SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20049
         (646 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BC001709-1|AAH01709.1|  446|Homo sapiens FLJ13052 protein protein.     64   4e-10
AY090771-1|AAM01195.1|  446|Homo sapiens NAD kinase protein.           64   4e-10
AL031282-13|CAA20354.1|  446|Homo sapiens NAD kinase protein.          64   4e-10
AK023114-1|BAB14412.1|  447|Homo sapiens protein ( Homo sapiens ...    64   4e-10
AL031282-12|CAI20045.1|  206|Homo sapiens NAD kinase protein.          39   0.017
AL031282-14|CAI20046.1|  591|Homo sapiens NAD kinase protein.          35   0.28 
AF250320-1|AAG44568.1|  590|Homo sapiens HT029 protein.                35   0.28 
Y00661-1|CAA68676.1| 1227|Homo sapiens protein ( Human bcr mRNA ...    31   4.6  
X06418-1|CAA29726.1|  386|Homo sapiens protein ( Human bcr-abl m...    31   4.6  
X02596-1|CAA26441.1| 1271|Homo sapiens bcr protein.                    31   4.6  
U07000-1|AAB60388.1| 1271|Homo sapiens breakpoint cluster region...    31   4.6  
M15025-1|AAA35594.1|  693|Homo sapiens protein ( Human BCR/ABL m...    31   4.6  
AB209991-1|BAE06073.1| 1287|Homo sapiens BCR variant protein pro...    31   4.6  

>BC001709-1|AAH01709.1|  446|Homo sapiens FLJ13052 protein protein.
          Length = 446

 Score = 64.1 bits (149), Expect = 4e-10
 Identities = 28/49 (57%), Positives = 35/49 (71%)
 Frame = +3

Query: 363 RRTRSLNAPSPIQQFGPCGRIMKNSAMVMQIQDPASQRLTWYKPPLTVL 509
           RRTRSL+ P P+  FGP   +++N   +M IQDPASQRLTW K P +VL
Sbjct: 60  RRTRSLHGPCPVTTFGPKACVLQNPQTIMHIQDPASQRLTWNKSPKSVL 108



 Score = 38.7 bits (86), Expect = 0.017
 Identities = 19/42 (45%), Positives = 30/42 (71%)
 Frame = +2

Query: 509 VIKKVHDAQILAPFVQLVHWLVHDKSMVVFVEAAVLDDTLLA 634
           VIKK+ DA +L PF +L   L+ +++M+V+VE  VL+D  +A
Sbjct: 109 VIKKMRDASLLQPFKELCTHLM-EENMIVYVEKKVLEDPAIA 149


>AY090771-1|AAM01195.1|  446|Homo sapiens NAD kinase protein.
          Length = 446

 Score = 64.1 bits (149), Expect = 4e-10
 Identities = 28/49 (57%), Positives = 35/49 (71%)
 Frame = +3

Query: 363 RRTRSLNAPSPIQQFGPCGRIMKNSAMVMQIQDPASQRLTWYKPPLTVL 509
           RRTRSL+ P P+  FGP   +++N   +M IQDPASQRLTW K P +VL
Sbjct: 60  RRTRSLHGPCPVTTFGPKACVLQNPQTIMHIQDPASQRLTWNKSPKSVL 108



 Score = 38.7 bits (86), Expect = 0.017
 Identities = 19/42 (45%), Positives = 30/42 (71%)
 Frame = +2

Query: 509 VIKKVHDAQILAPFVQLVHWLVHDKSMVVFVEAAVLDDTLLA 634
           VIKK+ DA +L PF +L   L+ +++M+V+VE  VL+D  +A
Sbjct: 109 VIKKMRDASLLQPFKELCTHLM-EENMIVYVEKKVLEDPAIA 149


>AL031282-13|CAA20354.1|  446|Homo sapiens NAD kinase protein.
          Length = 446

 Score = 64.1 bits (149), Expect = 4e-10
 Identities = 28/49 (57%), Positives = 35/49 (71%)
 Frame = +3

Query: 363 RRTRSLNAPSPIQQFGPCGRIMKNSAMVMQIQDPASQRLTWYKPPLTVL 509
           RRTRSL+ P P+  FGP   +++N   +M IQDPASQRLTW K P +VL
Sbjct: 60  RRTRSLHGPCPVTTFGPKACVLQNPQTIMHIQDPASQRLTWNKSPKSVL 108



 Score = 38.7 bits (86), Expect = 0.017
 Identities = 19/42 (45%), Positives = 30/42 (71%)
 Frame = +2

Query: 509 VIKKVHDAQILAPFVQLVHWLVHDKSMVVFVEAAVLDDTLLA 634
           VIKK+ DA +L PF +L   L+ +++M+V+VE  VL+D  +A
Sbjct: 109 VIKKMRDASLLQPFKELCTHLM-EENMIVYVEKKVLEDPAIA 149


>AK023114-1|BAB14412.1|  447|Homo sapiens protein ( Homo sapiens
           cDNA FLJ13052 fis, clone NT2RP3001449. ).
          Length = 447

 Score = 64.1 bits (149), Expect = 4e-10
 Identities = 28/49 (57%), Positives = 35/49 (71%)
 Frame = +3

Query: 363 RRTRSLNAPSPIQQFGPCGRIMKNSAMVMQIQDPASQRLTWYKPPLTVL 509
           RRTRSL+ P P+  FGP   +++N   +M IQDPASQRLTW K P +VL
Sbjct: 60  RRTRSLHGPCPVTTFGPKACVLQNPQTIMHIQDPASQRLTWNKSPKSVL 108



 Score = 38.7 bits (86), Expect = 0.017
 Identities = 19/42 (45%), Positives = 30/42 (71%)
 Frame = +2

Query: 509 VIKKVHDAQILAPFVQLVHWLVHDKSMVVFVEAAVLDDTLLA 634
           VIKK+ DA +L PF +L   L+ +++M+V+VE  VL+D  +A
Sbjct: 109 VIKKMRDASLLQPFKELCTHLM-EENMIVYVEKKVLEDPAIA 149


>AL031282-12|CAI20045.1|  206|Homo sapiens NAD kinase protein.
          Length = 206

 Score = 38.7 bits (86), Expect = 0.017
 Identities = 19/42 (45%), Positives = 30/42 (71%)
 Frame = +2

Query: 509 VIKKVHDAQILAPFVQLVHWLVHDKSMVVFVEAAVLDDTLLA 634
           VIKK+ DA +L PF +L   L+ +++M+V+VE  VL+D  +A
Sbjct: 77  VIKKMRDASLLQPFKELCTHLM-EENMIVYVEKKVLEDPAIA 117



 Score = 35.5 bits (78), Expect = 0.16
 Identities = 16/26 (61%), Positives = 19/26 (73%)
 Frame = +3

Query: 432 NSAMVMQIQDPASQRLTWYKPPLTVL 509
           ++A    IQDPASQRLTW K P +VL
Sbjct: 51  SNACTGHIQDPASQRLTWNKSPKSVL 76


>AL031282-14|CAI20046.1|  591|Homo sapiens NAD kinase protein.
          Length = 591

 Score = 34.7 bits (76), Expect = 0.28
 Identities = 15/19 (78%), Positives = 16/19 (84%)
 Frame = +3

Query: 453 IQDPASQRLTWYKPPLTVL 509
           IQDPASQRLTW K P +VL
Sbjct: 194 IQDPASQRLTWNKSPKSVL 212



 Score = 31.9 bits (69), Expect = 2.0
 Identities = 12/29 (41%), Positives = 19/29 (65%)
 Frame = +3

Query: 363 RRTRSLNAPSPIQQFGPCGRIMKNSAMVM 449
           RRTRSL+ P P+  FGP   +++N   ++
Sbjct: 60  RRTRSLHGPCPVTTFGPKACVLQNPQTII 88


>AF250320-1|AAG44568.1|  590|Homo sapiens HT029 protein.
          Length = 590

 Score = 34.7 bits (76), Expect = 0.28
 Identities = 15/19 (78%), Positives = 16/19 (84%)
 Frame = +3

Query: 453 IQDPASQRLTWYKPPLTVL 509
           IQDPASQRLTW K P +VL
Sbjct: 194 IQDPASQRLTWNKSPKSVL 212



 Score = 31.9 bits (69), Expect = 2.0
 Identities = 12/29 (41%), Positives = 19/29 (65%)
 Frame = +3

Query: 363 RRTRSLNAPSPIQQFGPCGRIMKNSAMVM 449
           RRTRSL+ P P+  FGP   +++N   ++
Sbjct: 60  RRTRSLHGPCPVTTFGPKACVLQNPQTII 88


>Y00661-1|CAA68676.1| 1227|Homo sapiens protein ( Human bcr mRNA
           (break point cluster gene). ).
          Length = 1227

 Score = 30.7 bits (66), Expect = 4.6
 Identities = 14/50 (28%), Positives = 25/50 (50%), Gaps = 1/50 (2%)
 Frame = +2

Query: 392 PNTTVWTMRQDYEKFRHGHANPGSGVAEADLVQAS-PHRAVIKKVHDAQI 538
           P  +V  +R ++E+ R GH  PG+   +   V     H   + KV+D ++
Sbjct: 147 PPASVAALRSNFERIRKGHGQPGADAEKPFYVNVEFHHERGLVKVNDKEV 196


>X06418-1|CAA29726.1|  386|Homo sapiens protein ( Human bcr-abl mRNA
           of acute lymphocytic leukaemia (ALL) patients. ).
          Length = 386

 Score = 30.7 bits (66), Expect = 4.6
 Identities = 14/50 (28%), Positives = 25/50 (50%), Gaps = 1/50 (2%)
 Frame = +2

Query: 392 PNTTVWTMRQDYEKFRHGHANPGSGVAEADLVQAS-PHRAVIKKVHDAQI 538
           P  +V  +R ++E+ R GH  PG+   +   V     H   + KV+D ++
Sbjct: 92  PPASVAALRSNFERIRKGHGQPGADAEKPFYVNVEFHHERGLVKVNDKEV 141


>X02596-1|CAA26441.1| 1271|Homo sapiens bcr protein.
          Length = 1271

 Score = 30.7 bits (66), Expect = 4.6
 Identities = 14/50 (28%), Positives = 25/50 (50%), Gaps = 1/50 (2%)
 Frame = +2

Query: 392 PNTTVWTMRQDYEKFRHGHANPGSGVAEADLVQAS-PHRAVIKKVHDAQI 538
           P  +V  +R ++E+ R GH  PG+   +   V     H   + KV+D ++
Sbjct: 147 PPASVAALRSNFERIRKGHGQPGADAEKPFYVNVEFHHERGLVKVNDKEV 196


>U07000-1|AAB60388.1| 1271|Homo sapiens breakpoint cluster region
           protein protein.
          Length = 1271

 Score = 30.7 bits (66), Expect = 4.6
 Identities = 14/50 (28%), Positives = 25/50 (50%), Gaps = 1/50 (2%)
 Frame = +2

Query: 392 PNTTVWTMRQDYEKFRHGHANPGSGVAEADLVQAS-PHRAVIKKVHDAQI 538
           P  +V  +R ++E+ R GH  PG+   +   V     H   + KV+D ++
Sbjct: 147 PPASVAALRSNFERIRKGHGQPGADAEKPFYVNVEFHHERGLVKVNDKEV 196


>M15025-1|AAA35594.1|  693|Homo sapiens protein ( Human BCR/ABL mRNA
           (product of translocation t(22q11;9q34)), 5' end. ).
          Length = 693

 Score = 30.7 bits (66), Expect = 4.6
 Identities = 14/50 (28%), Positives = 25/50 (50%), Gaps = 1/50 (2%)
 Frame = +2

Query: 392 PNTTVWTMRQDYEKFRHGHANPGSGVAEADLVQAS-PHRAVIKKVHDAQI 538
           P  +V  +R ++E+ R GH  PG+   +   V     H   + KV+D ++
Sbjct: 147 PPASVAALRSNFERIRKGHGQPGADAEKPFYVNVEFHHERGLVKVNDKEV 196


>AB209991-1|BAE06073.1| 1287|Homo sapiens BCR variant protein
           protein.
          Length = 1287

 Score = 30.7 bits (66), Expect = 4.6
 Identities = 14/50 (28%), Positives = 25/50 (50%), Gaps = 1/50 (2%)
 Frame = +2

Query: 392 PNTTVWTMRQDYEKFRHGHANPGSGVAEADLVQAS-PHRAVIKKVHDAQI 538
           P  +V  +R ++E+ R GH  PG+   +   V     H   + KV+D ++
Sbjct: 163 PPASVAALRSNFERIRKGHGQPGADAEKPFYVNVEFHHERGLVKVNDKEV 212


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 102,956,209
Number of Sequences: 237096
Number of extensions: 2332401
Number of successful extensions: 4996
Number of sequences better than 10.0: 13
Number of HSP's better than 10.0 without gapping: 4791
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4991
length of database: 76,859,062
effective HSP length: 87
effective length of database: 56,231,710
effective search space used: 7141427170
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -