQADCAVLIVAAG GEFEAGISKNGQTREHALLA+TLGVKQLIVG  K
Sbjct: 1   MITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNK 53



 Score = 78.6 bits (185), Expect = 2e-14
 Identities = 34/42 (80%), Positives = 38/42 (90%)
 Frame = +2

Query: 521 STEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           STEPPYS+ R+EEI KEVS+YIKKIGYNP  VAFVPISGW+G
Sbjct: 56  STEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNG 97


>AL445190-4|CAI95162.1|  453|Homo sapiens HBS1-like (S. cerevisiae)
           protein.
          Length = 453

 Score = 82.2 bits (194), Expect = 1e-15
 Identities = 35/62 (56%), Positives = 48/62 (77%)
 Frame = +2

Query: 68  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 247
           K  +N+VVIGHVD+GKST  GH++Y  G I+KRT+ K+E+E+++ GK SF YAWVLD+  
Sbjct: 258 KQLLNLVVIGHVDAGKSTLMGHMLYLLGNINKRTMHKYEQESKKAGKASFAYAWVLDETG 317

Query: 248 AE 253
            E
Sbjct: 318 EE 319


>AL353596-1|CAI17913.1|  453|Homo sapiens HBS1-like (S. cerevisiae)
           protein.
          Length = 453

 Score = 82.2 bits (194), Expect = 1e-15
 Identities = 35/62 (56%), Positives = 48/62 (77%)
 Frame = +2

Query: 68  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 247
           K  +N+VVIGHVD+GKST  GH++Y  G I+KRT+ K+E+E+++ GK SF YAWVLD+  
Sbjct: 258 KQLLNLVVIGHVDAGKSTLMGHMLYLLGNINKRTMHKYEQESKKAGKASFAYAWVLDETG 317

Query: 248 AE 253
            E
Sbjct: 318 EE 319


>M29548-1|AAA52367.1|  327|Homo sapiens EEF1A protein.
          Length = 327

 Score = 78.6 bits (185), Expect = 2e-14
 Identities = 34/42 (80%), Positives = 38/42 (90%)
 Frame = +2

Query: 521 STEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           STEPPYS+ R+EEI KEVS+YIKKIGYNP  VAFVPISGW+G
Sbjct: 22  STEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNG 63



 Score = 30.3 bits (65), Expect = 6.2
 Identities = 14/17 (82%), Positives = 15/17 (88%)
 Frame = +1

Query: 466 LLAFTLGVKQLIVGETK 516
           LLA+TLGVKQLIVG  K
Sbjct: 3   LLAYTLGVKQLIVGVNK 19


>BC094687-1|AAH94687.1|  308|Homo sapiens EEF1A1 protein protein.
          Length = 308

 Score = 78.6 bits (185), Expect = 2e-14
 Identities = 34/42 (80%), Positives = 38/42 (90%)
 Frame = +2

Query: 521 STEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           STEPPYS+ R+EEI KEVS+YIKKIGYNP  VAFVPISGW+G
Sbjct: 3   STEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNG 44


>X84694-1|CAA59169.1|  452|Homo sapiens mitochondrial elongation
           factor Tu protein.
          Length = 452

 Score = 68.5 bits (160), Expect = 2e-11
 Identities = 36/82 (43%), Positives = 50/82 (60%)
 Frame = +1

Query: 259 RGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGIS 438
           RGITI+ A  ++ T+  +    D PGH D++KNMITGT+  D  +L+VAA  G       
Sbjct: 104 RGITINAAHVEYSTAARHYAHTDCPGHADYVKNMITGTAPLDGCILVVAANDGPMP---- 159

Query: 439 KNGQTREHALLAFTLGVKQLIV 504
              QTREH LLA  +GV+ ++V
Sbjct: 160 ---QTREHLLLARQIGVEHVVV 178



 Score = 37.9 bits (84), Expect = 0.031
 Identities = 17/53 (32%), Positives = 30/53 (56%), Gaps = 3/53 (5%)
 Frame = +2

Query: 62  KEKTHINIVVIGHVDSGKSTTTG---HLIYKCGGIDKRTIEKFEKEAQEMGKG 211
           ++K H+N+  IGHVD GK+T T     ++ + GG   +  E+ +   +E  +G
Sbjct: 53  RDKPHVNVGTIGHVDHGKTTLTAAITKILAEGGGAKFKKYEEIDNAPEERARG 105


>S75463-1|AAC60647.1|  452|Homo sapiens P43 protein.
          Length = 452

 Score = 68.5 bits (160), Expect = 2e-11
 Identities = 36/82 (43%), Positives = 50/82 (60%)
 Frame = +1

Query: 259 RGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGIS 438
           RGITI+ A  ++ T+  +    D PGH D++KNMITGT+  D  +L+VAA  G       
Sbjct: 107 RGITINAAHVEYSTAARHYAHTDCPGHADYVKNMITGTAPLDGCILVVAANDGPMP---- 162

Query: 439 KNGQTREHALLAFTLGVKQLIV 504
              QTREH LLA  +GV+ ++V
Sbjct: 163 ---QTREHLLLARQIGVEHVVV 181



 Score = 37.9 bits (84), Expect = 0.031
 Identities = 17/53 (32%), Positives = 30/53 (56%), Gaps = 3/53 (5%)
 Frame = +2

Query: 62  KEKTHINIVVIGHVDSGKSTTTG---HLIYKCGGIDKRTIEKFEKEAQEMGKG 211
           ++K H+N+  IGHVD GK+T T     ++ + GG   +  E+ +   +E  +G
Sbjct: 56  RDKPHVNVGTIGHVDHGKTTLTAAITKILAEGGGAKFKKYEEIDNAPEERARG 108


>L38995-1|AAB00499.1|  452|Homo sapiens elongation factor Tu
           protein.
          Length = 452

 Score = 68.5 bits (160), Expect = 2e-11
 Identities = 36/82 (43%), Positives = 50/82 (60%)
 Frame = +1

Query: 259 RGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGIS 438
           RGITI+ A  ++ T+  +    D PGH D++KNMITGT+  D  +L+VAA  G       
Sbjct: 104 RGITINAAHVEYSTAARHYAHTDCPGHADYVKNMITGTAPLDGCILVVAANDGPMP---- 159

Query: 439 KNGQTREHALLAFTLGVKQLIV 504
              QTREH LLA  +GV+ ++V
Sbjct: 160 ---QTREHLLLARQIGVEHVVV 178



 Score = 37.9 bits (84), Expect = 0.031
 Identities = 17/53 (32%), Positives = 30/53 (56%), Gaps = 3/53 (5%)
 Frame = +2

Query: 62  KEKTHINIVVIGHVDSGKSTTTG---HLIYKCGGIDKRTIEKFEKEAQEMGKG 211
           ++K H+N+  IGHVD GK+T T     ++ + GG   +  E+ +   +E  +G
Sbjct: 53  RDKPHVNVGTIGHVDHGKTTLTAAITKILAEGGGAKFKKYEEIDNAPEERARG 105


>BC010041-1|AAH10041.2|  455|Homo sapiens Tu translation elongation
           factor, mitochondrial protein.
          Length = 455

 Score = 68.5 bits (160), Expect = 2e-11
 Identities = 36/82 (43%), Positives = 50/82 (60%)
 Frame = +1

Query: 259 RGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGIS 438
           RGITI+ A  ++ T+  +    D PGH D++KNMITGT+  D  +L+VAA  G       
Sbjct: 107 RGITINAAHVEYSTAARHYAHTDCPGHADYVKNMITGTAPLDGCILVVAANDGPMP---- 162

Query: 439 KNGQTREHALLAFTLGVKQLIV 504
              QTREH LLA  +GV+ ++V
Sbjct: 163 ---QTREHLLLARQIGVEHVVV 181



 Score = 37.9 bits (84), Expect = 0.031
 Identities = 17/53 (32%), Positives = 30/53 (56%), Gaps = 3/53 (5%)
 Frame = +2

Query: 62  KEKTHINIVVIGHVDSGKSTTTG---HLIYKCGGIDKRTIEKFEKEAQEMGKG 211
           ++K H+N+  IGHVD GK+T T     ++ + GG   +  E+ +   +E  +G
Sbjct: 56  RDKPHVNVGTIGHVDHGKTTLTAAITKILAEGGGAKFKKYEEIDNAPEERARG 108


>BC001633-1|AAH01633.2|  455|Homo sapiens Tu translation elongation
           factor, mitochondrial protein.
          Length = 455

 Score = 68.5 bits (160), Expect = 2e-11
 Identities = 36/82 (43%), Positives = 50/82 (60%)
 Frame = +1

Query: 259 RGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGIS 438
           RGITI+ A  ++ T+  +    D PGH D++KNMITGT+  D  +L+VAA  G       
Sbjct: 107 RGITINAAHVEYSTAARHYAHTDCPGHADYVKNMITGTAPLDGCILVVAANDGPMP---- 162

Query: 439 KNGQTREHALLAFTLGVKQLIV 504
              QTREH LLA  +GV+ ++V
Sbjct: 163 ---QTREHLLLARQIGVEHVVV 181



 Score = 37.9 bits (84), Expect = 0.031
 Identities = 17/53 (32%), Positives = 30/53 (56%), Gaps = 3/53 (5%)
 Frame = +2

Query: 62  KEKTHINIVVIGHVDSGKSTTTG---HLIYKCGGIDKRTIEKFEKEAQEMGKG 211
           ++K H+N+  IGHVD GK+T T     ++ + GG   +  E+ +   +E  +G
Sbjct: 56  RDKPHVNVGTIGHVDHGKTTLTAAITKILAEGGGAKFKKYEEIDNAPEERARG 108


>BC063511-1|AAH63511.1|  290|Homo sapiens EEF1A1 protein protein.
          Length = 290

 Score = 52.4 bits (120), Expect = 1e-06
 Identities = 22/26 (84%), Positives = 24/26 (92%)
 Frame = +2

Query: 569 EVSSYIKKIGYNPAAVAFVPISGWHG 646
           EVS+YIKKIGYNP  VAFVPISGW+G
Sbjct: 1   EVSTYIKKIGYNPDTVAFVPISGWNG 26


>BC014377-1|AAH14377.1|  287|Homo sapiens Unknown (protein for
           IMAGE:4041545) protein.
          Length = 287

 Score = 46.8 bits (106), Expect = 7e-05
 Identities = 19/22 (86%), Positives = 20/22 (90%)
 Frame = +2

Query: 581 YIKKIGYNPAAVAFVPISGWHG 646
           YIKKIGYNP  VAFVPISGW+G
Sbjct: 2   YIKKIGYNPDTVAFVPISGWNG 23


>BC030612-1|AAH30612.1|  777|Homo sapiens G elongation factor,
           mitochondrial 2 protein.
          Length = 777

 Score = 39.1 bits (87), Expect = 0.013
 Identities = 22/54 (40%), Positives = 26/54 (48%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 417
           ERGITI  A   F+   Y V +ID PGH DF   +       D AV +  A  G
Sbjct: 118 ERGITIQSAAVTFDWKGYRVNLIDTPGHVDFTLEVERCLRVLDGAVAVFDASAG 171



 Score = 31.5 bits (68), Expect = 2.7
 Identities = 11/24 (45%), Positives = 18/24 (75%)
 Frame = +2

Query: 80  NIVVIGHVDSGKSTTTGHLIYKCG 151
           NI ++ H+D+GK+TTT  ++Y  G
Sbjct: 72  NIGIMAHIDAGKTTTTERILYYSG 95


>BC015712-1|AAH15712.1|  779|Homo sapiens GFM2 protein protein.
          Length = 779

 Score = 39.1 bits (87), Expect = 0.013
 Identities = 22/54 (40%), Positives = 26/54 (48%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 417
           ERGITI  A   F+   Y V +ID PGH DF   +       D AV +  A  G
Sbjct: 118 ERGITIQSAAVTFDWKGYRVNLIDTPGHVDFTLEVERCLRVLDGAVAVFDASAG 171



 Score = 31.5 bits (68), Expect = 2.7
 Identities = 11/24 (45%), Positives = 18/24 (75%)
 Frame = +2

Query: 80  NIVVIGHVDSGKSTTTGHLIYKCG 151
           NI ++ H+D+GK+TTT  ++Y  G
Sbjct: 72  NIGIMAHIDAGKTTTTERILYYSG 95


>AY453587-1|AAS49035.1|  531|Homo sapiens elongation factor G
           isoform protein.
          Length = 531

 Score = 39.1 bits (87), Expect = 0.013
 Identities = 22/54 (40%), Positives = 26/54 (48%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 417
           ERGITI  A   F+   Y V +ID PGH DF   +       D AV +  A  G
Sbjct: 118 ERGITIQSAAVTFDWKGYRVNLIDTPGHVDFTLEVERCLRVLDGAVAVFDASAG 171



 Score = 31.5 bits (68), Expect = 2.7
 Identities = 11/24 (45%), Positives = 18/24 (75%)
 Frame = +2

Query: 80  NIVVIGHVDSGKSTTTGHLIYKCG 151
           NI ++ H+D+GK+TTT  ++Y  G
Sbjct: 72  NIGIMAHIDAGKTTTTERILYYSG 95


>AK025314-1|BAB15109.1|  513|Homo sapiens protein ( Homo sapiens
           cDNA: FLJ21661 fis, clone COL08837. ).
          Length = 513

 Score = 39.1 bits (87), Expect = 0.013
 Identities = 22/54 (40%), Positives = 26/54 (48%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 417
           ERGITI  A   F+   Y V +ID PGH DF   +       D AV +  A  G
Sbjct: 118 ERGITIQSAAVTFDWKGYRVNLIDTPGHVDFTLEVERCLRVLDGAVAVFDASAG 171



 Score = 31.5 bits (68), Expect = 2.7
 Identities = 11/24 (45%), Positives = 18/24 (75%)
 Frame = +2

Query: 80  NIVVIGHVDSGKSTTTGHLIYKCG 151
           NI ++ H+D+GK+TTT  ++Y  G
Sbjct: 72  NIGIMAHIDAGKTTTTERILYYSG 95


>AF367997-1|AAK53401.1|  779|Homo sapiens elongation factor G2
           protein.
          Length = 779

 Score = 39.1 bits (87), Expect = 0.013
 Identities = 22/54 (40%), Positives = 26/54 (48%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 417
           ERGITI  A   F+   Y V +ID PGH DF   +       D AV +  A  G
Sbjct: 118 ERGITIQSAAVTFDWKGYRVNLIDTPGHVDFTLEVERCLRVLDGAVAVFDASAG 171



 Score = 31.5 bits (68), Expect = 2.7
 Identities = 11/24 (45%), Positives = 18/24 (75%)
 Frame = +2

Query: 80  NIVVIGHVDSGKSTTTGHLIYKCG 151
           NI ++ H+D+GK+TTT  ++Y  G
Sbjct: 72  NIGIMAHIDAGKTTTTERILYYSG 95


>AF111808-1|AAL39010.1|  732|Homo sapiens MSTP027 protein.
          Length = 732

 Score = 39.1 bits (87), Expect = 0.013
 Identities = 22/54 (40%), Positives = 26/54 (48%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 417
           ERGITI  A   F+   Y V +ID PGH DF   +       D AV +  A  G
Sbjct: 118 ERGITIQSAAVTFDWKGYRVNLIDTPGHVDFTLEVERCLRVLDGAVAVFDASAG 171



 Score = 31.5 bits (68), Expect = 2.7
 Identities = 11/24 (45%), Positives = 18/24 (75%)
 Frame = +2

Query: 80  NIVVIGHVDSGKSTTTGHLIYKCG 151
           NI ++ H+D+GK+TTT  ++Y  G
Sbjct: 72  NIGIMAHIDAGKTTTTERILYYSG 95


>BC036768-1|AAH36768.1|  669|Homo sapiens GUF1 GTPase homolog (S.
           cerevisiae) protein.
          Length = 669

 Score = 33.5 bits (73), Expect = 0.66
 Identities = 19/58 (32%), Positives = 27/58 (46%), Gaps = 4/58 (6%)
 Frame = +1

Query: 256 ERGITIDIA----LWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 417
           ERGIT+        +  E  +Y + +ID PGH DF   +    S     +L+V A  G
Sbjct: 113 ERGITVKAQTASLFYNCEGKQYLLNLIDTPGHVDFSYEVSRSLSACQGVLLVVDANEG 170



 Score = 30.3 bits (65), Expect = 6.2
 Identities = 13/28 (46%), Positives = 16/28 (57%)
 Frame = +2

Query: 80  NIVVIGHVDSGKSTTTGHLIYKCGGIDK 163
           N  ++ HVD GKST    L+   G IDK
Sbjct: 70  NFSIVAHVDHGKSTLADRLLELTGTIDK 97


>AK023282-1|BAB14507.1|  669|Homo sapiens protein ( Homo sapiens
           cDNA FLJ13220 fis, clone NT2RP4002047, moderately
           similar to GTP-BINDING PROTEIN LEPA. ).
          Length = 669

 Score = 33.5 bits (73), Expect = 0.66
 Identities = 19/58 (32%), Positives = 27/58 (46%), Gaps = 4/58 (6%)
 Frame = +1

Query: 256 ERGITIDIA----LWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 417
           ERGIT+        +  E  +Y + +ID PGH DF   +    S     +L+V A  G
Sbjct: 113 ERGITVKAQTASLFYNCEGKQYLLNLIDTPGHVDFSYEVSRSLSACQGVLLVVDANEG 170



 Score = 32.3 bits (70), Expect = 1.5
 Identities = 14/28 (50%), Positives = 17/28 (60%)
 Frame = +2

Query: 80  NIVVIGHVDSGKSTTTGHLIYKCGGIDK 163
           N  ++ HVD GKST T  L+   G IDK
Sbjct: 70  NFSIVAHVDHGKSTLTDRLLELTGTIDK 97


>BC049210-1|AAH49210.1|  751|Homo sapiens G elongation factor,
           mitochondrial 1 protein.
          Length = 751

 Score = 33.1 bits (72), Expect = 0.88
 Identities = 20/54 (37%), Positives = 25/54 (46%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 417
           +RGITI  A          + IID PGH DF   +       D AVL++ A  G
Sbjct: 97  QRGITIQSAATYTMWKDVNINIIDTPGHVDFTIEVERALRVLDGAVLVLCAVGG 150



 Score = 30.7 bits (66), Expect = 4.7
 Identities = 13/28 (46%), Positives = 18/28 (64%)
 Frame = +2

Query: 80  NIVVIGHVDSGKSTTTGHLIYKCGGIDK 163
           NI +  H+DSGK+T T  ++Y  G I K
Sbjct: 48  NIGISAHIDSGKTTLTERVLYYTGRIAK 75


>AF367998-1|AAK53402.1|  751|Homo sapiens elongation factor G1
           protein.
          Length = 751

 Score = 33.1 bits (72), Expect = 0.88
 Identities = 20/54 (37%), Positives = 25/54 (46%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 417
           +RGITI  A          + IID PGH DF   +       D AVL++ A  G
Sbjct: 97  QRGITIQSAATYTMWKDVNINIIDTPGHVDFTIEVERALRVLDGAVLVLCAVGG 150



 Score = 30.7 bits (66), Expect = 4.7
 Identities = 13/28 (46%), Positives = 18/28 (64%)
 Frame = +2

Query: 80  NIVVIGHVDSGKSTTTGHLIYKCGGIDK 163
           NI +  H+DSGK+T T  ++Y  G I K
Sbjct: 48  NIGISAHIDSGKTTLTERVLYYTGRIAK 75


>AF309777-1|AAK58877.1|  751|Homo sapiens elongation factor G
           protein.
          Length = 751

 Score = 33.1 bits (72), Expect = 0.88
 Identities = 20/54 (37%), Positives = 25/54 (46%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 417
           +RGITI  A          + IID PGH DF   +       D AVL++ A  G
Sbjct: 97  QRGITIQSAATYTMWKDVNINIIDTPGHVDFTIEVERALRVLDGAVLVLCAVGG 150



 Score = 30.7 bits (66), Expect = 4.7
 Identities = 13/28 (46%), Positives = 18/28 (64%)
 Frame = +2

Query: 80  NIVVIGHVDSGKSTTTGHLIYKCGGIDK 163
           NI +  H+DSGK+T T  ++Y  G I K
Sbjct: 48  NIGISAHIDSGKTTLTERVLYYTGRIAK 75


>Z11692-1|CAA77750.1|  858|Homo sapiens human  elongation factor 2
           protein.
          Length = 858

 Score = 32.7 bits (71), Expect = 1.2
 Identities = 16/32 (50%), Positives = 19/32 (59%)
 Frame = +2

Query: 56  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCG 151
           M K+    N+ VI HVD GKST T  L+ K G
Sbjct: 13  MDKKANIRNMSVIAHVDHGKSTLTDSLVCKAG 44


>X51466-1|CAA35829.1|  858|Homo sapiens elongation factor 2 protein.
          Length = 858

 Score = 32.7 bits (71), Expect = 1.2
 Identities = 16/32 (50%), Positives = 19/32 (59%)
 Frame = +2

Query: 56  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCG 151
           M K+    N+ VI HVD GKST T  L+ K G
Sbjct: 13  MDKKANIRNMSVIAHVDHGKSTLTDSLVCKAG 44


>L19161-1|AAA19696.1|  472|Homo sapiens translation initiation
           factor eIF-2 gamma subunit protein.
          Length = 472

 Score = 32.7 bits (71), Expect = 1.2
 Identities = 17/69 (24%), Positives = 32/69 (46%)
 Frame = +1

Query: 310 YVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGV 489
           +V+ +D PGH   +  M+ G +  D A+L++A              QT EH      + +
Sbjct: 129 HVSFVDCPGHDILMATMLNGAAVMDAALLLIAGNES------CPQPQTSEHLAAIEIMKL 182

Query: 490 KQLIVGETK 516
           K +++ + K
Sbjct: 183 KHILILQNK 191


>DQ120619-1|ABB92405.1|  471|Homo sapiens eFI-2-gamma protein.
          Length = 471

 Score = 32.7 bits (71), Expect = 1.2
 Identities = 17/69 (24%), Positives = 32/69 (46%)
 Frame = +1

Query: 310 YVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGV 489
           +V+ +D PGH   +  M+ G +  D A+L++A              QT EH      + +
Sbjct: 129 HVSFVDCPGHDILMATMLNGAAVMDAALLLIAGNES------CPQPQTSEHLAAIEIMKL 182

Query: 490 KQLIVGETK 516
           K +++ + K
Sbjct: 183 KHILILQNK 191


>BC126259-1|AAI26260.1|  858|Homo sapiens EEF2 protein protein.
          Length = 858

 Score = 32.7 bits (71), Expect = 1.2
 Identities = 16/32 (50%), Positives = 19/32 (59%)
 Frame = +2

Query: 56  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCG 151
           M K+    N+ VI HVD GKST T  L+ K G
Sbjct: 13  MDKKANIRNMSVIAHVDHGKSTLTDSLVCKAG 44


>BC087847-1|AAH87847.1|  465|Homo sapiens Unknown (protein for
           IMAGE:30389268) protein.
          Length = 465

 Score = 32.7 bits (71), Expect = 1.2
 Identities = 17/69 (24%), Positives = 32/69 (46%)
 Frame = +1

Query: 310 YVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGV 489
           +V+ +D PGH   +  M+ G +  D A+L++A              QT EH      + +
Sbjct: 128 HVSFVDCPGHDILMATMLNGAAVMDAALLLIAGNES------CPQPQTSEHLAAIEIMKL 181

Query: 490 KQLIVGETK 516
           K +++ + K
Sbjct: 182 KHILILQNK 190


>BC019906-1|AAH19906.1|  472|Homo sapiens eukaryotic translation
           initiation factor 2, subunit 3 gamma, 52kDa protein.
          Length = 472

 Score = 32.7 bits (71), Expect = 1.2
 Identities = 17/69 (24%), Positives = 32/69 (46%)
 Frame = +1

Query: 310 YVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGV 489
           +V+ +D PGH   +  M+ G +  D A+L++A              QT EH      + +
Sbjct: 129 HVSFVDCPGHDILMATMLNGAAVMDAALLLIAGNES------CPQPQTSEHLAAIEIMKL 182

Query: 490 KQLIVGETK 516
           K +++ + K
Sbjct: 183 KHILILQNK 191


>BC006547-1|AAH06547.1|  583|Homo sapiens EEF2 protein protein.
          Length = 583

 Score = 32.7 bits (71), Expect = 1.2
 Identities = 16/32 (50%), Positives = 19/32 (59%)
 Frame = +2

Query: 56  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCG 151
           M K+    N+ VI HVD GKST T  L+ K G
Sbjct: 13  MDKKANIRNMSVIAHVDHGKSTLTDSLVCKAG 44


>AY942181-1|AAX34409.1|  858|Homo sapiens elongation factor 2
           protein.
          Length = 858

 Score = 32.7 bits (71), Expect = 1.2
 Identities = 16/32 (50%), Positives = 19/32 (59%)
 Frame = +2

Query: 56  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCG 151
           M K+    N+ VI HVD GKST T  L+ K G
Sbjct: 13  MDKKANIRNMSVIAHVDHGKSTLTDSLVCKAG 44


>AK222577-1|BAD96297.1|  472|Homo sapiens eukaryotic translation
           initiation factor 2, subunit 3 gamma, 52kDa variant
           protein.
          Length = 472

 Score = 32.7 bits (71), Expect = 1.2
 Identities = 17/69 (24%), Positives = 32/69 (46%)
 Frame = +1

Query: 310 YVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGV 489
           +V+ +D PGH   +  M+ G +  D A+L++A              QT EH      + +
Sbjct: 129 HVSFVDCPGHDILMATMLNGAAVMDAALLLIAGNES------CPQPQTSEHLAAIEIMKL 182

Query: 490 KQLIVGETK 516
           K +++ + K
Sbjct: 183 KHILILQNK 191


>AJ006932-1|CAA07331.1|  248|Homo sapiens eIF-2gA protein.
          Length = 248

 Score = 32.7 bits (71), Expect = 1.2
 Identities = 17/69 (24%), Positives = 32/69 (46%)
 Frame = +1

Query: 310 YVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGV 489
           +V+ +D PGH   +  M+ G +  D A+L++A              QT EH      + +
Sbjct: 69  HVSFVDCPGHDILMATMLNGAAVMDAALLLIAGNES------CPQPQTSEHLAAIEIMKL 122

Query: 490 KQLIVGETK 516
           K +++ + K
Sbjct: 123 KHILILQNK 131


>L34600-1|AAA67038.1|  727|Homo sapiens initiation factor 2 protein.
          Length = 727

 Score = 31.5 bits (68), Expect = 2.7
 Identities = 14/35 (40%), Positives = 17/35 (48%)
 Frame = +1

Query: 313 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 417
           +T +D PGH  F      G    D  VL+VAA  G
Sbjct: 230 ITFLDTPGHAAFSAMRARGAQVTDIVVLVVAADDG 264


>BC064977-1|AAH64977.1|  465|Homo sapiens MTIF2 protein protein.
          Length = 465

 Score = 31.5 bits (68), Expect = 2.7
 Identities = 14/35 (40%), Positives = 17/35 (48%)
 Frame = +1

Query: 313 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 417
           +T +D PGH  F      G    D  VL+VAA  G
Sbjct: 230 ITFLDTPGHAAFSAMRARGAQVTDIVVLVVAADDG 264


>BC039848-1|AAH39848.1|  500|Homo sapiens Similar to mitochondrial
           translational initiation factor 2 protein.
          Length = 500

 Score = 31.5 bits (68), Expect = 2.7
 Identities = 14/35 (40%), Positives = 17/35 (48%)
 Frame = +1

Query: 313 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 417
           +T +D PGH  F      G    D  VL+VAA  G
Sbjct: 230 ITFLDTPGHAAFSAMRARGAQVTDIVVLVVAADDG 264


>AF495546-1|AAM70196.1|  727|Homo sapiens translation initiation
           factor 2 protein.
          Length = 727

 Score = 31.5 bits (68), Expect = 2.7
 Identities = 14/35 (40%), Positives = 17/35 (48%)
 Frame = +1

Query: 313 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 417
           +T +D PGH  F      G    D  VL+VAA  G
Sbjct: 230 ITFLDTPGHAAFSAMRARGAQVTDIVVLVVAADDG 264


>AF494407-1|AAM14617.1|  727|Homo sapiens mitochondrial
           translation-initiation factor 2 protein.
          Length = 727

 Score = 31.5 bits (68), Expect = 2.7
 Identities = 14/35 (40%), Positives = 17/35 (48%)
 Frame = +1

Query: 313 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 417
           +T +D PGH  F      G    D  VL+VAA  G
Sbjct: 230 ITFLDTPGHAAFSAMRARGAQVTDIVVLVVAADDG 264


>BC007933-1|AAH07933.1|  569|Homo sapiens EEFSEC protein protein.
          Length = 569

 Score = 31.1 bits (67), Expect = 3.5
 Identities = 12/35 (34%), Positives = 19/35 (54%)
 Frame = +1

Query: 313 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 417
           VT++D PGH   I+ +I G    D  +L++    G
Sbjct: 61  VTLVDCPGHASLIRTIIGGAQIIDLMMLVIDVTKG 95


>AF268872-1|AAG13375.1|  526|Homo sapiens MJ0495-like protein SelB
           protein.
          Length = 526

 Score = 31.1 bits (67), Expect = 3.5
 Identities = 12/35 (34%), Positives = 19/35 (54%)
 Frame = +1

Query: 313 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 417
           VT++D PGH   I+ +I G    D  +L++    G
Sbjct: 18  VTLVDCPGHASLIRTIIGGAQIIDLMMLVIDVTKG 52


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 98,896,297
Number of Sequences: 237096
Number of extensions: 2016098
Number of successful extensions: 8292
Number of sequences better than 10.0: 112
Number of HSP's better than 10.0 without gapping: 7939
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 8287
length of database: 76,859,062
effective HSP length: 87
effective length of database: 56,231,710
effective search space used: 7197658880
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -